BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780170|ref|YP_003064583.1| cationic amino acid ABC
transporter, periplasmic binding protein [Candidatus Liberibacter
asiaticus str. psy62]
         (342 letters)

Database: nr 
           13,984,884 sequences; 4,792,584,752 total letters

Searching..................................................done


Results from round 1


>gi|254780170|ref|YP_003064583.1| cationic amino acid ABC transporter, periplasmic binding protein
           [Candidatus Liberibacter asiaticus str. psy62]
 gi|254039847|gb|ACT56643.1| cationic amino acid ABC transporter, periplasmic binding protein
           [Candidatus Liberibacter asiaticus str. psy62]
          Length = 342

 Score =  712 bits (1837), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/342 (100%), Positives = 342/342 (100%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD
Sbjct: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
           VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP
Sbjct: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120

Query: 121 ITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVE 180
           ITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVE
Sbjct: 121 ITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVE 180

Query: 181 EIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNI 240
           EIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNI
Sbjct: 181 EIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNI 240

Query: 241 VSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRII 300
           VSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRII
Sbjct: 241 VSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRII 300

Query: 301 RHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           RHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR
Sbjct: 301 RHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342


>gi|315122673|ref|YP_004063162.1| cationic amino acid ABC transporter, periplasmic binding protein
           [Candidatus Liberibacter solanacearum CLso-ZC1]
 gi|313496075|gb|ADR52674.1| cationic amino acid ABC transporter, periplasmic binding protein
           [Candidatus Liberibacter solanacearum CLso-ZC1]
          Length = 342

 Score =  592 bits (1525), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 274/342 (80%), Positives = 310/342 (90%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           MY++FF+SILCLI L FT+F T ASIL +IKKRGFLKCGINTGL GF+E++ANGDWKGFD
Sbjct: 1   MYRNFFISILCLIGLTFTNFPTYASILQNIKKRGFLKCGINTGLTGFSEIQANGDWKGFD 60

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
           VDFC+ALS+AIFDD SK+QYLPLNAKERF++LQSKQIDILSRNTDWTLLRE  LGLAFRP
Sbjct: 61  VDFCKALSAAIFDDSSKVQYLPLNAKERFISLQSKQIDILSRNTDWTLLRETKLGLAFRP 120

Query: 121 ITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVE 180
           ITYFDGQG +M+KK G+SS  QLS ASICVQAGTTTE TLADYFKAHNMKYHPIVFERVE
Sbjct: 121 ITYFDGQGLMMYKKSGVSSALQLSDASICVQAGTTTEKTLADYFKAHNMKYHPIVFERVE 180

Query: 181 EIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNI 240
           EIDAAYR+HRCD YTGD SALYAL+L+ D P+EHVIL DIISKSPL PAI+QGD+EW NI
Sbjct: 181 EIDAAYRSHRCDVYTGDKSALYALRLSTDNPNEHVILKDIISKSPLGPAILQGDSEWSNI 240

Query: 241 VSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRII 300
           VSWTHYA+V AEELGITQ N++Q    T +PD++RFLGIDKS+NIGE+LGL+KDW Y+II
Sbjct: 241 VSWTHYALVNAEELGITQSNVDQKRLTTNDPDMKRFLGIDKSANIGESLGLSKDWAYQII 300

Query: 301 RHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           +HMGNYGE+FDRNLG+QS LKIPR YNALWSKGG+MYAPPIR
Sbjct: 301 KHMGNYGEIFDRNLGSQSALKIPREYNALWSKGGIMYAPPIR 342


>gi|150396327|ref|YP_001326794.1| cationic amino acid ABC transporter periplasmic binding protein
           [Sinorhizobium medicae WSM419]
 gi|150027842|gb|ABR59959.1| cationic amino acid ABC transporter, periplasmic binding protein
           [Sinorhizobium medicae WSM419]
          Length = 341

 Score =  443 bits (1139), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 188/342 (54%), Positives = 267/342 (78%), Gaps = 1/342 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           M +    +++   ++   S++ +A+ L D+K +GF++CG+NTGL GFA   A+GDW GFD
Sbjct: 1   MARTILTALVSAAVMGVGSYAASAATLDDVKAKGFVQCGVNTGLAGFAAPNASGDWSGFD 60

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
           VD+C+A+++A+F D +K++Y PL+AKERF ALQS ++D+L+RNT W++ R+ +LG  FRP
Sbjct: 61  VDYCKAIAAAVFGDATKVKYTPLSAKERFPALQSGEVDVLARNTTWSINRDTALGFNFRP 120

Query: 121 ITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVE 180
           + Y+DGQGF++ K+  + S  +LSGA++CVQ GTTTEL LADYFKA+N++Y+P+VFE++E
Sbjct: 121 VNYYDGQGFMVRKELDVKSALELSGAAVCVQTGTTTELNLADYFKANNLQYNPVVFEKLE 180

Query: 181 EIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNI 240
           E++AAY A RCD YT D S LY+L+LT  +P +H++LP+IISK PLAPA+ QGD +W++I
Sbjct: 181 EVNAAYDAGRCDVYTTDQSGLYSLRLTLSKPDDHIVLPEIISKEPLAPAVRQGDDQWFDI 240

Query: 241 VSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRII 300
           VSW HYA+V AEE G+TQ N+ ++ K + NPDVQRFLG++  S IG  LGLT +W   I+
Sbjct: 241 VSWVHYALVQAEEFGVTQANVEEMKK-SANPDVQRFLGVEADSKIGTDLGLTNEWAVNIV 299

Query: 301 RHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           + +GNYGE+FDRN+G  S LKI RG NALW+KGGL YAPP+R
Sbjct: 300 KAVGNYGEVFDRNIGAGSPLKIERGLNALWNKGGLQYAPPVR 341


>gi|15965231|ref|NP_385584.1| general L-amino acid-binding periplasmic ABC transporter protein
           [Sinorhizobium meliloti 1021]
 gi|307316996|ref|ZP_07596437.1| cationic amino acid ABC transporter, periplasmic binding protein
           [Sinorhizobium meliloti AK83]
 gi|15074411|emb|CAC46057.1| Probable general L-amino acid-binding periplasmic ABC transporter
           [Sinorhizobium meliloti 1021]
 gi|306897084|gb|EFN27829.1| cationic amino acid ABC transporter, periplasmic binding protein
           [Sinorhizobium meliloti AK83]
          Length = 341

 Score =  439 bits (1128), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 189/342 (55%), Positives = 267/342 (78%), Gaps = 1/342 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           M +    +++   ++   + + +A+ L D+K +GF++CG+NTGL GFA   A+G+W GFD
Sbjct: 1   MARRILTALVGAAVVGIGTHAASAATLDDVKAKGFVQCGVNTGLAGFAAPDASGNWSGFD 60

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
           VD+C+A+++AIF D SK++Y PL+AKERF ALQS ++D+L+RNT W++ R+ +LG  FRP
Sbjct: 61  VDYCKAIAAAIFGDGSKVKYTPLSAKERFPALQSGEVDVLARNTTWSINRDTALGFNFRP 120

Query: 121 ITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVE 180
           + Y+DGQGF++ K+  + S  +LSGA++CVQ GTTTEL LADYFKA+N++Y+P+VFE++E
Sbjct: 121 VNYYDGQGFMVRKELDVKSALELSGAAVCVQTGTTTELNLADYFKANNLQYNPVVFEKLE 180

Query: 181 EIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNI 240
           E++AAY A RCD YT D S LY+L+LT  +P +H++LP+IISK PLAPA+ QGD +W++I
Sbjct: 181 EVNAAYDAGRCDVYTTDQSGLYSLRLTLSKPDDHIVLPEIISKEPLAPAVRQGDDQWFDI 240

Query: 241 VSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRII 300
           VSW HYA+V AEE G+TQ N+ ++ K +TNPDVQRFLG++  S IG  LGLT +W   I+
Sbjct: 241 VSWVHYALVQAEEFGVTQANLEEMKK-STNPDVQRFLGVEADSKIGTDLGLTNEWAVNIV 299

Query: 301 RHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           + +GNYGE+FDRN+G  S LKI RG NALW+KGGL YAPP+R
Sbjct: 300 KAVGNYGEVFDRNIGAGSPLKIERGLNALWNKGGLQYAPPVR 341


>gi|209549162|ref|YP_002281079.1| cationic amino acid ABC transporter periplasmic binding protein
           [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209534918|gb|ACI54853.1| cationic amino acid ABC transporter, periplasmic binding protein
           [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 341

 Score =  438 bits (1127), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 191/342 (55%), Positives = 262/342 (76%), Gaps = 1/342 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           M      +++   +    + + +A+ LGD+K +GF++CG+NTGL GFA   A+G+W GFD
Sbjct: 1   MKNKLLSAVIGAAVFALGTSAASATTLGDVKAKGFVQCGVNTGLTGFAAPDASGNWAGFD 60

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
           VDFC+A++SA+F DP+K++Y P NAKERF ALQS +ID+LSRNT WT+ R+ +LG  FRP
Sbjct: 61  VDFCKAVASAVFGDPTKVKYTPTNAKERFTALQSGEIDVLSRNTTWTINRDTALGFNFRP 120

Query: 121 ITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVE 180
           +TY+DGQGF++ K   + S  +LSGA+ICVQ+GTTTEL LADYFK +N++Y+P+VFE + 
Sbjct: 121 VTYYDGQGFMVRKSLNVKSALELSGAAICVQSGTTTELNLADYFKTNNLQYNPVVFENLP 180

Query: 181 EIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNI 240
           E++AAY A RCD YT D S LY+L+LT   P EHVILP+IISK PL PA+ QGD +W++I
Sbjct: 181 EVNAAYDAGRCDVYTTDQSGLYSLRLTLKNPDEHVILPEIISKEPLGPAVRQGDDQWFDI 240

Query: 241 VSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRII 300
           VSWT YA++ AEE GITQ N++++ K++ NPD++RFLG +  + IG  LGLT DW   +I
Sbjct: 241 VSWTAYALINAEEFGITQANVDEM-KNSPNPDIKRFLGSETDTKIGTDLGLTNDWAANVI 299

Query: 301 RHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           + +GNYGE+F+RN+G  S LKI RG NALW+KGG+ YAPP+R
Sbjct: 300 KGVGNYGEIFERNIGQGSPLKIARGLNALWNKGGIQYAPPVR 341


>gi|307309254|ref|ZP_07588922.1| cationic amino acid ABC transporter, periplasmic binding protein
           [Sinorhizobium meliloti BL225C]
 gi|306900255|gb|EFN30872.1| cationic amino acid ABC transporter, periplasmic binding protein
           [Sinorhizobium meliloti BL225C]
          Length = 341

 Score =  437 bits (1123), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 188/342 (54%), Positives = 267/342 (78%), Gaps = 1/342 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           M +    +++   ++   + + +A+ L D+K +GF++CG+NTGL GFA   A+G+W GFD
Sbjct: 1   MARRILTALVGAAVVGIGTHAASAATLDDVKAKGFVQCGVNTGLAGFAAPDASGNWSGFD 60

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
           VD+C+A+++AIF D SK++Y PL+AKERF ALQS ++D+L+RNT W++ R+ +LG  FRP
Sbjct: 61  VDYCKAIAAAIFGDGSKVKYTPLSAKERFPALQSGEVDVLARNTTWSINRDTALGFNFRP 120

Query: 121 ITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVE 180
           + Y+DGQGF++ K+  + S  +LSGA++CVQ GTTTEL LADYFKA+N++Y+P+VFE++E
Sbjct: 121 VNYYDGQGFMVRKELDVKSALELSGAAVCVQTGTTTELNLADYFKANNLQYNPVVFEKLE 180

Query: 181 EIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNI 240
           E++AAY A RCD YT D S LY+L+LT  +P +H++LP+IISK PLAPA+ QGD +W++I
Sbjct: 181 EVNAAYDAGRCDVYTTDQSGLYSLRLTLSKPDDHIVLPEIISKEPLAPAVRQGDDQWFDI 240

Query: 241 VSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRII 300
           VSW HYA+V AEE G+T+ N+ ++ K +TNPDVQRFLG++  S IG  LGLT +W   I+
Sbjct: 241 VSWVHYALVQAEEFGVTRANLEEMKK-STNPDVQRFLGVEADSKIGTDLGLTNEWAVNIV 299

Query: 301 RHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           + +GNYGE+FDRN+G  S LKI RG NALW+KGGL YAPP+R
Sbjct: 300 KAVGNYGEVFDRNIGAGSPLKIERGLNALWNKGGLQYAPPVR 341


>gi|241204488|ref|YP_002975584.1| cationic amino acid ABC transporter periplasmic-binding protein
           [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240858378|gb|ACS56045.1| cationic amino acid ABC transporter, periplasmic binding protein
           [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 341

 Score =  435 bits (1119), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 191/342 (55%), Positives = 261/342 (76%), Gaps = 1/342 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           M      + +   +L   + + +A+ L D+K +GF++CG+NTGL GFA   A+G+W GFD
Sbjct: 1   MKNKLLSAAIGAAVLAVGASAASATTLSDVKAKGFVQCGVNTGLTGFAAPDASGNWAGFD 60

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
           VDFC+A++SA+F DP+K++Y P NAKERF ALQS +ID+LSRNT WT+ R+ +LG  FRP
Sbjct: 61  VDFCKAVASAVFGDPTKVKYTPTNAKERFTALQSGEIDVLSRNTTWTINRDTALGFNFRP 120

