HHsearch alignment for GI: 254780170 and conserved domain: PRK12680

>PRK12680 transcriptional regulator CysB-like protein; Reviewed.
Probab=96.94  E-value=0.038  Score=33.91  Aligned_cols=220  Identities=11%  Similarity=0.085  Sum_probs=137.8

Q ss_pred             HCCEEEEEEECCCCCCEEECCCCCEEEEHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHCCCEEEEEECCCCCCCCH
Q ss_conf             57949998717898830688989880150999999999967982202599814310026774396279981243253201
Q gi|254780170|r   32 KRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLRE  111 (342)
Q Consensus        32 ~rG~L~vGv~~~~ppfs~~d~~G~~~GfDVDl~raiAaal~gd~~kVe~v~~~~~~rf~aL~sG~vDil~~~~T~T~~Rd  111 (342)
T Consensus        91 ~~G~L~Ig~~~t~a~~~-----------LP~vi~~f~~-~y-P~V~l~l~~~~~~~l~e~l~~g~~Diai~~~~~~~~~~  157 (327)
T PRK12680         91 SQGQLTLTTTHTQARFV-----------LPPAVAQIKQ-AY-PQVSVHLQQAAESAALDLLGQGDADIAVVSTAGGEPSA  157 (327)
T ss_pred             CCEEEEEEEECHHHHHH-----------HHHHHHHHHH-HC-CCCEEEEEECCCHHHHHHHHCCCCCEEEECCCCCCCCC
T ss_conf             73379999842277775-----------6899999998-68-99679999898288999997899409994477779976


Q ss_pred             HCCCCCCCCCCCCCCEEEEEECCCC------CCCHHHHCCCC-EEEEECCCHHHHHHHHHHHCCCCCCEEE-ECCHHHHH
Q ss_conf             1027843532234402346302113------47536417862-0343134269999999986299850787-47989999
Q gi|254780170|r  112 ISLGLAFRPITYFDGQGFIMHKKKG------ISSVSQLSGAS-ICVQAGTTTELTLADYFKAHNMKYHPIV-FERVEEID  183 (342)
Q Consensus       112 ~~~~v~Fs~~~~~dgq~~lVrk~~~------i~s~~dL~G~~-I~v~~GTT~e~~l~~~~~~~~~~~~~v~-~~~~~~a~  183 (342)
T Consensus       158 -----~~~~pl~~~~~~vvvP~~HpL~~~~~~i~L~~La~~plI~~~~g~~~r~~id~af~~~Gl~P~iv~ea~~~d~Ik  232 (327)
T PRK12680        158 -----GIAVPLYRWRRLVVVPRGHALDTPRTAPDMAALAEHPLISYDSSTRPGSSLQRAFAQVGLEPSIALTALDADLIK  232 (327)
T ss_pred             -----CEEEEEEECCEEEEEECCCCCCCCCCCCCHHHHHCCCEEECCCCCCHHHHHHHHHHHCCCCCCEEEEECCHHHHH
T ss_conf             -----547675223579999789810058999999998089889638998679999999997799764799999599999


Q ss_pred             HHHHCCCEEEEEECCHHHHHHHHHCCCCHHHCCCCC--CCCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCHHHH
Q ss_conf             998739602998250479999983678001002564--442371010002777579999887744331121233015208
Q gi|254780170|r  184 AAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPD--IISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNI  261 (342)
Q Consensus       184 ~al~~Gr~DA~~~D~s~La~~~~~~~~p~~~~il~e--~iskEPlg~avr~gD~~w~d~V~W~~~ali~Aee~git~~nv  261 (342)
T Consensus       233 ~~V~~GlGV~Ivp~------mA~~~-~d~~l~~~~~~~l~~~~~~~~~~~~~~-----~lr~~~~~fi~~~~p~l~~~~~  300 (327)
T PRK12680        233 TYVRAGLGVGLVAE------MAVNA-FDEDLRAWPAPAPIAECIAWAVLPRDR-----VLRDYALDLVHVLAPQIDKRDL  300 (327)
T ss_pred             HHHHHCCEEEECHH------HHHCC-CCCCEEEEECCCCCCCCEEEEEEECCC-----HHHHHHHHHHHHHCCCCCHHHH
T ss_conf             99994986188164------76287-689838940645777560599997884-----6899999999986688899999


Q ss_pred             HHHHHCCCCHHHHHHHCCCCCCCCHHHCCCCHHHHH
Q ss_conf             988622671778876235887650333799867999
Q gi|254780170|r  262 NQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTY  297 (342)
Q Consensus       262 ~~~~~~s~~p~i~r~lg~~~~~~~g~~lgl~~~~~~  297 (342)
T Consensus       301 ~------------~~~~----~~~~~~~~~~~~~~~  320 (327)
T PRK12680        301 R------------RVLD----GNQAPNWPLPPTWES  320 (327)
T ss_pred             H------------HHHC----CCCCCCCCCCCCHHH
T ss_conf             9------------9826----888999999974898