HHsearch results for GI: 254780170 and protein with PDBid: 3myu_A

>3myu_A High affinity transport system protein P37; Mg289, CYPL, extracytoplasmic, thiamine binding protein, lipoprotein; HET: VIB; 1.95A {Mycoplasma genitalium}
Probab=98.22  E-value=2e-07  Score=65.90  Aligned_cols=206  Identities=12%  Similarity=0.096  Sum_probs=111.0

Q ss_pred             HCCEEEEEEECCCCCCEEECCCCCEEEEHHHHHHHHHHHHCCCCCEEEEEE-CCCCCCHHHHHCCCEEEEEECCC-CCCC
Q ss_conf             579499987178988306889898801509999999999679822025998-14310026774396279981243-2532
Q gi|254780170|r   32 KRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLP-LNAKERFLALQSKQIDILSRNTD-WTLL  109 (342)
Q Consensus        32 ~rG~L~vGv~~~~ppfs~~d~~G~~~GfDVDl~raiAaal~gd~~kVe~v~-~~~~~rf~aL~sG~vDil~~~~T-~T~~  109 (342)
                      +..+|++|+....      +.+....-|---|++.+.++++ .+.+|+++. .+....+.+|.+|++|+.+-+.. +-..
T Consensus         6 ~~~~l~~~~~~~~------~~~~~~~~~~~pl~~~Ls~~l~-~~V~V~~~~~~Dy~~~ieal~~g~~Dia~~gp~~yv~a   78 (344)
T 3myu_A            6 SDNTLIFNISLDH------NADTSIEKFFTVFSKKLSGKLN-KKINVNFNIVDDSFTKINNIQANKADFAFVNSQAIASN   78 (344)
T ss_dssp             --CEEEEEECCCT------TGGGTHHHHHHHHHHHHHHHHT-SCCEEEEEECCCHHHHHHHHHTTSCSEEEECGGGCCCC
T ss_pred             CCCCEEEEECCCC------CCHHHHHHHHHHHHHHHHHHHC-CCEEEEEEECCCHHHHHHHHHCCCCCEEEECCHHHHHH
T ss_conf             8881699960488------8578899999999999999868-96589999648799999999779956899790999975


Q ss_pred             CHHCC-----------CCCCC------------------------------------------------CCCCCCCEEEE
Q ss_conf             01102-----------78435------------------------------------------------32234402346
Q gi|254780170|r  110 REISL-----------GLAFR------------------------------------------------PITYFDGQGFI  130 (342)
Q Consensus       110 Rd~~~-----------~v~Fs------------------------------------------------~~~~~dgq~~l  130 (342)
                      ++...           ..+..                                                ...+|.| .++
T Consensus        79 ~~~~~~~~l~~~~~~~~~d~~~~~y~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~Y~~-~I~  157 (344)
T 3myu_A           79 NWFGYTPLIQTLTTAFKEDLELDYYEDGNLQKKAEKTNLLFLSPPYKEWDDIKQKWTGNRYDFLYEPSKLVSFYRS-MIL  157 (344)
T ss_dssp             TTSSEEEEEEEEEEEETTBCSCCCGGGTHHHHHHHHHHHHHHSSCGGGCCTTTTTBCSSSBGGGEEEEEEESEEEE-EEE
T ss_pred             HHHCCCCHHHEEHHCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEE-EEE
T ss_conf             6515530200001013455554222466312322221000124543334443223567554221024567663268-999


Q ss_pred             EE----------CCCCCCCHHHHCCCCEEEEE-CCCHHHHH-HHHHHHCCCC-CC------EEEECCHHHHHHHHHCCCE
Q ss_conf             30----------21134753641786203431-34269999-9999862998-50------7874798999999873960
Q gi|254780170|r  131 MH----------KKKGISSVSQLSGASICVQA-GTTTELTL-ADYFKAHNMK-YH------PIVFERVEEIDAAYRAHRC  191 (342)
Q Consensus       131 Vr----------k~~~i~s~~dL~G~~I~v~~-GTT~e~~l-~~~~~~~~~~-~~------~v~~~~~~~a~~al~~Gr~  191 (342)
                      |+          ++++|++++||+|++|+... +||+--.+ ..++.+++.. .+      .+...+++.+..++.+|++
T Consensus       158 v~~~~~~~~~ikk~s~ik~l~DLkGk~iaf~d~~StSGyl~P~~~L~~~g~~~~~~~~~~~~~~~g~h~~~~~aV~~G~~  237 (344)
T 3myu_A          158 ITGSASEITAIKKAWNEKNWNQFMKFGIGHGQTNSASRFELPDLLFRKHFAKNYPGLQNAINSDPDKFAVVRGREIGINK  237 (344)
T ss_dssp             EEESHHHHHHHHHHHHHTCHHHHHTTCEEECCTTCTTTTHHHHHHHHHHHCTTCCCHHHHHHHCGGGEEECCGGGTTSST
T ss_pred             EECCCHHHHHHHCCCCCCCHHHHCCCEEEECCCCCCHHHHHHHHHHHHHCCCCCCCHHHEEEECCCCHHHHHHHHHCCCC
T ss_conf             80572011001036553788896698788348973122388999999814877761221144037857999999977998


Q ss_pred             EEEEE-CCHHHH-------HHHH-HC---CCCHHHCCCCCCCCCCCE---EEECCCC-CHHHHHHHHHHHHHH
Q ss_conf             29982-504799-------9998-36---780010025644423710---1000277-757999988774433
Q gi|254780170|r  192 DAYTG-DISALY-------ALKL-TN---DRPSEHVILPDIISKSPL---APAIIQG-DTEWYNIVSWTHYAM  248 (342)
Q Consensus       192 DA~~~-D~s~La-------~~~~-~~---~~p~~~~il~e~iskEPl---g~avr~g-D~~w~d~V~W~~~al  248 (342)
                      ||-.+ |...-.       .... ..   ..+++.+|+-+.   +|+   .+++|++ |+++++.++=++..|
T Consensus       238 Da~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Vi~~S---~~iP~~~i~v~~~L~~e~~~~I~~all~l  307 (344)
T 3myu_A          238 NIKIVFDDANSFSWTQNIKGSKRPFYTPIDPNDRLEILTYS---DPLLYDIGIVSNNLSRIYQKAIGEIFIEL  307 (344)
T ss_dssp             TCCEEEEETTGGGGSCCCC---CCSSCCSSTTSEEEEEEEE---EEEECCEEEEETTSCHHHHHHHHHHHHHH
T ss_pred             CEEEEECCCHHHHHHCCCHHHHHHHHCCCCCCCCEEEEEEC---CCCCCCCEEEECCCCHHHHHHHHHHHHHH
T ss_conf             87987332034431013101345542265655544899978---99888728993899999999999999961