HHsearch alignment for GI: 254780170 and conserved domain: TIGR00787

>TIGR00787 dctP TRAP transporter solute receptor, DctP family; InterPro: IPR004682 TRAP-T family proteins generally consist of three components, and these systems have so far been found in Gram-negative bacteria, Gram-positive bacteria and archaea. Only one member of the family has been both sequenced and functionally characterised. This system is the DctPQM system of Rhodobacter capsulatus. DctP is a periplasmic dicarboxylate (malate, fumarate, succinate) binding receptor that is biochemically well-characterised.; GO: 0006810 transport, 0030288 outer membrane-bounded periplasmic space.
Probab=92.67  E-value=0.097  Score=31.32  Aligned_cols=189  Identities=19%  Similarity=0.201  Sum_probs=106.6

Q ss_pred             CCCEEEEHHH-HHHHHHHHHCCCCCEEEEEE----C--CCCCCHHHHHCCCEEEEEECCCCCCCC-H-------------
Q ss_conf             8988015099-99999999679822025998----1--431002677439627998124325320-1-------------
Q gi|254780170|r   53 NGDWKGFDVD-FCRALSSAIFDDPSKIQYLP----L--NAKERFLALQSKQIDILSRNTDWTLLR-E-------------  111 (342)
Q Consensus        53 ~G~~~GfDVD-l~raiAaal~gd~~kVe~v~----~--~~~~rf~aL~sG~vDil~~~~T~T~~R-d-------------  111 (342)
T Consensus         7 ~~~p~~~AA~~Fa~lv~e~t~G~-~~i~~~P~s~LgPa~D~~~~~~l~~G~~d~~~~s~~~f~~la~p~~~v~dlPflF~   85 (267)
T TIGR00787         7 RSTPKHKAAEKFAKLVEEKTKGE-IKISVFPSSQLGPASDREMLEALRGGALDMTAPSSSKFTPLASPELAVLDLPFLFK   85 (267)
T ss_pred             CCCCHHHHHHHHHHHHHHHHCCE-EEEEECCCCCCCCCCHHHHHHHHHCCCEEEEECCCCCCCCCCCCHHHHHCCCHHHH
T ss_conf             99716589999999999865885-78997576347887769999984089548972576754233300687716762431


Q ss_pred             ----------------------HCC--CCCCCCCCCCCCEEEEEECCCCCCCHHHHCCCCEEEEECCCHHHHHHHHHHHC
Q ss_conf             ----------------------102--78435322344023463021134753641786203431342699999999862
Q gi|254780170|r  112 ----------------------ISL--GLAFRPITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAH  167 (342)
Q Consensus       112 ----------------------~~~--~v~Fs~~~~~dgq~~lVrk~~~i~s~~dL~G~~I~v~~GTT~e~~l~~~~~~~  167 (342)
T Consensus        86 d~~~~~Kvl~G~~vG~~L~~~~e~~~LG~~-~L~~w~nG~R~~t~~~~p~~~p~D~kGLKiRi~~s~~~~----~~~~~l  160 (267)
T TIGR00787        86 DTNHVHKVLDGSEVGKELLKSLEKKNLGLK-GLAYWDNGFRQFTSSKKPVTKPEDLKGLKIRIPASPVLE----AQFKAL  160 (267)
T ss_pred             CHHHHHHHHCCCHHHHHHHHHHHHHHCCCC-CHHHHHCCHHHHHCCCCCCCCCHHHCCCCCCCCCCHHHH----HHHHHC
T ss_conf             489999873665889999998887632400-003323314542214341246033258740259868999----999970


Q ss_pred             CCCCCEEEECCHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCCHHHCCCCCCCCCCCEEEECCCCCHHHHH----HHHH
Q ss_conf             998507874798999999873960299825047999998367800100256444237101000277757999----9887
Q gi|254780170|r  168 NMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYN----IVSW  243 (342)
Q Consensus       168 ~~~~~~v~~~~~~~a~~al~~Gr~DA~~~D~s~La~~~~~~~~p~~~~il~e~iskEPlg~avr~gD~~w~d----~V~W  243 (342)
T Consensus       161 GA~P~~~---~F~EvY~ALq~gvVDgqENP~s~~~s~KlY--EVqKyL~~tn-H~y~g~~v~~--n~~~w~~L~~dl~~~  232 (267)
T TIGR00787       161 GANPEPM---AFSEVYTALQTGVVDGQENPLSNIYSSKLY--EVQKYLSLTN-HGYLGYLVVV--NKAFWKSLPPDLQAV  232 (267)
T ss_pred             CCCCCCC---CHHHHHHHHHCCCCCCCCCCHHHHHHHHHH--HHHHHHHHHH-HHHCCCCEEE--EHHHHHCCCHHHHHH
T ss_conf             8998412---658999987548101004672776210212--3643453310-3032620275--036743187889999


Q ss_pred             HHHHHHHHHHHH
Q ss_conf             744331121233
Q gi|254780170|r  244 THYAMVTAEELG  255 (342)
Q Consensus       244 ~~~ali~Aee~g  255 (342)
T Consensus       233 ~~~A~~ea~~~~  244 (267)
T TIGR00787       233 VKEAAKEATEYQ  244 (267)
T ss_pred             HHHHHHHHHHHH
T ss_conf             999999999988