HHsearch results for GI: 254780170 and protein with PDBid: 2de3_A

>2de3_A Dibenzothiophene desulfurization enzyme B; alpha-beta, hydrolase; HET: OBP; 1.60A {Rhodococcus SP} PDB: 2de4_A* 2de2_A
Probab=99.06  E-value=2.7e-09  Score=77.77  Aligned_cols=127  Identities=15%  Similarity=0.090  Sum_probs=91.3

Q ss_pred             CEEEEEEC-CCCCCHHHHHCCCEEEEEECCCCCCCCHHCCCCCC--CCCCCC-CCEEEEEECCCCCCCHHHHCCCCEEEE
Q ss_conf             20259981-43100267743962799812432532011027843--532234-402346302113475364178620343
Q gi|254780170|r   76 SKIQYLPL-NAKERFLALQSKQIDILSRNTDWTLLREISLGLAF--RPITYF-DGQGFIMHKKKGISSVSQLSGASICVQ  151 (342)
Q Consensus        76 ~kVe~v~~-~~~~rf~aL~sG~vDil~~~~T~T~~Rd~~~~v~F--s~~~~~-dgq~~lVrk~~~i~s~~dL~G~~I~v~  151 (342)
                      .+|+++.. .+...+.+|.+|++|+....... ..+....+.+.  ...++. .+++++|+++++|++++||+||+|++.
T Consensus        47 ldV~~~~~~~~~~~~~al~~G~~D~~~~~~~~-~~~a~~~g~~~~~i~~~~~~~~~~l~v~~~s~I~s~~DLkGk~i~v~  125 (365)
T 2de3_A           47 IELDVLSGQQGTVHFTYDQPAYTRFGGEIPPL-LSEGLRAPGRTRLLGITPLLGRQGFFVRDDSPITAAADLAGRRIGVS  125 (365)
T ss_dssp             CEEEECBGGGTTHHHHCCSTTEEEEECSHHHH-HHHHTTCTTSEEEEEEEEECCSEEEEEETTCSCCSGGGGTTCEEEEC
T ss_pred             CCEEEEECCCCHHHHHHHHCCCCCEEEECHHH-HHHHHHCCCCEEEEEEEECCCCEEEEEECCCCCCCHHHHCCCEEECC
T ss_conf             91799967882799999975983789305899-99997489986999997438850899978877788699789835025


Q ss_pred             --------------------------ECCCHHHHHHHHHHHCCCC---CCEEEECC------------------------
Q ss_conf             --------------------------1342699999999862998---50787479------------------------
Q gi|254780170|r  152 --------------------------AGTTTELTLADYFKAHNMK---YHPIVFER------------------------  178 (342)
Q Consensus       152 --------------------------~GTT~e~~l~~~~~~~~~~---~~~v~~~~------------------------  178 (342)
                                                .||+++..+..+++..|++   +++|..+.                        
T Consensus       126 ~~~~~~~~~~~~~~~~~~~~~~~~~~~gs~~~~~l~~~l~~~Gl~~~dV~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~  205 (365)
T 2de3_A          126 ASAIRILRGQLGDYLELDPWRQTLVALGSWEARALLHTLEHGELGVDDVELVPISSPGVDVPAEQLEESATVKGADLFPD  205 (365)
T ss_dssp             HHHHHHHHTCCTTGGGSCHHHHHHHHTTHHHHHHHHHHHHHTTCCGGGSEEEECCCTTTCCCHHHHHHSSBSSHHHHSTT
T ss_pred             CCCCCHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCHHHEEEEECCCHHHHHHHHHHHHCCCCCCCCCCCC
T ss_conf             66420135666543102333212457786799999999998499989937620480444444431000013444321234


Q ss_pred             -HHHHHHHHHCCCEEEEEECCHHHHH
Q ss_conf             -8999999873960299825047999
Q gi|254780170|r  179 -VEEIDAAYRAHRCDAYTGDISALYA  203 (342)
Q Consensus       179 -~~~a~~al~~Gr~DA~~~D~s~La~  203 (342)
                       .....++|.+|++||++.-.+...-
T Consensus       206 ~~~~~~aAL~~G~VDA~~~~~P~~~~  231 (365)
T 2de3_A          206 VARGQAAVLASGDVDALYSWLPWAGE  231 (365)
T ss_dssp             HHHHHHHHHHSSSCSEEEEEHHHHHH
T ss_pred             CCHHHHHHHHCCCEEEEEECCHHHHH
T ss_conf             42048999976982699965755999