Query: 121 ITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVE 180
           +TY+DGQGF++ K   + S  +LSGA+ICVQ+GTTTEL LADYFK +N++Y+P+VFE + 
Sbjct: 121 VTYYDGQGFMVRKGLNVKSALELSGAAICVQSGTTTELNLADYFKTNNLQYNPVVFENLP 180

Query: 181 EIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNI 240
           E++AAY A RCD YT D S LY+L+LT   P EHVILP+IISK PL PA+ QGD +W++I
Sbjct: 181 EVNAAYDAGRCDVYTTDQSGLYSLRLTLKNPDEHVILPEIISKEPLGPAVRQGDDQWFDI 240

Query: 241 VSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRII 300
           VSWT YA++ AEE GITQ N++++ K++ NPD++RFLG +  + IG  LGLT DW   +I
Sbjct: 241 VSWTAYALINAEEFGITQANVDEM-KNSPNPDIKRFLGSETDTKIGTDLGLTNDWAANVI 299

Query: 301 RHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           + +GNYGE+F+RN+G  S LKI RG NALW+KGG+ YAPP+R
Sbjct: 300 KGVGNYGEIFERNIGQGSPLKIARGLNALWNKGGIQYAPPVR 341


>gi|116251960|ref|YP_767798.1| general L-amino acid substrate binding protein [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|3182887|sp|Q52812|AAPJ_RHIL3 RecName: Full=General L-amino acid-binding periplasmic protein
           AapJ; Flags: Precursor
 gi|1154894|emb|CAA57933.1| general amino acid ABC type transporter [Rhizobium leguminosarum]
 gi|115256608|emb|CAK07696.1| General L-amino acid substrate binding protein [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 341

 Score =  434 bits (1116), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 190/342 (55%), Positives = 261/342 (76%), Gaps = 1/342 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           M      + +   +L   + + +A+ L D+K +GF++CG+NTGL GFA   A+G+W GFD
Sbjct: 1   MKNKLLSAAIGAAVLAVGASAASATTLSDVKAKGFVQCGVNTGLTGFAAPDASGNWAGFD 60

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
           VDFC+A++SA+F DP+K++Y P NAKERF ALQS +ID+LSRNT WT+ R+ +LG  FRP
Sbjct: 61  VDFCKAVASAVFGDPTKVKYTPTNAKERFTALQSGEIDVLSRNTTWTINRDTALGFNFRP 120

Query: 121 ITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVE 180
           +TY+DGQGF++ K   + S  +LSGA+ICVQ+GTTTEL LADYFK +N++Y+P+VFE + 
Sbjct: 121 VTYYDGQGFMVRKGLNVKSALELSGAAICVQSGTTTELNLADYFKTNNLQYNPVVFENLP 180

Query: 181 EIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNI 240
           E++AAY A RCD YT D S LY+L+LT   P EH+ILP+IISK PL PA+ QGD +W++I
Sbjct: 181 EVNAAYDAGRCDVYTTDQSGLYSLRLTLKNPDEHIILPEIISKEPLGPAVRQGDDQWFDI 240

Query: 241 VSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRII 300
           VSWT YA++ AEE GITQ N++++ K++ NPD++RFLG +  + IG  LGLT DW   +I
Sbjct: 241 VSWTAYALINAEEFGITQANVDEM-KNSPNPDIKRFLGSETDTKIGTDLGLTNDWAANVI 299

Query: 301 RHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           + +GNYGE+F+RN+G  S LKI RG NALW+KGG+ YAPP+R
Sbjct: 300 KGVGNYGEIFERNIGQGSPLKIARGLNALWNKGGIQYAPPVR 341


>gi|86357519|ref|YP_469411.1| general L-amino acid ABC transporter, substrate-binding protein
           [Rhizobium etli CFN 42]
 gi|86281621|gb|ABC90684.1| general L-amino acid ABC transporter, substrate-binding protein
           [Rhizobium etli CFN 42]
          Length = 348

 Score =  432 bits (1111), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 187/342 (54%), Positives = 263/342 (76%), Gaps = 1/342 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           M      + +   +    + + +A+ LGD+K +GF++CG+NTGL GFA   A+G+W GFD
Sbjct: 8   MKNKLLSAAIGAAVFALGASAASATTLGDVKAKGFIQCGVNTGLAGFAAPDASGNWAGFD 67

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
           VDFC+A++SA+F DP+K+++ PL+A  RF ALQS +ID+L+RNT W++ R+ +LGL FR 
Sbjct: 68  VDFCKAVASAVFGDPTKVKFTPLSAANRFPALQSGEIDVLARNTTWSINRDTALGLNFRF 127

Query: 121 ITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVE 180
           + Y+DGQGF++ K   + S  +LSGAS+CVQ+GTTTEL LADYFKA+N++Y+P+VFE+++
Sbjct: 128 VNYYDGQGFMVRKSLNVKSALELSGASVCVQSGTTTELNLADYFKANNLQYNPVVFEKLD 187

Query: 181 EIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNI 240
           E++AAY A RCD YT D S LY+L+LT   P EH ILP+IISK PLAPA+ QGD +W++I
Sbjct: 188 EVNAAYDAGRCDVYTTDQSGLYSLRLTLKNPDEHAILPEIISKEPLAPAVRQGDDQWFDI 247

Query: 241 VSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRII 300
           VSW  YAM+ AEE GITQ N++ + K++ NPD++RFLG++  + IG  LGLT +W Y I+
Sbjct: 248 VSWVGYAMINAEEFGITQANVDDM-KNSPNPDIKRFLGVEADTKIGTDLGLTNEWAYNIV 306

Query: 301 RHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           +++GNYGE+F+RN+G  S LKI RG NALWSKGG+ YAPP+R
Sbjct: 307 KNVGNYGEVFERNIGQGSPLKIARGLNALWSKGGIQYAPPVR 348


>gi|327190790|gb|EGE57858.1| general L-amino acid ABC transporter, substrate-binding protein
           [Rhizobium etli CNPAF512]
          Length = 341

 Score =  432 bits (1110), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 188/342 (54%), Positives = 264/342 (77%), Gaps = 1/342 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           M      + +   +L   + + +A+ LGD+K +GF++CG+NTGL GFA   A+G+W GFD
Sbjct: 1   MKNKLLSAAIGAAVLALGAPAASATTLGDVKAKGFVQCGVNTGLAGFAAPDASGNWAGFD 60

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
           VDFC+A++SA+F DP+K+++ PL+A  RF ALQS +ID+L+RNT W++ R+ +LGL FR 
Sbjct: 61  VDFCKAVASAVFGDPTKVKFTPLSAANRFPALQSGEIDVLARNTTWSINRDTALGLNFRF 120

Query: 121 ITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVE 180
           + Y+DGQGF++ K   + S  +LSGAS+CVQ+GTTTEL LADYFKA+N++Y+P+VFE+++
Sbjct: 121 VNYYDGQGFMVRKSLNVKSALELSGASVCVQSGTTTELNLADYFKANNLQYNPVVFEKLD 180

Query: 181 EIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNI 240
           E++AAY A RCD YT D S LY+L+LT   P EH ILP+IISK PLAPA+ QGD +W++I
Sbjct: 181 EVNAAYDAGRCDVYTTDQSGLYSLRLTLKNPDEHAILPEIISKEPLAPAVRQGDDQWFDI 240

Query: 241 VSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRII 300
           VSW  YAM+ AEE GITQ N++ + K++ NPD++RFLG++  + IG  LGLT +W Y II
Sbjct: 241 VSWVGYAMINAEEFGITQANVDDM-KNSPNPDIKRFLGVEADTKIGTDLGLTNEWAYNII 299

Query: 301 RHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           +++GNYGE+F+RN+G  S LKI RG NALW+KGG+ YAPP+R
Sbjct: 300 KNVGNYGEVFERNIGQGSPLKIARGLNALWNKGGIQYAPPVR 341


>gi|190891587|ref|YP_001978129.1| general L-amino acid ABC transporter, substrate-binding protein
           [Rhizobium etli CIAT 652]
 gi|190696866|gb|ACE90951.1| general L-amino acid ABC transporter, substrate-binding protein
           [Rhizobium etli CIAT 652]
          Length = 341

 Score =  431 bits (1109), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 187/342 (54%), Positives = 264/342 (77%), Gaps = 1/342 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           M      + +   +L   + + +A+ LGD+K +GF++CG+NTGL GFA   A+G+W GFD
Sbjct: 1   MKNKLLSAAIGAAVLALGAPAASATTLGDVKAKGFVQCGVNTGLAGFAAPDASGNWAGFD 60

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
           VDFC+A++SA+F DP+K+++ PL+A  RF ALQS +ID+L+RNT W++ R+ +LGL FR 
Sbjct: 61  VDFCKAVASAVFGDPTKVKFTPLSAANRFPALQSGEIDVLARNTTWSINRDTALGLNFRF 120

Query: 121 ITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVE 180
           + Y+DGQGF++ K   + S  +LSGAS+CVQ+GTTTEL LADYFKA+N++Y+P+VFE+++
Sbjct: 121 VNYYDGQGFMVRKSLNVKSALELSGASVCVQSGTTTELNLADYFKANNLQYNPVVFEKLD 180

Query: 181 EIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNI 240
           E++AAY A RCD YT D S LY+L+LT   P EH ILP+IISK PLAPA+ QGD +W++I
Sbjct: 181 EVNAAYDAGRCDVYTTDQSGLYSLRLTLKNPDEHAILPEIISKEPLAPAVRQGDDQWFDI 240

Query: 241 VSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRII 300
           VSW  YAM+ AEE GITQ N++ + K++ NPD++RFLG++  + IG  LGLT +W Y I+
Sbjct: 241 VSWVGYAMINAEEFGITQANVDDM-KNSPNPDIKRFLGVEADTKIGTDLGLTNEWAYNIV 299

Query: 301 RHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           +++GNYGE+F+RN+G  S LKI RG NALW+KGG+ YAPP+R
Sbjct: 300 KNVGNYGEVFERNIGQGSPLKIARGLNALWNKGGIQYAPPVR 341


>gi|227821880|ref|YP_002825850.1| hypothetical protein NGR_c13170 [Sinorhizobium fredii NGR234]
 gi|227340879|gb|ACP25097.1| hypothetical protein NGR_c13170 [Sinorhizobium fredii NGR234]
          Length = 341

 Score =  428 bits (1101), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 182/342 (53%), Positives = 261/342 (76%), Gaps = 1/342 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           M +    ++    ++   + + +A+ L D+K +GF++CG+NTGL GFA   A+G+W GFD
Sbjct: 1   MARRILTALFGAAVMGIGAQAASAATLDDVKAKGFVQCGVNTGLAGFAAPDASGNWSGFD 60

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
           VD+C+A+++A+F D +K++Y P +AKERF ALQS ++D+L+RNT WT+ R+ +LG  FRP
Sbjct: 61  VDYCKAIAAAVFGDATKVKYTPTSAKERFPALQSGEVDVLARNTTWTINRDTALGFNFRP 120

Query: 121 ITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVE 180
           + Y+DGQGF++ K   + S  +LSGA++CVQ GTTTEL LADYFK +N++Y+P+VFE++E
Sbjct: 121 VNYYDGQGFMVRKSLNVKSALELSGAAVCVQTGTTTELNLADYFKTNNLQYNPVVFEKLE 180

Query: 181 EIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNI 240
           E++AAY A RCD YT D S LY+L+LT  +P +H+ILP+IISK PL PA+ QGD +W++I
Sbjct: 181 EVNAAYDAGRCDVYTTDQSGLYSLRLTLSKPDDHMILPEIISKEPLGPAVRQGDDQWFDI 240

Query: 241 VSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRII 300
           V+W HYA++ AEE G+TQ N+ ++ K + NPDVQRFLG++  S IG  LGLT +W   +I
Sbjct: 241 VTWVHYALIQAEEFGVTQANVEEMKK-SPNPDVQRFLGVEADSKIGTDLGLTNEWAVNVI 299

Query: 301 RHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           + +GNYGE+FDRN+G  S LKI RG NALW+KGG+ YAPP+R
Sbjct: 300 KAVGNYGEVFDRNIGAGSPLKIERGLNALWNKGGIQYAPPVR 341


>gi|222085840|ref|YP_002544371.1| general L-amino acid ABC transporter [Agrobacterium radiobacter
           K84]
 gi|221723288|gb|ACM26444.1| general L-amino acid ABC transporter [Agrobacterium radiobacter
           K84]
          Length = 344

 Score =  424 bits (1089), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 183/342 (53%), Positives = 267/342 (78%), Gaps = 1/342 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           M K    + L    L ++    +AS L D+K +GF++CG+NT L+GF++  A+G++ GFD
Sbjct: 4   MKKIALSAFLGAAALAYSVSGASASTLSDVKAKGFVQCGVNTALLGFSQPDASGNYSGFD 63

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
           VD C+A+++A+F D +K++Y  L++K+RF ALQS +ID+LSRNT WTL R+ +LGL FRP
Sbjct: 64  VDMCKAVAAAVFGDVTKVKYTALSSKDRFTALQSGEIDLLSRNTTWTLNRDTALGLNFRP 123

Query: 121 ITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVE 180
           +TY+DGQGF++ K+  + S  +LSGA++CVQ+GTTTEL LADYFK++N++Y+P+VF+++E
Sbjct: 124 VTYYDGQGFMVRKELNVKSALELSGAAVCVQSGTTTELNLADYFKSNNLQYNPVVFDKLE 183

