HHsearch results for GI: 254780170 and protein with PDBid: 3g41_A

>3g41_A Amino acid ABC transporter, periplasmic amino acid-binding protein; aminoacid transporter, structural genomics, bacabs EU FP6 programme; HET: ARG; 2.10A {Chlamydophila pneumoniae} PDB: 3n26_A*
Probab=100.00  E-value=4.7e-32  Score=221.95  Aligned_cols=211  Identities=18%  Similarity=0.149  Sum_probs=176.0

Q ss_pred             HHHHHCCEEEEEEECCCCCCEEECCCCCEEEEHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHCCCEEEEEECCCCC
Q ss_conf             99985794999871789883068898988015099999999996798220259981431002677439627998124325
Q gi|254780170|r   28 GDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWT  107 (342)
Q Consensus        28 d~Vk~rG~L~vGv~~~~ppfs~~d~~G~~~GfDVDl~raiAaal~gd~~kVe~v~~~~~~rf~aL~sG~vDil~~~~T~T  107 (342)
                      .+|+++++|+||++.++|||+|.|++|+++||++|+++++|+.++   .+++|+.++|..++.+|++|++|++++++++|
T Consensus         4 ~~~~~~~~l~Vg~~~~~~P~~~~~~~g~~~G~~~dl~~~ia~~lg---~~~~~~~~~~~~~~~~l~~g~~d~i~~~~~~~   80 (246)
T 3g41_A            4 SKIDRNRIWIVGTNATYPPFEYVDAQGEVVGFDIDLAKAISEKLG---KQLEVREFAFDALILNLKKHRIDAILAGMSIT   80 (246)
T ss_dssp             ---CCCCEEEEEECSCBTTTBEECTTSCEESHHHHHHHHHHHHHT---CEEEEEECCGGGHHHHHHTTSSSEECSCCBCC
T ss_pred             CHHCCCCCEEEEECCCCCCCEEECCCCCEEEEHHHHHHHHHHHHC---CCEEEEECCHHHHHHHHHCCCCCEEEEECCCC
T ss_conf             202058959999899889934899999888729999999999969---96699988989999999759988796623158


Q ss_pred             CCCHHCCCCCCCCCCCCCCEEEEEECCC--CCCCHHHHCCCCEEEEECCCHHHHHHHHHHHCCCCCCEEEECCHHHHHHH
Q ss_conf             3201102784353223440234630211--34753641786203431342699999999862998507874798999999
Q gi|254780170|r  108 LLREISLGLAFRPITYFDGQGFIMHKKK--GISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAA  185 (342)
Q Consensus       108 ~~Rd~~~~v~Fs~~~~~dgq~~lVrk~~--~i~s~~dL~G~~I~v~~GTT~e~~l~~~~~~~~~~~~~v~~~~~~~a~~a  185 (342)
                      ++|+  ..++|++||+...+.++++++.  .+++.++|+|++|||+.||+.+..+    .. ...++++.|++..+++.+
T Consensus        81 ~~r~--~~~~fs~~~~~~~~~l~~~~~~~~~~~~~~~l~~~~Igv~~gs~~~~~l----~~-~~~~~~~~~~~~~~~~~~  153 (246)
T 3g41_A           81 PSRQ--KEIALLPYYGDEVQELMVVSKRSLETPVLPLTQYSSVAVQTGTYQEHYL----LS-QPGICVRSFDSTLEVIME  153 (246)
T ss_dssp             HHHH--TTSEEEEEECCCBCEEEEEEETTCCSCSCCGGGSSCEEEETTSHHHHHH----HT-STTCCEEEESCHHHHHHH
T ss_pred             HHHC--CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECCHHHHHH----HH-CCCCEEEEECHHHHHHHH
T ss_conf             6660--3434342333334332112222344441001234058885153799999----83-887538983407878889


Q ss_pred             HHCCCEEEEEECCHHHHHHHHHCCCCHH-HCCCCCCCCCCCEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             8739602998250479999983678001-00256444237101000277757999988774433
Q gi|254780170|r  186 YRAHRCDAYTGDISALYALKLTNDRPSE-HVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAM  248 (342)
Q Consensus       186 l~~Gr~DA~~~D~s~La~~~~~~~~p~~-~~il~e~iskEPlg~avr~gD~~w~d~V~W~~~al  248 (342)
                      |.+||+|+++.|...+.......++... ...++.....++++++++++|++|.+.++..+..|
T Consensus       154 L~~GriD~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~k~~~~L~~~in~~l~~~  217 (246)
T 3g41_A          154 VRYGKSPVAVLEPSVGRVVLKDFPNLVATRLELPPECWVLGCGLGVAKDRPEEIQTIQQAITDL  217 (246)
T ss_dssp             HHTTSSSEEEECHHHHHHHGGGCTTEEEEEEECCGGGCBCCEEEEECTTCHHHHHHHHHHHHHH
T ss_pred             HHCCCCCHHHHCHHHHHHHHHHCCCCCCEEECCCCCCCCEEEEEEEECCCHHHHHHHHHHHHHH
T ss_conf             8759843113069999999985456530232258754430389999698999999999999999