HHsearch results for GI: 254780170 and protein with PDBid: 3b50_A

>3b50_A Sialic acid-binding periplasmic protein SIAP; periplasmic binding protein, trap, sugar transport, transport, transport protein; HET: SLB; 1.40A {Haemophilus influenzae} PDB: 2v4c_A* 2cey_A 2cex_A
Probab=97.81  E-value=0.00035  Score=45.38  Aligned_cols=156  Identities=14%  Similarity=0.167  Sum_probs=95.4

Q ss_pred             HHHHHHHHHHCCCCCEEEEEECC----CCCCHHHHHCCCEEEEEECCCCCCCCHHCCCCCCCCCC---------------
Q ss_conf             99999999967982202599814----31002677439627998124325320110278435322---------------
Q gi|254780170|r   62 DFCRALSSAIFDDPSKIQYLPLN----AKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPIT---------------  122 (342)
Q Consensus        62 Dl~raiAaal~gd~~kVe~v~~~----~~~rf~aL~sG~vDil~~~~T~T~~Rd~~~~v~Fs~~~---------------  122 (342)
                      .+++.|.++..|. .+|++-|-.    ..+.+.+|++|.+|+.....+....+.-..++ |..|+               
T Consensus        23 ~fa~~V~e~t~G~-v~v~v~~~g~Lg~~~e~~~av~~G~vd~~~~~~~~~~~~~p~~~~-~~lP~~~~~~~~~~~~~~~~  100 (310)
T 3b50_A           23 MFAKEVKEKSQGK-IEISLYPSSQLGDDRAMLKQLKDGSLDFTFAESARFQLFYPEAAV-FALPYVISNYNVAQKALFDT  100 (310)
T ss_dssp             HHHHHHHHHTTTS-EEEEEECTTTTCCHHHHHHHHHHTSCCEEEECGGGGGGTSGGGGG-GGSTTTSCSHHHHHHHHHSS
T ss_pred             HHHHHHHHHCCCE-EEEEEECCCCCCCHHHHHHHHHCCCCCEEEECHHHHCCCCCHHHH-CCCCCCCCCHHHHHHHHHCC
T ss_conf             9999999976994-999996698748879999999779957897533332445803442-15765679879888887511


Q ss_pred             ---------------------CCCCEEEEEECCCCCCCHHHHCCCCEEEEECCCHHHHHHHHHHHCCCCCCEEEECCHHH
Q ss_conf             ---------------------34402346302113475364178620343134269999999986299850787479899
Q gi|254780170|r  123 ---------------------YFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEE  181 (342)
Q Consensus       123 ---------------------~~dgq~~lVrk~~~i~s~~dL~G~~I~v~~GTT~e~~l~~~~~~~~~~~~~v~~~~~~~  181 (342)
                                           +..|...+. .+..|++++||+|+||-+..+...    .++++.-|.  +++.. ...+
T Consensus       101 ~~~~~~~~~~~~~~~v~~l~~~~~g~~~~~-~~~pi~s~~DlkG~kiRv~~~~~~----~~~~~~lGa--~pv~~-~~~e  172 (310)
T 3b50_A          101 EFGKDLIKKMDKDLGVTLLSQAYNGTRQTT-SNRAINSIADMKGLKLRVPNAATN----LAYAKYVGA--SPTPM-AFSE  172 (310)
T ss_dssp             HHHHHHHHHHHHHHCEEEEEEEEEEEEEEE-ESSCCCSGGGGTTCEEEECSCHHH----HHHHHHTTC--EEEEC-CGGG
T ss_pred             HHHHHHHHHHHHHCCEEEEEECCCCCCCCC-CCCCCCCHHHHCCCEEECCCCCHH----HHHHHHCCC--EEEEE-CCCC
T ss_conf             889999999987569368763157621146-798999968967884643686054----679997397--53673-5641


Q ss_pred             HHHHHHCCCEEEEEECCHHHHHHHHHCCCCHHHCCCCCCCCCCCEEEEC
Q ss_conf             9999873960299825047999998367800100256444237101000
Q gi|254780170|r  182 IDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAI  230 (342)
Q Consensus       182 a~~al~~Gr~DA~~~D~s~La~~~~~~~~p~~~~il~e~iskEPlg~av  230 (342)
                      .+.+|++|.+|+..+..+...+.+  +....+|..... ...-+..+++
T Consensus       173 vy~aLq~G~vDg~~~~~~~~~~~~--~~ev~~y~~~~~-~~~~~~~~~~  218 (310)
T 3b50_A          173 VYLALQTNAVDGQENPLAAVQAQK--FYEVQKFLAMTN-HILNDQLYLV  218 (310)
T ss_dssp             HHHHHHTTSSSEEEEEHHHHHHTT--GGGSCSEEECCC-CCEEEEEEEE
T ss_pred             HHHHHHCCCCCCCCCCCHHHHHCC--CEEEEEEEECCC-CCCEEHHEEE
T ss_conf             568987598653327610012033--125546763277-5210001013