Query: 181 EIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNI 240
           E++AAY + RCD YT D S LY+L+LT   P ++V+LP+IISK PL PA+ QGD +W++I
Sbjct: 184 EVNAAYDSGRCDVYTTDQSGLYSLRLTLKNPDDNVVLPEIISKEPLGPAVRQGDDQWFDI 243

Query: 241 VSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRII 300
           V+WT YA++ AEE GITQKN++++ K + NPD++RFLG ++ S +G  +GLT DW Y +I
Sbjct: 244 VTWTAYALINAEEFGITQKNVDEM-KSSANPDIKRFLGAEQGSTLGTDMGLTNDWAYNVI 302

Query: 301 RHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           + +GNYGE+FDRN+G  S LKI RG NALW+KGG+ YAPP+R
Sbjct: 303 KGVGNYGEVFDRNIGAGSPLKIARGLNALWNKGGIQYAPPVR 344


>gi|13476741|ref|NP_108310.1| ABC transporter, amino acid binding protein [Mesorhizobium loti
           MAFF303099]
 gi|14027502|dbj|BAB53771.1| ABC transporter, amino acid binding protein [Mesorhizobium loti
           MAFF303099]
          Length = 342

 Score =  415 bits (1067), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 185/342 (54%), Positives = 263/342 (76%), Gaps = 3/342 (0%)

Query: 3   KDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVD 62
           K   + IL    L F + + +A+ L  +K +GF++CG++TGL GF+     GDW+G D D
Sbjct: 2   KHIAIGILGAATLGFMASAASATTLDTVKAKGFIQCGVSTGLAGFSAPDDKGDWQGIDAD 61

Query: 63  FCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPIT 122
           FCRA+++A+F D +K+++ PL+AKERF ALQS ++DILSRNT WT+ R+ +LGL F   T
Sbjct: 62  FCRAVAAAVFGDGTKVKFTPLSAKERFTALQSGEVDILSRNTTWTINRDTALGLNFVGTT 121

Query: 123 YFDGQGFIMHKKK--GISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVE 180
           Y+DGQGF+++ KK  G++S  QLSGA++CVQ+GTTTEL LADYFKA+ M+Y+P+VFE++E
Sbjct: 122 YYDGQGFMINAKKLPGVNSALQLSGAAVCVQSGTTTELNLADYFKANKMEYNPVVFEKLE 181

Query: 181 EIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNI 240
           E++AAY A RCD YT D S LY ++LT   P++HV+LP+IISK PL PA+ QGD +WY+I
Sbjct: 182 EVNAAYDAGRCDVYTTDQSGLYGIRLTLGSPADHVVLPEIISKEPLGPAVRQGDDQWYHI 241

Query: 241 VSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRII 300
           V WT++A++ AEELGIT+ N++++ K++ +P+++R LG +  + IG  LG++ DW   I+
Sbjct: 242 VKWTYFALLDAEELGITKANVDEM-KNSASPEIKRVLGQEADTKIGADLGVSNDWVVNIV 300

Query: 301 RHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           + +GNYGEMFDRN+G+ S LKI RG NALW+KGGL YAPPIR
Sbjct: 301 KAVGNYGEMFDRNVGSGSPLKIARGINALWTKGGLQYAPPIR 342


>gi|153009884|ref|YP_001371099.1| cationic amino acid ABC transporter periplasmic-binding protein
           [Ochrobactrum anthropi ATCC 49188]
 gi|151561772|gb|ABS15270.1| cationic amino acid ABC transporter, periplasmic binding protein
           [Ochrobactrum anthropi ATCC 49188]
          Length = 343

 Score =  414 bits (1064), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 187/344 (54%), Positives = 253/344 (73%), Gaps = 3/344 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           M K     +L    LF  +   +A  L D+K +GFL+CG+NTGL+GFA     G+W GFD
Sbjct: 1   MKKTLMTGVLGAAALFSVASGASADTLSDVKAKGFLQCGVNTGLLGFASPNDKGEWSGFD 60

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
           VD+CRA++SAIF DP+K+++ PLNAKERF ALQS ++D+L RNT WT+ R+ +LGL F  
Sbjct: 61  VDYCRAVASAIFGDPTKVKFTPLNAKERFTALQSGEVDVLIRNTTWTISRDTALGLDFAG 120

Query: 121 ITYFDGQGFIMHKKK--GISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFER 178
           I YFDGQGF+++ KK  GI+S  QLSGASICVQAGTTTEL +ADYF+A+ M+Y+P+VFE+
Sbjct: 121 INYFDGQGFMINSKKLSGINSALQLSGASICVQAGTTTELNMADYFRANKMEYNPVVFEK 180

Query: 179 VEEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWY 238
           +EE +AAY + RCDAYT D S+LY ++L    P +HVILP+IISK P    + QGD++W 
Sbjct: 181 IEEANAAYDSGRCDAYTTDQSSLYGVRLALANPDDHVILPEIISKEPFGLTVRQGDSKWA 240

Query: 239 NIVSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYR 298
           ++V WTH A++ AEE GITQ N+ ++ K + NPD++R LG++  + IG  LGL  DW  +
Sbjct: 241 DVVRWTHNALLNAEEYGITQANVEEMKK-SDNPDIKRLLGVEADTKIGTDLGLDNDWVVK 299

Query: 299 IIRHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           I++ +GNYGE+F+RN+G  S LKI RG NA W+KGGL Y  P+R
Sbjct: 300 IVKGVGNYGEIFERNIGASSPLKIARGINAQWNKGGLQYGVPVR 343


>gi|319784340|ref|YP_004143816.1| cationic amino acid ABC transporter periplasmic binding protein
           [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317170228|gb|ADV13766.1| cationic amino acid ABC transporter, periplasmic binding protein
           [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 342

 Score =  413 bits (1061), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 184/342 (53%), Positives = 263/342 (76%), Gaps = 3/342 (0%)

Query: 3   KDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVD 62
           K   + IL    L   + + +A+ L  +K +GF++CG++TGL GF+     GDW+G D D
Sbjct: 2   KHIAIGILGAATLGLMASAASAATLDTVKAKGFIQCGVSTGLAGFSAPDDKGDWQGIDAD 61

Query: 63  FCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPIT 122
           FCRA+++A+F D S++++ PL+AKERF ALQS +IDILSRNT WT+ R+ +LGL F  +T
Sbjct: 62  FCRAVAAAVFGDGSRVKFTPLSAKERFTALQSGEIDILSRNTTWTINRDTALGLNFIGVT 121

Query: 123 YFDGQGFIMHKKK--GISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVE 180
           Y+DGQGF+++ KK  G++S  QLSGA++CVQ+GTTTEL LADYFKA+ M+Y+P+VFE++E
Sbjct: 122 YYDGQGFMINAKKLPGVNSALQLSGAAVCVQSGTTTELNLADYFKANKMEYNPVVFEKLE 181

Query: 181 EIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNI 240
           E++AAY A RCD YT D S LY ++LT   P++HV+LP+IISK PL PA+ QGD +WY+I
Sbjct: 182 EVNAAYDAGRCDVYTTDQSGLYGIRLTLGSPADHVVLPEIISKEPLGPAVRQGDDQWYHI 241

Query: 241 VSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRII 300
           V WT++A++ AEELGIT+ N++++ K++ +P+++R LG +  + IG  LG++ DW   I+
Sbjct: 242 VKWTYFALLQAEELGITKANVDEM-KNSASPEIKRVLGQEADTKIGTDLGVSNDWVVNIV 300

Query: 301 RHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           + +GNYGEMF+RN+G+ S LKI RG NALW+KGGL YAPPIR
Sbjct: 301 KAVGNYGEMFERNVGSGSPLKIARGINALWTKGGLQYAPPIR 342


>gi|260463341|ref|ZP_05811542.1| cationic amino acid ABC transporter, periplasmic binding protein
           [Mesorhizobium opportunistum WSM2075]
 gi|259030931|gb|EEW32206.1| cationic amino acid ABC transporter, periplasmic binding protein
           [Mesorhizobium opportunistum WSM2075]
          Length = 430

 Score =  412 bits (1060), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 184/344 (53%), Positives = 264/344 (76%), Gaps = 3/344 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           + K   + IL    L   + + +A+ L  +K +GF++CG++TGL GF+     GDW+G D
Sbjct: 88  VMKHIAIGILGAAALGLMASAASATTLDTVKAKGFIQCGVSTGLAGFSAPDDKGDWQGID 147

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
            DFCRA+++A+F D +K+++ PL+AKERF ALQS ++DILSRNT WT+ R+ +LGL F  
Sbjct: 148 ADFCRAVAAAVFGDGTKVKFTPLSAKERFTALQSGEVDILSRNTTWTINRDTALGLNFIG 207

Query: 121 ITYFDGQGFIMHKKK--GISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFER 178
           +TY+DGQGF+++ KK  G++S  QLSGA++CVQ+GTTTEL LADYFKA+ M+Y+P+VFE+
Sbjct: 208 VTYYDGQGFMINAKKLPGVNSALQLSGAAVCVQSGTTTELNLADYFKANKMEYNPVVFEK 267

Query: 179 VEEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWY 238
           +EE++AAY A RCD YT D S LY ++LT   P++HV+LP+IISK PL PA+ QGD +WY
Sbjct: 268 LEEVNAAYDAGRCDVYTTDQSGLYGIRLTLGSPADHVVLPEIISKEPLGPAVRQGDDQWY 327

Query: 239 NIVSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYR 298
           +IV WT++A++ AEELGIT+ N++++ K++ +P+++R LG +  + IG  LG++ DW   
Sbjct: 328 HIVKWTYFALLDAEELGITKANVDEM-KNSASPEIKRVLGQEADTKIGTDLGVSNDWVVN 386

Query: 299 IIRHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           I++ +GNYGEMFDRN+G+ S LKI RG NALW+KGGL YAPPIR
Sbjct: 387 IVKAVGNYGEMFDRNVGSGSPLKIARGINALWTKGGLQYAPPIR 430


>gi|254709861|ref|ZP_05171672.1| lysine-arginine-ornithine-binding periplasmic protein [Brucella
           pinnipedialis B2/94]
 gi|256031353|ref|ZP_05444967.1| lysine-arginine-ornithine-binding periplasmic protein [Brucella
           pinnipedialis M292/94/1]
 gi|261317400|ref|ZP_05956597.1| cationic amino acid ABC transporter [Brucella pinnipedialis B2/94]
 gi|265988437|ref|ZP_06100994.1| cationic amino acid ABC transporter [Brucella pinnipedialis
           M292/94/1]
 gi|261296623|gb|EEY00120.1| cationic amino acid ABC transporter [Brucella pinnipedialis B2/94]
 gi|264660634|gb|EEZ30895.1| cationic amino acid ABC transporter [Brucella pinnipedialis
           M292/94/1]
          Length = 343

 Score =  412 bits (1060), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 189/344 (54%), Positives = 252/344 (73%), Gaps = 3/344 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           M K     +L    LF  +   +A  L D+K +GFL+CG+NTGL+GFA     G+W GFD
Sbjct: 1   MKKTLMTGVLGAAALFGIASGASADTLSDVKAKGFLQCGVNTGLLGFASPNNKGEWSGFD 60

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
           VD+CRA++SAIF DP+K+++ PLNAKERF ALQS ++D+L RNT WT+ R+ SLGL F  
Sbjct: 61  VDYCRAVASAIFGDPTKVKFTPLNAKERFTALQSGEVDVLIRNTTWTISRDTSLGLDFAG 120

Query: 121 ITYFDGQGFIMHKKK--GISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFER 178
           I Y+DGQGF+++ KK  GI+S  QLSGASICVQAGTTTEL +ADYF+A+ M+Y+P+VFE+
Sbjct: 121 INYYDGQGFMINSKKLAGINSALQLSGASICVQAGTTTELNMADYFRANKMEYNPVVFEK 180

Query: 179 VEEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWY 238
           +EE +AAY + RCDAYT D S+LY ++L    P +HVILP+IISK P    + QGD  W 
Sbjct: 181 IEEANAAYDSGRCDAYTTDQSSLYGVRLALANPDDHVILPEIISKEPFGLTVRQGDARWA 240

Query: 239 NIVSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYR 298
           ++V WTH A++ AEE GITQ N+ ++ K + NPD++R LG +  + IG  LGL KDW  +
Sbjct: 241 DVVRWTHNALLNAEEYGITQANVEEMKK-SDNPDIKRLLGAEADTKIGTDLGLDKDWVVK 299

Query: 299 IIRHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           II+ +GNYGE+F+RN+G+ S LKI RG NA W+KGGL Y  P+R
Sbjct: 300 IIKGVGNYGEIFERNIGSGSPLKIARGLNAQWNKGGLQYGIPVR 343


