HHsearch alignment for GI: 254780170 and conserved domain: COG2113

>COG2113 ProX ABC-type proline/glycine betaine transport systems, periplasmic components [Amino acid transport and metabolism].
Probab=96.90  E-value=0.037  Score=33.98  Aligned_cols=117  Identities=15%  Similarity=0.217  Sum_probs=74.3

Q ss_pred             HHHHHHHHHCCCC-CEEEEEECCCCCCHHHHHCCCEEEEEECCCCCCCCH-------HCCCCCCCCCCCCC-CEEEEEEC
Q ss_conf             9999999967982-202599814310026774396279981243253201-------10278435322344-02346302
Q gi|254780170|r   63 FCRALSSAIFDDP-SKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLRE-------ISLGLAFRPITYFD-GQGFIMHK  133 (342)
Q Consensus        63 l~raiAaal~gd~-~kVe~v~~~~~~rf~aL~sG~vDil~~~~T~T~~Rd-------~~~~v~Fs~~~~~d-gq~~lVrk  133 (342)
T Consensus        45 ~~t~v~~~iLk~~Gy~v~~~~~~~~~~~~sla~gd~D~~~~~--W~p~~~~~~~~~~~~~~v~~~~~~~~Ga~~g~~vp~  122 (302)
T COG2113          45 ATTNVAKKILKGLGYTVELVTLDTAVMYQSLAKGDLDVFPEA--WLPTTPDDYKKAVKDKKVELGGTNLEGAKQGWAVPK  122 (302)
T ss_pred             HHHHHHHHHHHHCCCCCEEEECCHHHHHHHHHCCCCCCCCCE--ECCCCHHHHHHHHCCCCEEECCCCCCCCEEEEEECE
T ss_conf             999999999996799624665559999999973797532010--268875889987426854413546677247898240


Q ss_pred             CCC---CCCHHHHC-------CCCEEEEECCCHHHHHHHHHHHCCCC-CCEEEECCHHH
Q ss_conf             113---47536417-------86203431342699999999862998-50787479899
Q gi|254780170|r  134 KKG---ISSVSQLS-------GASICVQAGTTTELTLADYFKAHNMK-YHPIVFERVEE  181 (342)
Q Consensus       134 ~~~---i~s~~dL~-------G~~I~v~~GTT~e~~l~~~~~~~~~~-~~~v~~~~~~~  181 (342)
T Consensus       123 y~~d~~iksi~D~~~~~d~~~g~i~g~~pG~g~~~~~~~~~k~y~~~~~~~~lv~~s~~  181 (302)
T COG2113         123 YVADAGIKSIADLAKFKDKFGGKIYGIEPGWGCMRVIEDAIKAYGLGLKGFELVESSEA  181 (302)
T ss_pred             EHHHCCCCCHHHHHHCCCCCCCCEECCCCCCCHHHHHHHHHHHCCCCCCCEEEECCCHH
T ss_conf             03423556565698666877785781589973548999998643655364488447478