HHsearch alignment for GI: 254780170 and conserved domain: smart00079

>smart00079 PBPe Eukaryotic homologues of bacterial periplasmic substrate binding proteins. Prokaryotic homologues are represented by a separate alignment: PBPb
Probab=97.97  E-value=4.1e-05  Score=52.68  Aligned_cols=109  Identities=16%  Similarity=0.097  Sum_probs=81.0

Q ss_pred             CCCCHHHHCC---CCEEEEECCCHHHHHHHHHHHCCCC-----------CCEEEECCHHHHHHHHHCCCEEEEEECCHHH
Q ss_conf             3475364178---6203431342699999999862998-----------5078747989999998739602998250479
Q gi|254780170|r  136 GISSVSQLSG---ASICVQAGTTTELTLADYFKAHNMK-----------YHPIVFERVEEIDAAYRAHRCDAYTGDISAL  201 (342)
Q Consensus       136 ~i~s~~dL~G---~~I~v~~GTT~e~~l~~~~~~~~~~-----------~~~v~~~~~~~a~~al~~Gr~DA~~~D~s~L  201 (342)
T Consensus         1 pI~s~~DL~~q~~i~yGtv~~ss~~~fF----~~s~~~~y~~mw~~m~~~~~~~v~~~~eGv~rv~~g~-yAfi~e~~~l   75 (134)
T smart00079        1 PITSVEDLAKQTKIEYGTIRGSSTLAFF----KRSGNPEYSRMWNYMSASPSVFVKSYAEGVQRVRVSN-YAFLMESTYL   75 (134)
T ss_pred             CCCCHHHHHCCCCCEEEEECCCHHHHHH----HHCCCHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHCC-CEEECCCHHH
T ss_conf             9799899842887201687896389998----8778658999999986285556677899999998078-2355051478


Q ss_pred             HHHHHHCCCCHHHCCCCCCCCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             9999836780010025644423710100027775799998877443311212330
Q gi|254780170|r  202 YALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGI  256 (342)
Q Consensus       202 a~~~~~~~~p~~~~il~e~iskEPlg~avr~gD~~w~d~V~W~~~ali~Aee~gi  256 (342)
T Consensus        76 ~y~~~---~~C~l~~vG~~f~~~~ygia~~kg-Sp~~~~is~---~Il~l~e~G~  123 (134)
T smart00079       76 DYELS---QNCDLMTVGENFGRKGYGIAFPKG-SPLRDDLSR---AILKLSESGE  123 (134)
T ss_pred             HHHHC---CCCCEEEECEEEECCCEEEEECCC-CHHHHHHHH---HHHHHHHCCH
T ss_conf             99860---678748953066415457883399-814999999---9999885787