>gi|23501628|ref|NP_697755.1| amino acid ABC transporter periplasmic amino acid-binding protein
           [Brucella suis 1330]
 gi|148560716|ref|YP_001258723.1| amino acid ABC transporter periplasmic amino acid-binding protein
           [Brucella ovis ATCC 25840]
 gi|161618711|ref|YP_001592598.1| lysine-arginine-ornithine-binding periplasmic protein [Brucella
           canis ATCC 23365]
 gi|163843013|ref|YP_001627417.1| lysine-arginine-ornithine-binding periplasmic protein [Brucella
           suis ATCC 23445]
 gi|225627243|ref|ZP_03785280.1| lysine-arginine-ornithine-binding periplasmic protein [Brucella
           ceti str. Cudo]
 gi|254704068|ref|ZP_05165896.1| lysine-arginine-ornithine-binding periplasmic protein [Brucella
           suis bv. 3 str. 686]
 gi|254718861|ref|ZP_05180672.1| lysine-arginine-ornithine-binding periplasmic protein [Brucella sp.
           83/13]
 gi|256060862|ref|ZP_05451022.1| lysine-arginine-ornithine-binding periplasmic protein [Brucella
           neotomae 5K33]
 gi|256369174|ref|YP_003106682.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Brucella microti CCM 4915]
 gi|260168486|ref|ZP_05755297.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Brucella sp. F5/99]
 gi|260566684|ref|ZP_05837154.1| cationic amino acid ABC transporter [Brucella suis bv. 4 str. 40]
 gi|261324858|ref|ZP_05964055.1| cationic amino acid ABC transporter [Brucella neotomae 5K33]
 gi|261754726|ref|ZP_05998435.1| cationic amino acid ABC transporter [Brucella suis bv. 3 str. 686]
 gi|261757954|ref|ZP_06001663.1| cationic amino acid ABC transporter [Brucella sp. F5/99]
 gi|265983846|ref|ZP_06096581.1| cationic amino acid ABC transporter [Brucella sp. 83/13]
 gi|306837636|ref|ZP_07470506.1| lysine-arginine-ornithine-binding periplasmic protein [Brucella sp.
           NF 2653]
 gi|306842009|ref|ZP_07474682.1| lysine-arginine-ornithine-binding periplasmic protein [Brucella sp.
           BO2]
 gi|306843688|ref|ZP_07476288.1| lysine-arginine-ornithine-binding periplasmic protein [Brucella sp.
           BO1]
 gi|23347545|gb|AAN29670.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Brucella suis 1330]
 gi|148371973|gb|ABQ61952.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Brucella ovis ATCC 25840]
 gi|161335522|gb|ABX61827.1| lysine-arginine-ornithine-binding periplasmic protein [Brucella
           canis ATCC 23365]
 gi|163673736|gb|ABY37847.1| lysine-arginine-ornithine-binding periplasmic protein [Brucella
           suis ATCC 23445]
 gi|225617248|gb|EEH14293.1| lysine-arginine-ornithine-binding periplasmic protein [Brucella
           ceti str. Cudo]
 gi|255999334|gb|ACU47733.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Brucella microti CCM 4915]
 gi|260156202|gb|EEW91282.1| cationic amino acid ABC transporter [Brucella suis bv. 4 str. 40]
 gi|261300838|gb|EEY04335.1| cationic amino acid ABC transporter [Brucella neotomae 5K33]
 gi|261737938|gb|EEY25934.1| cationic amino acid ABC transporter [Brucella sp. F5/99]
 gi|261744479|gb|EEY32405.1| cationic amino acid ABC transporter [Brucella suis bv. 3 str. 686]
 gi|264662438|gb|EEZ32699.1| cationic amino acid ABC transporter [Brucella sp. 83/13]
 gi|306275998|gb|EFM57707.1| lysine-arginine-ornithine-binding periplasmic protein [Brucella sp.
           BO1]
 gi|306287850|gb|EFM59270.1| lysine-arginine-ornithine-binding periplasmic protein [Brucella sp.
           BO2]
 gi|306407285|gb|EFM63494.1| lysine-arginine-ornithine-binding periplasmic protein [Brucella sp.
           NF 2653]
          Length = 343

 Score =  412 bits (1060), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 189/344 (54%), Positives = 252/344 (73%), Gaps = 3/344 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           M K     +L    LF  +   +A  L D+K +GFL+CG+NTGL+GFA     G+W GFD
Sbjct: 1   MKKTLMTGVLGAAALFGIASGASADTLSDVKAKGFLQCGVNTGLLGFASPNDKGEWSGFD 60

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
           VD+CRA++SAIF DP+K+++ PLNAKERF ALQS ++D+L RNT WT+ R+ SLGL F  
Sbjct: 61  VDYCRAVASAIFGDPTKVKFTPLNAKERFTALQSGEVDVLIRNTTWTISRDTSLGLDFAG 120

Query: 121 ITYFDGQGFIMHKKK--GISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFER 178
           I Y+DGQGF+++ KK  GI+S  QLSGASICVQAGTTTEL +ADYF+A+ M+Y+P+VFE+
Sbjct: 121 INYYDGQGFMINSKKLAGINSALQLSGASICVQAGTTTELNMADYFRANKMEYNPVVFEK 180

Query: 179 VEEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWY 238
           +EE +AAY + RCDAYT D S+LY ++L    P +HVILP+IISK P    + QGD  W 
Sbjct: 181 IEEANAAYDSGRCDAYTTDQSSLYGVRLALANPDDHVILPEIISKEPFGLTVRQGDARWA 240

Query: 239 NIVSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYR 298
           ++V WTH A++ AEE GITQ N+ ++ K + NPD++R LG +  + IG  LGL KDW  +
Sbjct: 241 DVVRWTHNALLNAEEYGITQANVEEMKK-SDNPDIKRLLGAEADTKIGTDLGLDKDWVVK 299

Query: 299 IIRHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           II+ +GNYGE+F+RN+G+ S LKI RG NA W+KGGL Y  P+R
Sbjct: 300 IIKGVGNYGEIFERNIGSGSPLKIARGLNAQWNKGGLQYGIPVR 343


>gi|239831564|ref|ZP_04679893.1| lysine-arginine-ornithine-binding periplasmic protein [Ochrobactrum
           intermedium LMG 3301]
 gi|239823831|gb|EEQ95399.1| lysine-arginine-ornithine-binding periplasmic protein [Ochrobactrum
           intermedium LMG 3301]
          Length = 360

 Score =  411 bits (1057), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 186/344 (54%), Positives = 253/344 (73%), Gaps = 3/344 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           M K     +L    LF  +   +A  L D+K +GFL+CG+NTGL+GF+     G+W GFD
Sbjct: 18  MKKTLMTGVLGAAALFCVASGASADTLSDVKAKGFLQCGVNTGLLGFSSPNDKGEWSGFD 77

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
           VD+CRA++SAIF DP+K+++ PLNAKERF ALQS +ID+L RNT WT+ R+ +LGL F  
Sbjct: 78  VDYCRAVASAIFGDPAKVKFTPLNAKERFTALQSGEIDVLIRNTTWTISRDTALGLDFAG 137

Query: 121 ITYFDGQGFIMHKKK--GISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFER 178
           I YFDGQGF+++ KK  GI+S  QLSGASICVQAGTTTE+ +ADYF+A+ M+Y+P+VFE+
Sbjct: 138 INYFDGQGFMINSKKLSGINSALQLSGASICVQAGTTTEMNMADYFRANKMEYNPVVFEK 197

Query: 179 VEEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWY 238
           +EE +AAY + RCDAYT D S+LY ++L    P +HVILP+IISK P    + QGD++W 
Sbjct: 198 IEEANAAYDSGRCDAYTTDQSSLYGVRLALANPDDHVILPEIISKEPFGLTVRQGDSKWT 257

Query: 239 NIVSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYR 298
           ++V W H A++ AEE GITQ N+ ++ K + NPD++R LG++  + IG  LGL  DW  +
Sbjct: 258 DVVRWVHNALLNAEEYGITQANVEEMKK-SDNPDIKRLLGVEADTKIGTDLGLENDWVVK 316

Query: 299 IIRHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           II+ +GNYGE+F+RN+G+ S LKI RG NA W+KGGL Y  P+R
Sbjct: 317 IIKGVGNYGEIFERNIGSGSPLKIARGINAQWNKGGLQYGIPVR 360


>gi|17987494|ref|NP_540128.1| general L-amino acid-binding periplasmic protein AAPJ precursor
           [Brucella melitensis bv. 1 str. 16M]
 gi|254689006|ref|ZP_05152260.1| general L-amino acid-binding periplasmic protein AAPJ precursor
           [Brucella abortus bv. 6 str. 870]
 gi|254693490|ref|ZP_05155318.1| general L-amino acid-binding periplasmic protein AAPJ precursor
           [Brucella abortus bv. 3 str. Tulya]
 gi|256044431|ref|ZP_05447335.1| general L-amino acid-binding periplasmic protein AAPJ precursor
           [Brucella melitensis bv. 1 str. Rev.1]
 gi|256113275|ref|ZP_05454143.1| general L-amino acid-binding periplasmic protein AAPJ precursor
           [Brucella melitensis bv. 3 str. Ether]
 gi|256257256|ref|ZP_05462792.1| general L-amino acid-binding periplasmic protein AAPJ precursor
           [Brucella abortus bv. 9 str. C68]
 gi|260563783|ref|ZP_05834269.1| cationic amino acid ABC transporter [Brucella melitensis bv. 1 str.
           16M]
 gi|260754500|ref|ZP_05866848.1| cationic amino acid ABC transporter [Brucella abortus bv. 6 str.
           870]
 gi|260883528|ref|ZP_05895142.1| cationic amino acid ABC transporter [Brucella abortus bv. 9 str.
           C68]
 gi|261213748|ref|ZP_05928029.1| cationic amino acid ABC transporter [Brucella abortus bv. 3 str.
           Tulya]
 gi|265990852|ref|ZP_06103409.1| cationic amino acid ABC transporter [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265994687|ref|ZP_06107244.1| cationic amino acid ABC transporter [Brucella melitensis bv. 3 str.
           Ether]
 gi|297248104|ref|ZP_06931822.1| general L-amino acid transport system substrate-binding protein
           [Brucella abortus bv. 5 str. B3196]
 gi|17983192|gb|AAL52392.1| general l-amino acid-binding periplasmic protein aapj precursor
           [Brucella melitensis bv. 1 str. 16M]
 gi|260153799|gb|EEW88891.1| cationic amino acid ABC transporter [Brucella melitensis bv. 1 str.
           16M]
 gi|260674608|gb|EEX61429.1| cationic amino acid ABC transporter [Brucella abortus bv. 6 str.
           870]
 gi|260873056|gb|EEX80125.1| cationic amino acid ABC transporter [Brucella abortus bv. 9 str.
           C68]
 gi|260915355|gb|EEX82216.1| cationic amino acid ABC transporter [Brucella abortus bv. 3 str.
           Tulya]
 gi|262765800|gb|EEZ11589.1| cationic amino acid ABC transporter [Brucella melitensis bv. 3 str.
           Ether]
 gi|263001636|gb|EEZ14211.1| cationic amino acid ABC transporter [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|297175273|gb|EFH34620.1| general L-amino acid transport system substrate-binding protein
           [Brucella abortus bv. 5 str. B3196]
          Length = 343

 Score =  410 bits (1055), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 188/344 (54%), Positives = 251/344 (72%), Gaps = 3/344 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           M K     +L    LF  +   +A  L D+K +GFL+CG+NTGL+GFA     G+W GFD
Sbjct: 1   MKKTLMTGVLGAAALFGIASGASADTLSDVKAKGFLQCGVNTGLLGFASPNDKGEWSGFD 60

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
           VD+CRA++SAIF DP+K+++ PLNAKERF A QS ++D+L RNT WT+ R+ SLGL F  
Sbjct: 61  VDYCRAVASAIFGDPTKVKFTPLNAKERFTAFQSGEVDVLIRNTTWTISRDTSLGLDFAG 120

Query: 121 ITYFDGQGFIMHKKK--GISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFER 178
           I Y+DGQGF+++ KK  GI+S  QLSGASICVQAGTTTEL +ADYF+A+ M+Y+P+VFE+
Sbjct: 121 INYYDGQGFMINSKKLAGINSALQLSGASICVQAGTTTELNMADYFRANKMEYNPVVFEK 180

Query: 179 VEEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWY 238
           +EE +AAY + RCDAYT D S+LY ++L    P +HVILP+IISK P    + QGD  W 
Sbjct: 181 IEEANAAYDSGRCDAYTTDQSSLYGVRLALANPDDHVILPEIISKEPFGLTVRQGDARWA 240

Query: 239 NIVSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYR 298
           ++V WTH A++ AEE GITQ N+ ++ K + NPD++R LG +  + IG  LGL KDW  +
Sbjct: 241 DVVRWTHNALLNAEEYGITQANVEEMKK-SDNPDIKRLLGAEADTKIGTDLGLDKDWVVK 299

Query: 299 IIRHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           II+ +GNYGE+F+RN+G+ S LKI RG NA W+KGGL Y  P+R
Sbjct: 300 IIKGVGNYGEIFERNIGSGSPLKIARGLNAQWNKGGLQYGIPVR 343


>gi|254713861|ref|ZP_05175672.1| lysine-arginine-ornithine-binding periplasmic protein [Brucella
           ceti M644/93/1]
 gi|254717082|ref|ZP_05178893.1| lysine-arginine-ornithine-binding periplasmic protein [Brucella
           ceti M13/05/1]
 gi|261218893|ref|ZP_05933174.1| cationic amino acid ABC transporter [Brucella ceti M13/05/1]
 gi|261321608|ref|ZP_05960805.1| cationic amino acid ABC transporter [Brucella ceti M644/93/1]
 gi|260923982|gb|EEX90550.1| cationic amino acid ABC transporter [Brucella ceti M13/05/1]
 gi|261294298|gb|EEX97794.1| cationic amino acid ABC transporter [Brucella ceti M644/93/1]
          Length = 343

