HHsearch alignment for GI: 254780170 and conserved domain: pfam00497

>pfam00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3.
Probab=100.00  E-value=4.9e-31  Score=216.91  Aligned_cols=205  Identities=25%  Similarity=0.374  Sum_probs=175.3

Q ss_pred             EEEEEECCCCCCEEECCCCCEEEEHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHCCCEEEEEECCCCCCCCHHCCC
Q ss_conf             99987178988306889898801509999999999679822025998143100267743962799812432532011027
Q gi|254780170|r   36 LKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLG  115 (342)
Q Consensus        36 L~vGv~~~~ppfs~~d~~G~~~GfDVDl~raiAaal~gd~~kVe~v~~~~~~rf~aL~sG~vDil~~~~T~T~~Rd~~~~  115 (342)
T Consensus         1 l~v~~~~~~pP~~~~~~~G~~~G~~~dil~~i~~~lg---~~~~~~~~p~~~~~~~l~~g~~D~~~~~~~~t~~R~~--~   75 (224)
T pfam00497         1 LRVGTDADYPPFSYLDEDGKLVGFDVDLAKAIAKRLG---VKVEFVPVSWDGLIPALQSGKIDVIIAGMTITPERKK--K   75 (224)
T ss_pred             CEEEECCCCCCCEEECCCCCEEEEHHHHHHHHHHHHC---CCEEEEECCHHHHHHHHHCCCCCEEECCCCCCHHHHH--H
T ss_conf             9899589989915999999788829999999999979---9679998588999999976998766136778855510--2


Q ss_pred             CCCCCCCCCCCEEEEEECCC-----CCCCHHHHCCCCEEEEECCCHHHHHHHHHHHCCCCCCEEEECCHHHHHHHHHCCC
Q ss_conf             84353223440234630211-----3475364178620343134269999999986299850787479899999987396
Q gi|254780170|r  116 LAFRPITYFDGQGFIMHKKK-----GISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHR  190 (342)
Q Consensus       116 v~Fs~~~~~dgq~~lVrk~~-----~i~s~~dL~G~~I~v~~GTT~e~~l~~~~~~~~~~~~~v~~~~~~~a~~al~~Gr  190 (342)
T Consensus        76 ~~~s~p~~~~~~~~~~~~~~~~~~~~~~~~~dL~~~~I~v~~g~~~~~~l~~~~---~~~~~i~~~~~~~~~l~~L~~gr  152 (224)
T pfam00497        76 VDFSDPYYYSGQVLVVRKDSPPKIKSIKDLADLKGKKVGVQKGTTQEDLLKELA---PKGAEIVLYDDQAEALQALAAGR  152 (224)
T ss_pred             HCCCCCEEECCEEEEEECCCCCCCCCCCCHHHHCCCEEEEECCCHHHHHHHHHC---CCCCEEEEECCHHHHHHHHHCCC
T ss_conf             125753440471799998987654565898997797799968977999998606---24451699542788888987497


Q ss_pred             EEEEEECCHHHHHHHHHCCCCHHHCCCCCCCCCCCEEEECCCCCHHHHHHHHHHHHHHHH
Q ss_conf             029982504799999836780010025644423710100027775799998877443311
Q gi|254780170|r  191 CDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVT  250 (342)
Q Consensus       191 ~DA~~~D~s~La~~~~~~~~p~~~~il~e~iskEPlg~avr~gD~~w~d~V~W~~~ali~  250 (342)
T Consensus       153 ~D~~i~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~k~~~~l~~~~n~~l~~l~~  210 (224)
T pfam00497       153 VDAVVADSPVAAYLIKKN--PGLNLVVGEPLSGEPYGIAVRKGDPELLAAVNKALAELKA  210 (224)
T ss_pred             EEEEEECHHHHHHHHHHC--CCCEEEECCCCCCCEEEEEEECCCHHHHHHHHHHHHHHHH
T ss_conf             689995799999999868--9972994367776149999979999999999999999996