HHsearch results for GI: 254780170 and protein with PDBid: 2vpn_A

>2vpn_A Periplasmic substrate binding protein; ectoine, hydroxyectoine, trap-transporter, periplasmic binding protein, transport; HET: 4CS; 1.55A {Halomonas elongata} PDB: 2vpo_A* 3gyy_A
Probab=97.24  E-value=0.0014  Score=41.57  Aligned_cols=164  Identities=13%  Similarity=0.075  Sum_probs=94.0

Q ss_pred             CCCEEE-EHHHHHHHHHHHHCCCCCEEEEEE----CCCCCCHHHHHCCCEEEEEECCCCCCCCHHCCCCCCCCCCCC---
Q ss_conf             898801-509999999999679822025998----143100267743962799812432532011027843532234---
Q gi|254780170|r   53 NGDWKG-FDVDFCRALSSAIFDDPSKIQYLP----LNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYF---  124 (342)
Q Consensus        53 ~G~~~G-fDVDl~raiAaal~gd~~kVe~v~----~~~~~rf~aL~sG~vDil~~~~T~T~~Rd~~~~v~Fs~~~~~---  124 (342)
                      .|.+.+ +--.+++.|.++-.|   +|++-|    ....+.+.++++|.+|+.....+....+.-...+ |..|+++   
T Consensus        11 ~g~~~~~~~~~fa~~v~e~t~G---~v~i~~~g~Lg~~~e~~~~v~~G~id~~~~~~~~~~~~~p~~~v-~~lP~~~~s~   86 (316)
T 2vpn_A           11 EGDVQDVFAQAFKGYVEDNSDH---TVQVYRFGELGESDDIMEQTQNGILQFVNQSPGFTGSLIPSAQI-FFIPYLMPTD   86 (316)
T ss_dssp             TTSHHHHHHHHHHHHHHHSSSC---EEEEECTTCC----CHHHHHHTTSCSEEEECHHHHHHHSGGGGG-GGSTTCSCSS
T ss_pred             CCCHHHHHHHHHHHHHHHHCCC---EEEEEECCEECCHHHHHHHHHCCCCCEEEECHHHHHHHCHHHHH-HHCCHHHHHH
T ss_conf             9998899999999999986698---79999899127779999999779838898766665102512566-6162254669


Q ss_pred             ----------------------------------CCEEEEEECCCCCCCHHHHCCCCEEEEECCCHHHHHHHHHHHCCCC
Q ss_conf             ----------------------------------4023463021134753641786203431342699999999862998
Q gi|254780170|r  125 ----------------------------------DGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMK  170 (342)
Q Consensus       125 ----------------------------------dgq~~lVrk~~~i~s~~dL~G~~I~v~~GTT~e~~l~~~~~~~~~~  170 (342)
                                                        .|...+. .+..|++++||+|+||-+..+.+.    .++++..|. 
T Consensus        87 ~~~~~~~~~~~~~~~~~~~~~~~~~gv~~L~~~~~g~~~~~-t~~pi~s~~DLkG~kiR~~~~~~~----~~~~~~lGa-  160 (316)
T 2vpn_A           87 MDTVLEFFDESKAINEMFPKLYAEHGLELLKMYPEGEMVVT-ADEPITSPEDFDNKKIRTMTNPLL----AETYKAFGA-  160 (316)
T ss_dssp             HHHHHHHHHHCHHHHTHHHHHHHTTTEEEEEEEEEEEEEEE-ESSCCCSGGGGTTCEEEECSCHHH----HHHHHHHTC-
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEECCCCEEEE-CCCCCCCHHHHCCCEEEECCCCHH----HHHHHHCCC-
T ss_conf             99999853005789999999998619677787147853553-698889978976880762488058----999997598-


Q ss_pred             CCEEEECCHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCCHHHCCCCCCCCCCCEEEECC
Q ss_conf             5078747989999998739602998250479999983678001002564442371010002
Q gi|254780170|r  171 YHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAII  231 (342)
Q Consensus       171 ~~~v~~~~~~~a~~al~~Gr~DA~~~D~s~La~~~~~~~~p~~~~il~e~iskEPlg~avr  231 (342)
                       .++.. ...+.+.+|++|.+|+..+..+.+.+.  ++..--+|.+.+. +..-+..+++.
T Consensus       161 -~pv~~-p~~evy~aLq~G~iDg~~~~~~~~~~~--~~~ev~~y~~~~~-~~~~~~~~~~n  216 (316)
T 2vpn_A          161 -TPTPL-PWGEVYGGLQTGIIDGQENPIFWIESG--GLYEVSPNLTFTS-HGWFTTAMMAN  216 (316)
T ss_dssp             -EEEEC-CGGGHHHHHHHTSCSEEEEEHHHHHHT--TGGGTCCEEEECC-CCEEEEEEEEE
T ss_pred             -CCCCC-CCCCCCHHHHCCCEEEEECCCCCCCCC--CEEEEECCEECCC-CCCCHHHHHHH
T ss_conf             -43245-300123065358610475252100122--0011104413143-33433687743