 Score =  410 bits (1055), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 188/344 (54%), Positives = 251/344 (72%), Gaps = 3/344 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           M K     +L    LF  +   +A  L D+K +GFL+CG+NTGL+GFA     G+W GFD
Sbjct: 1   MKKTLMTGVLGAAALFGIASGASADTLSDVKAKGFLQCGVNTGLLGFASPNDKGEWSGFD 60

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
           VD+CRA++SAIF DP+K+++ PLNAKERF ALQS ++D+L RNT WT+ R+ SLGL F  
Sbjct: 61  VDYCRAVASAIFGDPTKVKFTPLNAKERFTALQSGEVDVLIRNTTWTISRDTSLGLDFAG 120

Query: 121 ITYFDGQGFIMHKKK--GISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFER 178
           I Y+DGQGF+++ KK  GI+S  QLSGASICVQ GTTTEL +ADYF+A+ M+Y+P+VFE+
Sbjct: 121 INYYDGQGFMINSKKLAGINSALQLSGASICVQVGTTTELNMADYFRANKMEYNPVVFEK 180

Query: 179 VEEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWY 238
           +EE +AAY + RCDAYT D S+LY ++L    P +HVILP+IISK P    + QGD  W 
Sbjct: 181 IEEANAAYDSGRCDAYTTDQSSLYGVRLALANPDDHVILPEIISKEPFGLTVRQGDARWA 240

Query: 239 NIVSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYR 298
           ++V WTH A++ AEE GITQ N+ ++ K + NPD++R LG +  + IG  LGL KDW  +
Sbjct: 241 DVVRWTHNALLNAEEYGITQANVEEMKK-SDNPDIKRLLGAEADTKIGTDLGLDKDWVVK 299

Query: 299 IIRHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           II+ +GNYGE+F+RN+G+ S LKI RG NA W+KGGL Y  P+R
Sbjct: 300 IIKGVGNYGEIFERNIGSGSPLKIARGLNAEWNKGGLQYGIPVR 343


>gi|225852259|ref|YP_002732492.1| lysine-arginine-ornithine-binding periplasmic protein [Brucella
           melitensis ATCC 23457]
 gi|256264234|ref|ZP_05466766.1| cationic amino acid ABC transporter [Brucella melitensis bv. 2 str.
           63/9]
 gi|225640624|gb|ACO00538.1| lysine-arginine-ornithine-binding periplasmic protein [Brucella
           melitensis ATCC 23457]
 gi|263094479|gb|EEZ18301.1| cationic amino acid ABC transporter [Brucella melitensis bv. 2 str.
           63/9]
          Length = 343

 Score =  409 bits (1052), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 188/344 (54%), Positives = 250/344 (72%), Gaps = 3/344 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           M K     +L    LF  +   +A  L D+K +GFL+CG+NTGL+GFA     G+W GFD
Sbjct: 1   MKKTLMTGVLGAAALFGIASGASADTLSDVKAKGFLQCGVNTGLLGFASPNDKGEWSGFD 60

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
           VD+CRA++SAIF DP+K+++ PLNAKERF A QS ++D+L RNT WT+ R+ SLGL F  
Sbjct: 61  VDYCRAVASAIFGDPTKVKFTPLNAKERFTAFQSGEVDVLIRNTTWTISRDTSLGLDFAG 120

Query: 121 ITYFDGQGFIMHKKK--GISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFER 178
           I Y+DGQGF+++ KK  GI+S  QLSGASICVQAGTTTEL +ADYF+A+ M+Y+P VFE+
Sbjct: 121 INYYDGQGFMINSKKLAGINSALQLSGASICVQAGTTTELNMADYFRANKMEYNPAVFEK 180

Query: 179 VEEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWY 238
           +EE +AAY + RCDAYT D S+LY ++L    P +HVILP+IISK P    + QGD  W 
Sbjct: 181 IEEANAAYDSGRCDAYTTDQSSLYGVRLALANPDDHVILPEIISKEPFGLTVRQGDARWA 240

Query: 239 NIVSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYR 298
           ++V WTH A++ AEE GITQ N+ ++ K + NPD++R LG +  + IG  LGL KDW  +
Sbjct: 241 DVVRWTHNALLNAEEYGITQANVEEMKK-SDNPDIKRLLGAEADTKIGTDLGLDKDWVVK 299

Query: 299 IIRHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           II+ +GNYGE+F+RN+G+ S LKI RG NA W+KGGL Y  P+R
Sbjct: 300 IIKGVGNYGEIFERNIGSGSPLKIARGLNAQWNKGGLQYGIPVR 343


>gi|294852106|ref|ZP_06792779.1| general L-amino acid transport system substrate-binding protein
           [Brucella sp. NVSL 07-0026]
 gi|294820695|gb|EFG37694.1| general L-amino acid transport system substrate-binding protein
           [Brucella sp. NVSL 07-0026]
          Length = 338

 Score =  407 bits (1047), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 186/339 (54%), Positives = 249/339 (73%), Gaps = 3/339 (0%)

Query: 6   FVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCR 65
              +L    LF  +   +A  L D+K +GFL+CG+NTGL+GFA     G+W GFDVD+CR
Sbjct: 1   MTGVLGAAALFGIASGASADTLSDVKAKGFLQCGVNTGLLGFASPNDKGEWSGFDVDYCR 60

Query: 66  ALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFD 125
           A++SAIF DP+K+++ PLNAKERF ALQS ++D+L RNT WT+ R+ SLGL F  I Y+D
Sbjct: 61  AVASAIFGDPTKVKFTPLNAKERFTALQSGEVDVLIRNTTWTISRDTSLGLDFAGINYYD 120

Query: 126 GQGFIMHKKK--GISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEID 183
           GQGF+++ KK  GI+S  QLSGASICVQAGTTTEL +ADYF+A+ M+Y+P+VFE++EE +
Sbjct: 121 GQGFMINSKKLAGINSALQLSGASICVQAGTTTELNMADYFRANKMEYNPVVFEKIEEAN 180

Query: 184 AAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSW 243
           AAY + RCDAYT D S+LY ++L    P +HVILP+IISK P    + QGD  W ++V W
Sbjct: 181 AAYDSGRCDAYTTDQSSLYGVRLALANPDDHVILPEIISKEPFGLTVRQGDARWADVVRW 240

Query: 244 THYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHM 303
           TH A++ AEE GITQ N+ ++ K + NPD++R LG +  + IG  LGL KDW  +II+ +
Sbjct: 241 THNALLNAEEYGITQANVEEMKK-SDNPDIKRLLGAEADTKIGTDLGLDKDWVVKIIKGV 299

Query: 304 GNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           GNYGE+F+RN+G+ S LKI RG N  W+KGGL Y  P+R
Sbjct: 300 GNYGEIFERNIGSGSPLKIARGLNVQWNKGGLQYGIPVR 338


>gi|256159474|ref|ZP_05457242.1| lysine-arginine-ornithine-binding periplasmic protein [Brucella
           ceti M490/95/1]
 gi|256254760|ref|ZP_05460296.1| lysine-arginine-ornithine-binding periplasmic protein [Brucella
           ceti B1/94]
 gi|261221938|ref|ZP_05936219.1| cationic amino acid ABC transporter [Brucella ceti B1/94]
 gi|265997901|ref|ZP_06110458.1| cationic amino acid ABC transporter [Brucella ceti M490/95/1]
 gi|260920522|gb|EEX87175.1| cationic amino acid ABC transporter [Brucella ceti B1/94]
 gi|262552369|gb|EEZ08359.1| cationic amino acid ABC transporter [Brucella ceti M490/95/1]
          Length = 343

 Score =  407 bits (1045), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 187/344 (54%), Positives = 250/344 (72%), Gaps = 3/344 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           M K     +L    LF  +   +A  L D+K +GFL+CG+NTGL+GFA     G+W GFD
Sbjct: 1   MKKTLMTGVLGAAALFGIASGASADTLSDVKAKGFLQCGVNTGLLGFASPNDKGEWSGFD 60

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
           VD CRA++SAIF DP+K+++ PLNAKERF ALQS ++D+L RNT WT+ R+ SLGL F  
Sbjct: 61  VDSCRAVASAIFGDPTKVKFTPLNAKERFTALQSGEVDVLIRNTTWTISRDTSLGLDFAG 120

Query: 121 ITYFDGQGFIMHKKK--GISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFER 178
           I Y+DGQGF+++ KK   I+S  QLSGASICVQAG+TTEL +ADYF+A+ M+Y+P+VFE+
Sbjct: 121 INYYDGQGFMINSKKLADINSALQLSGASICVQAGSTTELNMADYFRANKMEYNPVVFEK 180

Query: 179 VEEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWY 238
           +EE +AAY + RCDAYT D S+LY ++L    P +HVILP+IISK P    + QGD  W 
Sbjct: 181 IEEANAAYDSGRCDAYTTDQSSLYGVRLALANPDDHVILPEIISKEPFGLTVRQGDARWA 240

Query: 239 NIVSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYR 298
           ++V WTH A++ AEE GITQ N+ ++ K + NPD++R LG +  + IG  LGL KDW  +
Sbjct: 241 DVVRWTHNALLNAEEYGITQANVEEMKK-SDNPDIKRLLGAEADTKIGTDLGLDKDWVVK 299

Query: 299 IIRHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           II+ +GNYGE+F+RN+G+ S LKI RG NA W+KGGL Y  P+R
Sbjct: 300 IIKGVGNYGEIFERNIGSGSPLKIARGLNAQWNKGGLQYGIPVR 343


>gi|326408764|gb|ADZ65829.1| lysine-arginine-ornithine-binding periplasmic protein [Brucella
           melitensis M28]
 gi|326538482|gb|ADZ86697.1| lysine-arginine-ornithine-binding periplasmic protein [Brucella
           melitensis M5-90]
          Length = 338

 Score =  406 bits (1044), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 186/339 (54%), Positives = 248/339 (73%), Gaps = 3/339 (0%)

Query: 6   FVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCR 65
              +L    LF  +   +A  L D+K +GFL+CG+NTGL+GFA     G+W GFDVD+CR
Sbjct: 1   MTGVLGAAALFGIASGASADTLSDVKAKGFLQCGVNTGLLGFASPNDKGEWSGFDVDYCR 60

Query: 66  ALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFD 125
           A++SAIF DP+K+++ PLNAKERF A QS ++D+L RNT WT+ R+ SLGL F  I Y+D
Sbjct: 61  AVASAIFGDPTKVKFTPLNAKERFTAFQSGEVDVLIRNTTWTISRDTSLGLDFAGINYYD 120

Query: 126 GQGFIMHKKK--GISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEID 183
           GQGF+++ KK  GI+S  QLSGASICVQAGTTTEL +ADYF+A+ M+Y+P VFE++EE +
Sbjct: 121 GQGFMINSKKLAGINSALQLSGASICVQAGTTTELNMADYFRANKMEYNPAVFEKIEEAN 180

Query: 184 AAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSW 243
           AAY + RCDAYT D S+LY ++L    P +HVILP+IISK P    + QGD  W ++V W
Sbjct: 181 AAYDSGRCDAYTTDQSSLYGVRLALANPDDHVILPEIISKEPFGLTVRQGDARWADVVRW 240

Query: 244 THYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHM 303
           TH A++ AEE GITQ N+ ++ K + NPD++R LG +  + IG  LGL KDW  +II+ +
Sbjct: 241 THNALLNAEEYGITQANVEEMKK-SDNPDIKRLLGAEADTKIGTDLGLDKDWVVKIIKGV 299

Query: 304 GNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           GNYGE+F+RN+G+ S LKI RG NA W+KGGL Y  P+R
Sbjct: 300 GNYGEIFERNIGSGSPLKIARGLNAQWNKGGLQYGIPVR 338


>gi|220926164|ref|YP_002501466.1| family 3 extracellular solute-binding protein [Methylobacterium
           nodulans ORS 2060]
 gi|219950771|gb|ACL61163.1| extracellular solute-binding protein family 3 [Methylobacterium
           nodulans ORS 2060]
          Length = 337

 Score =  400 bits (1028), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 179/333 (53%), Positives = 240/333 (72%), Gaps = 2/333 (0%)

Query: 10  LCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSS 69
           L L +   +  +   + L  IK++GF+ CG N GL GF    A G W G DVDFCRAL++
Sbjct: 7   LSLSVCLLSGAAQAQATLASIKQKGFIACGSNPGLAGFGVPDAQGRWTGLDVDFCRALAA 66

Query: 70  AIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGF 129
           AIF+D ++++++PL+AK+RF ALQS ++D+LSRNT WT+ R+ SLGL F  + ++DGQGF
Sbjct: 67  AIFNDTTRVRFIPLSAKDRFTALQSGEVDVLSRNTTWTMSRDTSLGLDFPSVNFYDGQGF 126

Query: 130 IMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAH 189
           ++ KK G++S  QL GASIC Q GTTTEL LADYF+A+ +KY  + F   +E   AY + 
Sbjct: 127 MVKKKLGVTSAKQLDGASICTQQGTTTELNLADYFRANKLKYEAVAFATADETFKAYDSG 186

