HHsearch alignment for GI: 254780170 and conserved domain: PRK09495

>PRK09495 glnH glutamine ABC transporter periplasmic protein; Reviewed.
Probab=100.00  E-value=6.4e-43  Score=292.17  Aligned_cols=224  Identities=21%  Similarity=0.219  Sum_probs=186.3

Q ss_pred             CHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHCCEEEEEEECCCCCCEEECCCCCEEEEHHHHHHHHHHHHCCCCCEEEE
Q ss_conf             91389999999999998401244216899985794999871789883068898988015099999999996798220259
Q gi|254780170|r    1 MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQY   80 (342)
Q Consensus         1 M~K~~l~~~l~l~~~~~~~~aa~a~tLd~Vk~rG~L~vGv~~~~ppfs~~d~~G~~~GfDVDl~raiAaal~gd~~kVe~   80 (342)
T Consensus         1 mk~~~~~~~~~~~~~~~~~~~a~---------~~~l~Vg~~~~~pPf~f~-~~g~~~GfdvDl~~~ia~~lg---~~~e~   67 (247)
T PRK09495          1 MKSVLKVSLAALTLAFAVSSHAA---------DKELVVATDTAFVPFEFK-QGDKYVGFDVDLWAAIAKELK---LDYTL   67 (247)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHC---------CCEEEEEECCCCCCEEEC-CCCEEEEEHHHHHHHHHHHHC---CCEEE
T ss_conf             97799999999999998766514---------994999989987980576-799278829999999999969---94699


Q ss_pred             EECCCCCCHHHHHCCCEEEEEECCCCCCCCHHCCCCCCCCCCCCCCEEEEEECC-CCCCCHHHHCCCCEEEEECCCHHHH
Q ss_conf             981431002677439627998124325320110278435322344023463021-1347536417862034313426999
Q gi|254780170|r   81 LPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKK-KGISSVSQLSGASICVQAGTTTELT  159 (342)
Q Consensus        81 v~~~~~~rf~aL~sG~vDil~~~~T~T~~Rd~~~~v~Fs~~~~~dgq~~lVrk~-~~i~s~~dL~G~~I~v~~GTT~e~~  159 (342)
T Consensus        68 ~~~~~~~~i~~l~~g~~D~~~~~~~~T~eR~~--~~~FS~py~~~~~~i~v~~~~~~i~~~~dL~Gk~v~v~~Gs~~~~~  145 (247)
T PRK09495         68 KPMDFSGIIPALQTKNIDLALAGITITDERKK--AIDFSDGYYKSGLLVMVKANNNDIKSVKDLDGKVVAVKSGTGSVDY  145 (247)
T ss_pred             EECCHHHHHHHHHCCCCCEEECCCCCCHHHHH--HCCCCCCCEEEEEEEEEECCCCCCCCHHHCCCCEEEEECCCHHHHH
T ss_conf             97788999999976995636466014789984--3334777077246999989997779824548988998469589999


Q ss_pred             HHHHHHHCCCCCCEEEECCHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCCHHHCCCCCCCCCCCEEEECCCCCHHHHH
Q ss_conf             99999862998507874798999999873960299825047999998367800100256444237101000277757999
Q gi|254780170|r  160 LADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYN  239 (342)
Q Consensus       160 l~~~~~~~~~~~~~v~~~~~~~a~~al~~Gr~DA~~~D~s~La~~~~~~~~p~~~~il~e~iskEPlg~avr~gD~~w~d  239 (342)
T Consensus       146 ~----~~~~~~~~i~~~~~~~~~~~aL~~GrvDa~v~d~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~ia~~k~~~-L~~  219 (247)
T PRK09495        146 A----KANIKTKDLRQFPNIDNAYLELGTGRADAVLHDTPNILYFIKTAG-NGQFKAVGDSLEAQQYGIAFPKGSD-LRE  219 (247)
T ss_pred             H----HHHCCCCCEEECCCHHHHHHHHHCCCEEEEEECHHHHHHHHHHCC-CCCEEEECCCCCCCEEEEEEECCHH-HHH
T ss_conf             9----963889866965988999998765873499956899999998489-9978994677776459999928829-999


Q ss_pred             HHHHHH
Q ss_conf             988774
Q gi|254780170|r  240 IVSWTH  245 (342)
Q Consensus       240 ~V~W~~  245 (342)
T Consensus       220 ~in~aL  225 (247)
T PRK09495        220 KVNGAL  225 (247)
T ss_pred             HHHHHH
T ss_conf             999999