HHsearch results for GI: 254780170 and protein with PDBid: 2ql3_A

>2ql3_A Probable transcriptional regulator, LYSR family protein; APC7314, rhodococcus SP. RHA1, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.05A {Rhodococcus SP}
Probab=97.37  E-value=0.0077  Score=36.93  Aligned_cols=181  Identities=9%  Similarity=-0.025  Sum_probs=112.5

Q ss_pred             HCCEEEEEEECCCCCCEEECCCCCEEEEHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHCCCEEEEEECCCCCCCCH
Q ss_conf             57949998717898830688989880150999999999967982202599814310026774396279981243253201
Q gi|254780170|r   32 KRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLRE  111 (342)
Q Consensus        32 ~rG~L~vGv~~~~ppfs~~d~~G~~~GfDVDl~raiAaal~gd~~kVe~v~~~~~~rf~aL~sG~vDil~~~~T~T~~Rd  111 (342)
                      -+|.|++|+.+.....           +-.++.+.+.+.-  ...++++...++.+....|.+|++|+.+....   .. 
T Consensus         3 ~~G~lrIg~~~~~~~~-----------~l~~~l~~f~~~~--P~v~l~i~~~~~~~l~~~l~~g~~Dl~i~~~~---~~-   65 (209)
T 2ql3_A            3 VAGPIAVGCYPALGPT-----------ILPSMLYAFTAEY--PRASVEFREDTQNRLRTQLEGGELDVAIVYDL---DL-   65 (209)
T ss_dssp             CCEEEEEEECGGGTTT-----------THHHHHHHHHHHC--TTEEEEEEECCHHHHHHHHHTTSCSEEEEESS---SC-
T ss_pred             CCEEEEEEEEHHHHHH-----------HHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHCCCCEEEEEECC---CC-
T ss_conf             4289999968899999-----------9999999999988--79389999898289998760798358853046---54-


Q ss_pred             HCCCCCCCCCCCCCCEEEEEECCC------CCCCHHHHCCCCEEEEECCCHHHHHHHHHHHCCCCCCEE-EECCHHHHHH
Q ss_conf             102784353223440234630211------347536417862034313426999999998629985078-7479899999
Q gi|254780170|r  112 ISLGLAFRPITYFDGQGFIMHKKK------GISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPI-VFERVEEIDA  184 (342)
Q Consensus       112 ~~~~v~Fs~~~~~dgq~~lVrk~~------~i~s~~dL~G~~I~v~~GTT~e~~l~~~~~~~~~~~~~v-~~~~~~~a~~  184 (342)
                       ...+.+. +.+.+...++++++.      +.-++++|.+.......+......+.+++.+.+...+++ .+++...+..
T Consensus        66 -~~~~~~~-~~~~~~~~~v~~~~~~la~~~~~i~~~~l~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  143 (209)
T 2ql3_A           66 -SPEWQTV-PLMTREPMVVLGAEHPLAGVDGPVRLADLAEHPMVLLDAPPSTNHAMDVCREAGFAPRVAYRTANFETARA  143 (209)
T ss_dssp             -CTTEEEE-EEEEECCEEEEETTCGGGGCCSCBCGGGGTTSCEEEECCTTHHHHHHHHHHHHTCCCCEEEEESCHHHHHH
T ss_pred             -CCCHHEE-CCCCCCCCCCCCCCCHHHHCCCCCCHHHHHCCCEEECCCCCHHHHHHHHHHHCCCCCEEEEEECCHHHHHH
T ss_conf             -2000000-01211222224689834517996679988339856328995188999999974999506998263777899


Q ss_pred             HHHCCCEEEEEECCHHHHHHHHHCCCCHHHCCCC--CCC-CCCCEEEECCCCCH
Q ss_conf             9873960299825047999998367800100256--444-23710100027775
Q gi|254780170|r  185 AYRAHRCDAYTGDISALYALKLTNDRPSEHVILP--DII-SKSPLAPAIIQGDT  235 (342)
Q Consensus       185 al~~Gr~DA~~~D~s~La~~~~~~~~p~~~~il~--e~i-skEPlg~avr~gD~  235 (342)
                      ...+|..=+++.+.....    ...+.....+.|  +.. ..-++..+.|++..
T Consensus       144 lv~~g~Gi~~lp~~~~~~----~~~~~~~~~~~pl~~~~~~~~~i~l~~~~~~~  193 (209)
T 2ql3_A          144 FVGRGLGWTLLLQRPRVD----VTYEGLPVVVKPIAEPKPASVAVVVAWHQEAT  193 (209)
T ss_dssp             HHHHTSCBEEESCCCSSC----BCTTSCBEEEEEBCSSCCCCEEEEEEEETTCC
T ss_pred             HHHCCCEEEEEEHHHHHH----HHHCCCCEEEEECCCCCCCEEEEEEEECCCCC
T ss_conf             998199599902688877----86479978999778888744799999919897