Query: 190 RCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMV 249
           RCDA+T D S LYA +L    P ++V+LP++ISK PL PA+  GD++W +IV WTH+AM+
Sbjct: 187 RCDAFTTDASGLYAERLRASNPDDNVVLPEVISKEPLGPAVRHGDSQWADIVRWTHFAML 246

Query: 250 TAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEM 309
            AEE GITQ N++Q+ K T NPDV+R LG +     GE +GLT DW YRII+ +GNYGE+
Sbjct: 247 NAEEAGITQANVDQMLKSTDNPDVKRILGTE--GKFGEGIGLTNDWAYRIIKLVGNYGEV 304

Query: 310 FDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           F+RN+G  S+LKI RG NALWSKGGL Y PPIR
Sbjct: 305 FERNVGQGSQLKIQRGVNALWSKGGLQYGPPIR 337


>gi|325292970|ref|YP_004278834.1| general L-amino acid-binding periplasmic protein AapJ precursor
           [Agrobacterium sp. H13-3]
 gi|325060823|gb|ADY64514.1| general L-amino acid-binding periplasmic protein AapJ precursor
           [Agrobacterium sp. H13-3]
          Length = 340

 Score =  399 bits (1026), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 172/342 (50%), Positives = 251/342 (73%), Gaps = 2/342 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           M K    +++   +L   S ++ A+ L D+K +GF+ CG++ G+ GF+     G+W G D
Sbjct: 1   MKKAILSAVIGAAVLGGASVAS-AATLQDVKSKGFVTCGVSAGIPGFSNPDDKGEWSGID 59

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
           VD+CR +++A+F DP+K +++ L++K+RF ALQS ++D+L+RNT WT+ R+ SLG  FR 
Sbjct: 60  VDYCRGIATAVFGDPTKAKFVALSSKDRFPALQSGEVDVLTRNTTWTISRDTSLGFNFRT 119

Query: 121 ITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVE 180
           + Y+DGQGFI  K   + S  +LSGA++CVQ GTTTEL LADYFK +N++Y+P+VFE+  
Sbjct: 120 VNYYDGQGFIAKKGLNVKSALELSGAAVCVQTGTTTELNLADYFKTNNLQYNPVVFEKES 179

Query: 181 EIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNI 240
           +  +AY + RCD YT D S LYA++L    P ++++LP++ISK PL PA+ QGD +W++I
Sbjct: 180 DATSAYDSGRCDVYTTDQSGLYAIRLKLKNPDDNIVLPEVISKEPLGPAVRQGDDQWFDI 239

Query: 241 VSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRII 300
           V+W HYAMV AEELGIT KN+++  K++ NPD++R LG ++ + IG  LG+T DW Y I+
Sbjct: 240 VTWVHYAMVNAEELGITSKNVDE-QKNSANPDIKRLLGTEEGTKIGTDLGVTNDWAYNIV 298

Query: 301 RHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           + +GNYGE+FDRN+G  S LKI RG NALW+KGGL YAPP+R
Sbjct: 299 KKVGNYGEVFDRNVGAGSPLKIERGQNALWTKGGLQYAPPVR 340


>gi|163760315|ref|ZP_02167398.1| ABC transporter, amino acid binding protein [Hoeflea phototrophica
           DFL-43]
 gi|162282714|gb|EDQ33002.1| ABC transporter, amino acid binding protein [Hoeflea phototrophica
           DFL-43]
          Length = 340

 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 170/316 (53%), Positives = 238/316 (75%), Gaps = 3/316 (0%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           L D+K +GF++CG++TGL GF+     G+W G DVD CR +++A+F D S +++ PL+AK
Sbjct: 28  LDDVKAKGFVQCGVSTGLAGFSAPNDAGEWSGIDVDLCRGVAAAVFGDASAVKFSPLSAK 87

Query: 87  ERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGA 146
           ERF ALQS +ID+LSRNT WT+ R+  LGL F  + Y+DGQGF++ K  G++S  QLSGA
Sbjct: 88  ERFTALQSGEIDVLSRNTTWTMSRDTQLGLNFAGVNYYDGQGFMVRKSLGVTSALQLSGA 147

Query: 147 SICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKL 206
           S+CVQ GTTTEL L DYFKA++M Y+P+VFE++EE++AAY A+RCD YT D S LY+++L
Sbjct: 148 SVCVQTGTTTELNLTDYFKANDMTYNPVVFEKLEEVNAAYDANRCDVYTTDQSGLYSIRL 207

Query: 207 TNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSK 266
               P EH++LP++ISK PL P + QGD +W+NIV W H AM+ AEE+GIT  N+++++ 
Sbjct: 208 GLSAPDEHMVLPEVISKEPLGPVVRQGDDQWFNIVKWVHNAMLNAEEMGITSANVDEMAA 267

Query: 267 DTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGY 326
            + +P+V R LG  K    GE +G++ DW Y++++ +GNYGE+F+RN+G  + L I RG 
Sbjct: 268 -SADPNVMRLLG--KEGTFGEGIGVSNDWAYQVVKQVGNYGEVFERNVGASTPLAIDRGV 324

Query: 327 NALWSKGGLMYAPPIR 342
           NALWSKGGL YAPPIR
Sbjct: 325 NALWSKGGLQYAPPIR 340


>gi|222148880|ref|YP_002549837.1| ABC transporter substrate binding protein (amino acid)
           [Agrobacterium vitis S4]
 gi|221735866|gb|ACM36829.1| ABC transporter substrate binding protein (amino acid)
           [Agrobacterium vitis S4]
          Length = 341

 Score =  391 bits (1005), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 172/316 (54%), Positives = 234/316 (74%), Gaps = 1/316 (0%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           L D+K +GF++CG++ G+ GF+     GDW G DVD+CR +++A+F D SK ++ P++AK
Sbjct: 27  LSDVKAKGFVQCGVSQGIPGFSAPNDKGDWSGLDVDYCRGIAAAVFGDASKAKFTPVSAK 86

Query: 87  ERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGA 146
           +RF ALQS +ID+L+RNT WT+ R+ SLG  FR + Y+DGQGF+  K   + S  +LSGA
Sbjct: 87  DRFPALQSGEIDVLTRNTTWTISRDTSLGFNFRTVNYYDGQGFMAKKSLNVKSALELSGA 146

Query: 147 SICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKL 206
           ++CVQ GTTTEL LADYFKA+ +KY+P+VFE+ ++  AAY A RCD YT D S LYA++L
Sbjct: 147 AVCVQTGTTTELNLADYFKANGLKYNPVVFEKEDDATAAYDAGRCDVYTTDQSGLYAIRL 206

Query: 207 TNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSK 266
               P ++V+LP++ISK PL PA+ QGD +W+++VSW HYAMV AEE G+T KNI+ + K
Sbjct: 207 KLKNPDDNVVLPEVISKEPLGPAVRQGDDKWFDVVSWVHYAMVNAEEAGVTSKNIDDL-K 265

Query: 267 DTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGY 326
               PD++R LG +  S +G  LGL +DW Y +I+ +GNYGE+FDRN+G  S LKI RG 
Sbjct: 266 ANGGPDIKRMLGAEAGSKLGTDLGLKEDWAYNVIKLVGNYGEVFDRNVGVGSPLKIARGV 325

Query: 327 NALWSKGGLMYAPPIR 342
           NALWSKGGL Y PPIR
Sbjct: 326 NALWSKGGLQYGPPIR 341


>gi|170743936|ref|YP_001772591.1| cationic amino acid ABC transporter periplasmic binding protein
           [Methylobacterium sp. 4-46]
 gi|168198210|gb|ACA20157.1| cationic amino acid ABC transporter, periplasmic binding protein
           [Methylobacterium sp. 4-46]
          Length = 340

 Score =  390 bits (1003), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 174/313 (55%), Positives = 232/313 (74%), Gaps = 2/313 (0%)

Query: 30  IKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERF 89
           IK++GF+ CG N GL GF    A G W G DVDFCRAL++A+F+D +K++++PL+AK+RF
Sbjct: 30  IKQKGFIACGSNPGLAGFGVPDAQGRWTGLDVDFCRALAAAVFNDTTKVRFIPLSAKDRF 89

Query: 90  LALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASIC 149
            ALQS ++D+LSRNT WT+ R+ +LGL F  + ++DGQGF++ KK G++S  QL GASIC
Sbjct: 90  TALQSGEVDVLSRNTTWTMSRDTALGLDFPAVNFYDGQGFMVKKKLGVTSAKQLDGASIC 149

Query: 150 VQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTND 209
            Q GTTTEL LADYF+A+ +KY  + F   +E   AY + RCDA+T D S LYA +L   
Sbjct: 150 TQQGTTTELNLADYFRANKLKYEVVAFATSDETFKAYDSGRCDAFTTDASGLYAERLRAA 209

Query: 210 RPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTT 269
            P ++++LP++ISK PL PA+  GD++W +IV WTHYAM+ AEE GITQ N++Q+ K T 
Sbjct: 210 NPDDNIVLPEVISKEPLGPAVRHGDSQWADIVRWTHYAMLNAEEAGITQANVDQMVKATD 269

Query: 270 NPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNAL 329
           NPDV+R LG +     GE +GL+ DW YRII+ +GNYGE+F+RN+G  S LKI RG NAL
Sbjct: 270 NPDVKRILGTE--GKFGEGIGLSNDWAYRIIKLVGNYGEVFERNVGQGSPLKIQRGVNAL 327

Query: 330 WSKGGLMYAPPIR 342
           WSKGGL Y PPIR
Sbjct: 328 WSKGGLQYGPPIR 340


>gi|182678577|ref|YP_001832723.1| cationic amino acid ABC transporter, periplasmic binding protein
           [Beijerinckia indica subsp. indica ATCC 9039]
 gi|182634460|gb|ACB95234.1| cationic amino acid ABC transporter, periplasmic binding protein
           [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 336

 Score =  390 bits (1002), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 178/319 (55%), Positives = 234/319 (73%), Gaps = 3/319 (0%)

Query: 24  ASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPL 83
           A  L ++K RGFL CG N GL GF      G W GFD+DFCRA+++AIFDDP+K+++LPL
Sbjct: 21  AGTLDEVKGRGFLNCGSNPGLAGFGLPDDKGQWVGFDIDFCRAVAAAIFDDPTKVKFLPL 80

Query: 84  NAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQL 143
           + K+RF ALQS +IDILSRNT WT  RE+  G  F  ITY+DGQGF+ H+K  ++S  +L
Sbjct: 81  SGKDRFTALQSGEIDILSRNTTWTQSREVGQGFLFTGITYYDGQGFMTHRKLNLTSALEL 140

Query: 144 SGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYA 203
           +GASICVQ GTTTEL LAD+F+A+N++Y P+ F   +E   AY   RCDA T D S LYA
Sbjct: 141 AGASICVQQGTTTELNLADFFRANNLQYEPVNFATGDEALKAYDTGRCDALTTDASGLYA 200

Query: 204 LKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQ 263
            +     P +HV+LP+IISK PL P + QGD +W+N+V W H+A + AEE G+T KN+++
Sbjct: 201 QRAKLANPDDHVVLPEIISKEPLGPLVRQGDDQWFNLVKWVHFAWLNAEEDGVTSKNLDE 260

Query: 264 VSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIP 323
            +K + +P+++R LG +   N GE LGLT+DW YRII+H+GNYGE+FDRNLG  S+LKI 
Sbjct: 261 KTK-SESPEIKRLLGFE--GNFGEGLGLTRDWIYRIIKHVGNYGEVFDRNLGEGSKLKIK 317

Query: 324 RGYNALWSKGGLMYAPPIR 342
           RG N LW+KGGL YAPP+R
Sbjct: 318 RGINNLWTKGGLHYAPPVR 336


>gi|217977867|ref|YP_002362014.1| cationic amino acid ABC transporter, periplasmic binding protein
           [Methylocella silvestris BL2]
 gi|217503243|gb|ACK50652.1| cationic amino acid ABC transporter, periplasmic binding protein
           [Methylocella silvestris BL2]
          Length = 340

 Score =  390 bits (1001), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 180/335 (53%), Positives = 239/335 (71%), Gaps = 3/335 (0%)

Query: 8   SILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRAL 67
           ++  L ++   +    A +L  ++KRG++ CG N G+ GF      G W GFDVDFCRA+
Sbjct: 9   TLFALGLMIGCAQGAQAGLLDQVQKRGYVICGSNPGVPGFGLPDDKGGWTGFDVDFCRAV 68

Query: 68  SSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQ 127
           ++AIF+DP+K++++ L+AK+RF ALQS ++D+LSRNT WTL RE   G  F  ITY+DGQ
Sbjct: 69  AAAIFNDPTKVKFIALSAKDRFTALQSGEVDLLSRNTTWTLSRETGQGFLFAGITYYDGQ 128

Query: 128 GFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYR 187
           GF++ KK  +SS  +LSGASICVQ GTTTEL LAD+F+ +NMKY P+ F   EE   A+ 
Sbjct: 129 GFLVRKKLNLSSALELSGASICVQQGTTTELNLADFFRGNNMKYEPVNFANAEEAVRAFE 188

Query: 188 AHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYA 247
             RCDAYT D S LY  +     P + V+LP+IISK PL PA+ QGD  W+N+V WT +A
Sbjct: 189 GGRCDAYTTDASGLYVERQRLADPEDSVVLPEIISKEPLGPAVRQGDDGWFNVVKWTLFA 248

