HHsearch results for GI: 254780170 and protein with PDBid: 3l6g_A

>3l6g_A Betaine ABC transporter permease and substrate BI protein; glycine betaine binding, substrate binding domain, venus FLY cell membrane; HET: B3P; 1.90A {Lactococcus lactis} PDB: 3l6h_A
Probab=96.11  E-value=0.039  Score=32.43  Aligned_cols=120  Identities=11%  Similarity=0.128  Sum_probs=72.2

Q ss_pred             CEEEEEECCCCCCHHHHHCCCEEEEEECCCCCCCCH------HCCCCCCCCCCCCC-CEEEEEECCCCCCCHHHHCCCCE
Q ss_conf             202599814310026774396279981243253201------10278435322344-02346302113475364178620
Q gi|254780170|r   76 SKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLRE------ISLGLAFRPITYFD-GQGFIMHKKKGISSVSQLSGASI  148 (342)
Q Consensus        76 ~kVe~v~~~~~~rf~aL~sG~vDil~~~~T~T~~Rd------~~~~v~Fs~~~~~d-gq~~lVrk~~~i~s~~dL~G~~I  148 (342)
                      .+||.+..+....+++|.+|+||+....  |.+...      ...++.-..+.+.. .+++.|++..++++++||++..-
T Consensus        30 y~Ve~~~~~~~~~~~al~~G~iDi~~e~--w~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~vp~~~~i~si~dl~~~~~  107 (256)
T 3l6g_A           30 FDVKTTALDNAVAWQTVANGQADGMVSA--WLPNTHKTQWQKYGKSVDLLGPNLKGAKVGFVVPSYMNVNSIEDLTNQAN  107 (256)
T ss_dssp             EEEEEEECCHHHHHHHHHTTSSSEEEEE--EETTTTHHHHHHHGGGEEEEEEEEEEEEEEEEEETTSCCCBGGGCSSGGG
T ss_pred             CCEEEEECCCHHHHHHHHCCCCCEEEEC--CCCHHHHHHHHHCCCCEEECCCCCCCCEEEEEECCCCCCCCHHHHHHHHH
T ss_conf             9459987884899999987998298511--43245566676326765880224678626898755124025778765664


Q ss_pred             EEEECCCHH----HHHHHHHHHCCC--CCCEEEECCHH----HHHHHHHCCCEEEEEECC
Q ss_conf             343134269----999999986299--85078747989----999998739602998250
Q gi|254780170|r  149 CVQAGTTTE----LTLADYFKAHNM--KYHPIVFERVE----EIDAAYRAHRCDAYTGDI  198 (342)
Q Consensus       149 ~v~~GTT~e----~~l~~~~~~~~~--~~~~v~~~~~~----~a~~al~~Gr~DA~~~D~  198 (342)
                      ....|....    ......+...+.  .++++ ..+..    +...|+.+|+++.+..-.
T Consensus       108 ~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~a~~~~A~~~~~~~v~~~w~  166 (256)
T 3l6g_A          108 KTITGIEPGAGVMAASEKTLNSYDNLKDWKLV-PSSSGAMTVALGEAIKQHKDIVITGWS  166 (256)
T ss_dssp             GEEECCCTTCHHHHHHHHHHTTCGGGTTCEEE-CCCHHHHHHHHHHHHHTTCCCCEEEEE
T ss_pred             HCCCCCCCCCCCCCCCHHHHHHCCCCCCCEEE-CCCCHHHHHHHHHHHHCCCCEEEEECC
T ss_conf             04436786544241137677540345443120-465077899999997647977999506