Query: 248 MVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYG 307
           +V AEELG+T KN+++ +K +  P+V+R LG +   N GE LGL  DW YRI++H+GNYG
Sbjct: 249 LVNAEELGVTSKNVDEKAK-SDRPEVRRLLGFE--GNFGEPLGLDADWAYRIVKHVGNYG 305

Query: 308 EMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           E+FDRNLG+ S LKI RG NALW+KGGL YAPPIR
Sbjct: 306 EIFDRNLGDSSPLKIKRGINALWTKGGLQYAPPIR 340


>gi|90419549|ref|ZP_01227459.1| lysine-arginine-ornithine-binding periplasmic protein [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90336486|gb|EAS50227.1| lysine-arginine-ornithine-binding periplasmic protein [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 334

 Score =  387 bits (995), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 170/337 (50%), Positives = 244/337 (72%), Gaps = 3/337 (0%)

Query: 6   FVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCR 65
             ++L L +        +A  L  +K RG L+CG+NTGL GFA     G W+G D+D+C+
Sbjct: 1   MTAVLGLTVAGVAVSGASAQTLQTVKDRGVLRCGVNTGLPGFASQNDQGAWQGLDIDYCK 60

Query: 66  ALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFD 125
           A+++A+F DPSK++Y PL+A +RF ALQ+ ++D+L+RNT WT+ R+ +LGL F  + Y+D
Sbjct: 61  AIAAAVFGDPSKVEYSPLSAVQRFPALQNNEVDVLARNTTWTMDRDTTLGLTFAGVNYYD 120

Query: 126 GQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAA 185
           GQGF++ K  G++S  +LSGA++CVQ+GTTTEL LADYF+ +NM+Y+P+V E   ++++A
Sbjct: 121 GQGFMVKKDLGVNSALELSGATVCVQSGTTTELNLADYFRTNNMEYNPVVIESQSDVNSA 180

Query: 186 YRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTH 245
           Y + RCD  T D S L A +L      EH ILP+IISK PL PA+ QGDTEW+N+V WTH
Sbjct: 181 YDSGRCDVLTTDASGLAASRLEMGNADEHTILPEIISKEPLGPAVRQGDTEWFNVVKWTH 240

Query: 246 YAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGN 305
            A++ AEELG+TQ+N+  + K + NP+++R LG DK  N GE++GL++DW   II+ +GN
Sbjct: 241 NALLNAEELGVTQENVEDM-KTSENPEIRRLLGEDK--NFGESIGLSQDWAVNIIKAVGN 297

Query: 306 YGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           YGE+F+RN+G  + L+I RG NALW+KGGL Y  PIR
Sbjct: 298 YGEIFERNIGVDTPLEIARGQNALWTKGGLQYGMPIR 334


>gi|110633466|ref|YP_673674.1| cationic amino acid ABC transporter, periplasmic binding protein
           [Mesorhizobium sp. BNC1]
 gi|110284450|gb|ABG62509.1| general L-amino acid-binding protein [Chelativorans sp. BNC1]
          Length = 340

 Score =  387 bits (994), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 166/336 (49%), Positives = 246/336 (73%), Gaps = 3/336 (0%)

Query: 8   SILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRAL 67
           ++L  +++       +A+ L D+K RG L+CG+NTGL GFA     GDW+G DVD+C+A+
Sbjct: 7   ALLGTVVIASAVIPASAATLDDVKNRGALRCGVNTGLPGFAFQNDQGDWQGLDVDYCKAV 66

Query: 68  SSAIFD-DPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDG 126
           ++A+F+ D +K+QY PL+A +RF ALQ+ ++D+L+RNT WT+ R+ +LGL F  + Y+DG
Sbjct: 67  AAAVFEGDATKVQYSPLSAVQRFPALQNNEVDLLARNTTWTMNRDTALGLNFVGVNYYDG 126

Query: 127 QGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAY 186
           QGF++ +   ++S  QLSGA++CVQ+GTTTEL L DYF+A+NM+++P+V E+  ++++AY
Sbjct: 127 QGFMVRQDLNVTSALQLSGATVCVQSGTTTELNLTDYFRANNMEFNPVVIEQQSDVNSAY 186

Query: 187 RAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHY 246
              RCD  T D S LYA +L    P +HV+LP+IISK PL P + QGD +W++IV W H+
Sbjct: 187 EQGRCDVLTTDASGLYASRLELSNPDDHVVLPEIISKEPLGPVVRQGDEQWFDIVKWVHF 246

Query: 247 AMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNY 306
            ++ AEELG+TQ N+  ++ ++ NPDV+R LG D +   G+ +GLT DW   +I+ +GNY
Sbjct: 247 GLINAEELGVTQDNVEDMAANSENPDVRRLLGADGT--FGQDVGLTNDWMVNVIKAVGNY 304

Query: 307 GEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           GE+FDRN+G  + LKI RG NALW+KGGL YAPP+R
Sbjct: 305 GEIFDRNVGPNTPLKIQRGLNALWTKGGLQYAPPVR 340


>gi|159184823|ref|NP_354575.2| ABC transporter, substrate binding protein (amino acid)
           [Agrobacterium tumefaciens str. C58]
 gi|159140108|gb|AAK87360.2| ABC transporter, substrate binding protein (amino acid)
           [Agrobacterium tumefaciens str. C58]
          Length = 312

 Score =  386 bits (992), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 166/313 (53%), Positives = 235/313 (75%), Gaps = 1/313 (0%)

Query: 30  IKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERF 89
           +K +GF+ CG++ G+ GF+     G+W G DVD+CR +++A+F DPSK +++ L++K+RF
Sbjct: 1   MKGKGFVTCGVSAGIPGFSNPDDKGEWSGIDVDYCRGIATAVFGDPSKAKFVALSSKDRF 60

Query: 90  LALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASIC 149
            ALQS ++D+L+RNT WT+ R+ SLG  FR + Y+DGQGFI  K   + S  +LSGA++C
Sbjct: 61  PALQSGEVDVLTRNTTWTISRDTSLGFNFRTVNYYDGQGFIAKKGLNVKSALELSGAAVC 120

Query: 150 VQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTND 209
           VQ GTTTEL LADYFK +N++Y+P+VFE+  +  +AY + RCD YT D S LYA++L   
Sbjct: 121 VQTGTTTELNLADYFKTNNLQYNPVVFEKESDATSAYDSGRCDVYTTDQSGLYAIRLKLK 180

Query: 210 RPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTT 269
            P ++++LP++ISK PL PA+ QGD +W++IV+W HYAMV AEELGIT KN+++  K + 
Sbjct: 181 NPDDNIVLPEVISKEPLGPAVRQGDDQWFDIVTWVHYAMVNAEELGITSKNVDE-QKTSA 239

Query: 270 NPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNAL 329
           NPDV+R LG ++ + IG  LG+  DW Y I++ +GNYGE+FDRN+G  S LKI RG NAL
Sbjct: 240 NPDVKRLLGTEEGTKIGTDLGVGNDWAYNIVKLVGNYGEVFDRNVGAGSPLKIERGQNAL 299

Query: 330 WSKGGLMYAPPIR 342
           W+KGGL YAPP+R
Sbjct: 300 WTKGGLQYAPPVR 312


>gi|330504740|ref|YP_004381609.1| extracellular solute-binding protein [Pseudomonas mendocina NK-01]
 gi|328919026|gb|AEB59857.1| extracellular solute-binding protein [Pseudomonas mendocina NK-01]
          Length = 342

 Score =  384 bits (986), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 172/342 (50%), Positives = 240/342 (70%), Gaps = 2/342 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           M K     +    +L  + F+   + L  ++K+GF++CGI+ GL GF+     G++ G D
Sbjct: 3   MVKSTLAVLTTAAVLGVSGFAQAGATLDAVQKKGFVQCGISDGLPGFSYADEKGNYLGLD 62

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
           VD CRA+++A+F D +K++Y PL AKERF ALQS ++DILSRNT WT  R+ +LGL F  
Sbjct: 63  VDVCRAVAAAVFGDATKVKYSPLTAKERFTALQSGEVDILSRNTTWTSSRDAALGLNFTG 122

Query: 121 ITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVE 180
           +TY+DGQGF+++KK G+SS  +L GA++C+QAGTTTEL L+DYF+A+ MKY PI ++  +
Sbjct: 123 VTYYDGQGFLVNKKLGVSSAKELDGATVCIQAGTTTELNLSDYFRANGMKYTPITYDTSD 182

Query: 181 EIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNI 240
           E   +  A RCD  T D S LYA ++    P ++V+LP++ISK PL P++ QGD EW++I
Sbjct: 183 ESAKSVEAGRCDVLTSDQSQLYAQRIKLANPDDYVVLPEVISKEPLGPSVRQGDEEWFDI 242

Query: 241 VSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRII 300
           V WT +AM+ AEELG+T  N+ + +K T NPDV R LG +     G+ L L KDW  +I+
Sbjct: 243 VRWTLFAMLNAEELGVTSANVEETAKTTKNPDVARLLGAE--GEFGKDLKLPKDWAVQIV 300

Query: 301 RHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           + +GNYGE FDRN+G  SELKI RG NALW+KGGL YAPP+R
Sbjct: 301 KQVGNYGESFDRNVGAGSELKIERGLNALWNKGGLQYAPPVR 342


>gi|307942366|ref|ZP_07657717.1| general L-amino acid-binding periplasmic protein AapJ [Roseibium
           sp. TrichSKD4]
 gi|307774652|gb|EFO33862.1| general L-amino acid-binding periplasmic protein AapJ [Roseibium
           sp. TrichSKD4]
          Length = 371

 Score =  382 bits (980), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 170/316 (53%), Positives = 232/316 (73%), Gaps = 3/316 (0%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           L D+K +GF++CG++ GL GF+   + G+W G DVD CRA+++AIFDD + +++ PL+AK
Sbjct: 59  LDDVKAKGFVQCGVSQGLPGFSNPDSQGNWTGLDVDVCRAMAAAIFDDVNAVKFTPLSAK 118

Query: 87  ERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGA 146
           ERF ALQS +ID+LSRNT WT+ R+ SLGL F  + Y+DGQGF++ K  G++S  +LSGA
Sbjct: 119 ERFTALQSGEIDVLSRNTTWTMTRDTSLGLNFAGVNYYDGQGFMVRKDLGVTSALELSGA 178

Query: 147 SICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKL 206
           S+C   GTTTEL +ADYF+A+NM Y  + FE+ +E+ AAY A RCD YT D S LYA +L
Sbjct: 179 SVCTNTGTTTELNVADYFRANNMPYEIVAFEKADEVVAAYDAGRCDVYTTDASGLYAQRL 238

Query: 207 TNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSK 266
               P +H++LP+IISK PL P + QGD +W+N+V WT  AM+ AEELG+T  N++ + K
Sbjct: 239 KLTNPGDHMVLPEIISKEPLGPVVRQGDDQWFNLVKWTLNAMINAEELGVTSANVDDM-K 297

Query: 267 DTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGY 326
            + NP V+R LG + +   GE +GLT DW  RII+H+GNYGE FD N+G  + L I RG 
Sbjct: 298 GSDNPSVKRLLGTEGA--YGENIGLTNDWAARIIKHVGNYGESFDANVGPDTPLGIARGV 355

Query: 327 NALWSKGGLMYAPPIR 342
           NALWSKGG++YAPP+R
Sbjct: 356 NALWSKGGVLYAPPVR 371


>gi|316934242|ref|YP_004109224.1| cationic amino acid ABC transporter periplasmic-binding protein
           [Rhodopseudomonas palustris DX-1]
 gi|315601956|gb|ADU44491.1| cationic amino acid ABC transporter, periplasmic binding protein
           [Rhodopseudomonas palustris DX-1]
          Length = 338

 Score =  381 bits (979), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 171/322 (53%), Positives = 235/322 (72%), Gaps = 3/322 (0%)

Query: 21  STNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQY 80
           S +A  L  +K RG L CG++ GL GF+     G+W G DVD CRA+++AIFDDPSK+++
Sbjct: 20  SADAQTLKTVKDRGMLSCGVSQGLPGFSSPDDKGNWTGLDVDVCRAIAAAIFDDPSKVKF 79

Query: 81  LPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSV 140
           +PL+AK+RF ALQS +ID+LSRNT WTL R+ SLG+ F  I+Y+DGQGF+  K   ++S 
Sbjct: 80  VPLSAKDRFTALQSGEIDVLSRNTTWTLSRDTSLGVNFAGISYYDGQGFMAKKALKVNSA 139

Query: 141 SQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISA 200
            +L+GASICVQ GTT E  +ADYFK +NMKY  I F   +E   AY   RCD +T D+S 
Sbjct: 140 LELNGASICVQTGTTNEQNVADYFKGNNMKYEVIAFANADEAVKAYETGRCDVFTSDVSQ 199

Query: 201 LYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKN 260
           LYA +L    P++H++LP++ISK PL P +  GD +W++IV WT + ++ AEELG+TQKN
Sbjct: 200 LYAQRLKLATPADHIVLPEVISKEPLGPLVRHGDDQWFDIVKWTLFGLINAEELGVTQKN 259

Query: 261 INQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSEL 320
           +++++K +  P+++R  G D   N+GE LGLTKDW  RII+  GNYGE F+RN+G+ S+L
Sbjct: 260 VDEMAK-SDKPELKRVFGTD--GNLGEQLGLTKDWVARIIKATGNYGESFERNVGSGSKL 316

Query: 321 KIPRGYNALWSKGGLMYAPPIR 342
           +I RG N LW+KGG+MYAPPIR
Sbjct: 317 EIARGLNKLWNKGGIMYAPPIR 338


>gi|146340850|ref|YP_001205898.1| putative amino-acid ABC transporter substrate-binding protein
           [Bradyrhizobium sp. ORS278]
 gi|146193656|emb|CAL77673.1| putative amino-acid ABC transporter, substrate-binding protein
           [Bradyrhizobium sp. ORS278]
          Length = 338

 Score =  380 bits (977), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 171/326 (52%), Positives = 235/326 (72%), Gaps = 3/326 (0%)

Query: 17  FTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPS 76
             S    A  L  +K RG L CG++ GL GF+     G+W G DVD CRA+++AIF+DP+
Sbjct: 16  LASVGAQAETLKTVKDRGMLACGVSQGLPGFSNPDDKGNWTGLDVDVCRAIAAAIFNDPT 75

Query: 77  KIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKG 136
           K++Y+PL+AK+RF ALQS ++D+LSRNT WTL R+ SLG  F  ITY+DGQGF++ K   
Sbjct: 76  KVKYVPLSAKDRFTALQSGEVDVLSRNTTWTLSRDTSLGANFAGITYYDGQGFMVKKALK 135

Query: 137 ISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTG 196
           ++S  +L+ AS+CVQ GTTTE  LADYFKA+ MKY  I F   +E   AY + RCD +T 
Sbjct: 136 VNSALELNSASVCVQTGTTTEQNLADYFKANKMKYEVIAFAGADETVKAYESGRCDVFTT 195

Query: 197 DISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGI 256
           D+S LYA +L    P++HV+LP++ISK PL P +  GD +W++IV WT + ++TAEE+G+
Sbjct: 196 DVSGLYAERLKLANPADHVVLPEVISKEPLGPMVRHGDDQWFDIVKWTLFGLITAEEMGV 255

Query: 257 TQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGN 316
           TQ N+++++K +  PD +R  G D   N+GE LGLTKDW  RI++ +GNYGEM+DRN+G+
Sbjct: 256 TQANVDEMAK-SDKPDFKRAFGTD--GNLGEQLGLTKDWFSRIVKAVGNYGEMYDRNVGS 312

Query: 317 QSELKIPRGYNALWSKGGLMYAPPIR 342
            S+L+I RG N LW+KGGL YAPPIR
Sbjct: 313 GSKLQIARGLNQLWNKGGLQYAPPIR 338


>gi|146308575|ref|YP_001189040.1| extracellular solute-binding protein [Pseudomonas mendocina ymp]
 gi|145576776|gb|ABP86308.1| amino acid ABC transporter substrate-binding protein, PAAT family
           [Pseudomonas mendocina ymp]
          Length = 342

 Score =  380 bits (977), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 171/342 (50%), Positives = 237/342 (69%), Gaps = 2/342 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           M K     +    +L  + F+   + L  ++K+GF++CGI+ GL GF+     G++ G D
Sbjct: 3   MVKSTLAVLTTAAVLGVSGFAQAGATLDAVQKKGFVQCGISDGLPGFSYADEKGNYLGLD 62

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
           VD CRA+++A+F D +K++Y PL AKERF ALQS ++DILSRNT WT  R+  LGL F  
Sbjct: 63  VDVCRAVAAAVFGDATKVKYSPLTAKERFTALQSGEVDILSRNTTWTSSRDSGLGLNFAG 122

Query: 121 ITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVE 180
           + Y+DGQGF+++KK G+SS  +L GA++C+QAGTTTEL L+DYF+A+ +KY PI ++  +
Sbjct: 123 VNYYDGQGFLVNKKLGVSSAKELDGATVCIQAGTTTELNLSDYFRANGLKYTPITYDTSD 182

Query: 181 EIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNI 240
           E   +  A RCD  T D S LYA ++    P ++V+LP++ISK PL P + QGD EW+NI
Sbjct: 183 ESAKSVEAGRCDVLTSDQSQLYAQRIKLANPDDYVVLPEVISKEPLGPVVRQGDDEWFNI 242

Query: 241 VSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRII 300
           V W+ +AMV AEELG+T  N+ + +K T NPDV R LG +     G+ L L KDW  +I+
Sbjct: 243 VRWSLFAMVNAEELGVTSANVEETAKTTKNPDVARLLGAE--GEFGKDLKLPKDWAVQIV 300

Query: 301 RHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           + +GNYGE FDRN+G  SELKI RG NALW+KGGL YAPP+R
Sbjct: 301 KQVGNYGESFDRNVGAGSELKIERGLNALWNKGGLQYAPPVR 342


>gi|91977030|ref|YP_569689.1| lysine-arginine-ornithine-binding periplasmic protein
           [Rhodopseudomonas palustris BisB5]
 gi|91683486|gb|ABE39788.1| Lysine-arginine-ornithine-binding periplasmic protein
           [Rhodopseudomonas palustris BisB5]
          Length = 338

 Score =  380 bits (977), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 171/330 (51%), Positives = 236/330 (71%), Gaps = 3/330 (0%)

Query: 13  IILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIF 72
           I   F + S  A  L  +K RG L CG++ GL GF+     G+W G DVD CRA+++AIF
Sbjct: 12  ITACFAAQSAGAQTLKTVKDRGLLSCGVSQGLPGFSAPDDKGNWTGLDVDLCRAVAAAIF 71

Query: 73  DDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMH 132
           DDPSK++++PL+AK+RF ALQS +ID+LSRNT WT+ R+ SLG+ F  ++Y+DGQGF++ 
Sbjct: 72  DDPSKVKFVPLSAKDRFTALQSGEIDVLSRNTTWTVSRDTSLGVNFAGVSYYDGQGFLVK 131

Query: 133 KKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCD 192
           K   ++S  +L+ ASICVQ GTT E  +ADYFK +NMKY  I F   +E   AY + RCD
Sbjct: 132 KALKVNSALELNSASICVQTGTTNEQNVADYFKGNNMKYEVIAFANADEAIKAYESGRCD 191

Query: 193 AYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAE 252
            +T D+S LYA +L    P++HV+LP++ISK PL P +  GD +W++IV WT +A+V AE
Sbjct: 192 VFTSDVSQLYAQRLKVTTPADHVVLPEVISKEPLGPLVRHGDDQWFDIVKWTLFALVNAE 251

Query: 253 ELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDR 312
           ELG+TQ N+ +++K +  P+++R  G D   N+GE LGLTKDW  RI++  GNYGE F+R
Sbjct: 252 ELGVTQSNVGEMAK-SDKPELKRVFGSD--GNLGEQLGLTKDWVARIVKATGNYGESFER 308

Query: 313 NLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           N+G  S+L+I RG N LW+KGG+MYAPPIR
Sbjct: 309 NVGTGSKLEIARGLNKLWNKGGIMYAPPIR 338


>gi|39935626|ref|NP_947902.1| ABC transporter periplasmic amino acid binding protein aapJ-1
           [Rhodopseudomonas palustris CGA009]
 gi|39649479|emb|CAE28001.1| ABC transporter, periplasmic amino acid binding protein aapJ-1
           [Rhodopseudomonas palustris CGA009]
          Length = 338

 Score =  380 bits (976), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 169/320 (52%), Positives = 235/320 (73%), Gaps = 3/320 (0%)

Query: 23  NASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLP 82
           +A  L  +K RG L CG++ GL GF+     G+W G DVD CRA+++A+FDDPSK++++P
Sbjct: 22  DAQTLKTVKDRGMLSCGVSQGLPGFSAPDDKGNWAGLDVDVCRAIAAAVFDDPSKVKFVP 81

Query: 83  LNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQ 142
           L+AK+RF ALQS +ID+LSRNT WTL R+ SLG+ F  ++Y+DGQGF+  K   ++S  +
Sbjct: 82  LSAKDRFTALQSGEIDVLSRNTTWTLSRDTSLGVNFAGVSYYDGQGFMAKKSLKVNSALE 141

Query: 143 LSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALY 202
           L+GASICVQ GTT E  +ADYFK +NMKY  I F   +E   AY + RCD +T D+S LY
Sbjct: 142 LNGASICVQTGTTNEQNVADYFKGNNMKYEVIAFANADEAVKAYESGRCDVFTSDVSQLY 201

Query: 203 ALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNIN 262
           A +L    P++H +LP++ISK PL P +  GD +W++IV WT +A+V AEELG+TQKN++
Sbjct: 202 AQRLKLATPADHAVLPEVISKEPLGPLVRHGDDQWFDIVKWTLFALVNAEELGVTQKNVD 261

Query: 263 QVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKI 322
           +++K +  P+++R  G D   N+GE LGLTKDW  RI++  GNYGE F+RN+G+ S+L+I
Sbjct: 262 EMAK-SDKPELKRVFGTD--GNLGEQLGLTKDWVARIVKATGNYGESFERNVGSGSKLEI 318

Query: 323 PRGYNALWSKGGLMYAPPIR 342
            RG N LW+KGG+MYAPPIR
Sbjct: 319 ARGLNKLWNKGGIMYAPPIR 338


>gi|158423209|ref|YP_001524501.1| extracellular solute-binding protein [Azorhizobium caulinodans ORS
           571]
 gi|158330098|dbj|BAF87583.1| extracellular solute-binding protein [Azorhizobium caulinodans ORS
           571]
          Length = 336

 Score =  378 bits (970), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 172/329 (52%), Positives = 236/329 (71%), Gaps = 3/329 (0%)

Query: 14  ILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFD 73
           +L  T+ +  A  L D+K RG L CG++ GL GF+     G+WKG DVDFCRA+++AIF+
Sbjct: 11  VLALTAGAAKAGTLDDVKARGALNCGVSQGLPGFSSPDDKGNWKGLDVDFCRAVAAAIFN 70

Query: 74  DPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHK 133
           DP+K+++ PL+AK+RF ALQS  ID+LSRNT WT+ R+ +LG  F  + Y+DGQGFI+ K
Sbjct: 71  DPNKVRFTPLSAKDRFTALQSGAIDLLSRNTTWTMSRDTTLGFNFAGVMYYDGQGFIVRK 130

Query: 134 KKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDA 193
              I S  +L+GASICVQAGTTTEL L D+F+A+NMKY  I F   +E   AY + RCD+
Sbjct: 131 SLNIKSAKELNGASICVQAGTTTELNLGDFFRANNMKYEVITFSTEDETVKAYESGRCDS 190

Query: 194 YTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEE 253
           +T D S +YA+KL     ++HV+LP++ISK PL P +  GD +W+++V WT+YA++ +EE
Sbjct: 191 FTSDQSQIYAIKLKLTNAADHVVLPELISKEPLGPLVRHGDDQWFDLVKWTYYALLNSEE 250

Query: 254 LGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRN 313
           LG++QK ++Q S  +TNP+++R LG D     GE +GLT DW  RII+ +GNYGE+FDRN
Sbjct: 251 LGVSQKTLDQ-SMTSTNPEIKRLLGTD--GKFGEGIGLTNDWVVRIIKAVGNYGEIFDRN 307

Query: 314 LGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           +G  S L I RG N LW+KGGL Y  PIR
Sbjct: 308 VGTGSPLGIDRGENKLWNKGGLQYGMPIR 336


>gi|83648448|ref|YP_436883.1| amino acid ABC transporter periplasmic protein [Hahella chejuensis
           KCTC 2396]
 gi|83636491|gb|ABC32458.1| ABC-type amino acid transport/signal transduction systems,
           periplasmic component/domain [Hahella chejuensis KCTC
           2396]
          Length = 339

 Score =  377 bits (969), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 170/342 (49%), Positives = 236/342 (69%), Gaps = 3/342 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           M K F  ++  L  +  T  +     L  +KK+GF++CG++TGL GF+     G+W G D
Sbjct: 1   MKKTFVSAVAALGFMTATGAAMADGTLDAVKKKGFVQCGVSTGLPGFSNPDDKGNWMGLD 60

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
           VD CRA+++A   D SK++Y+PL AKERF ALQS +ID+LSRNT WTL R+ SLGL F  
Sbjct: 61  VDLCRAVAAATLGDASKVKYIPLTAKERFTALQSGEIDLLSRNTTWTLTRDGSLGLNFAG 120

Query: 121 ITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVE 180
           + Y+DGQGF++ K  G+ S  +L GA++C+QAGTTTEL LADYF+   MKY P+VF+  +
Sbjct: 121 VNYYDGQGFLVSKDLGVKSAKELDGAAVCIQAGTTTELNLADYFREFGMKYQPVVFDTSD 180

Query: 181 EIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNI 240
           +    + A RCD  T D S LYAL++    P + ++LP++ISK PL P + QGD +W+NI
Sbjct: 181 QTVKGFEAGRCDVLTSDQSQLYALRIQLSNPDKAMVLPEVISKEPLGPVVRQGDDQWFNI 240

Query: 241 VSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRII 300
           V W+ +A +TAEELG++  N++++ K +TNP+VQR LG +     G+ LGL   W + I+
Sbjct: 241 VKWSLFAAITAEELGVSSDNVDKM-KSSTNPNVQRLLGAEAGQ--GKNLGLDDTWAFNIV 297

Query: 301 RHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           + +GNYGEMF+RN+G  S L I RG NALW+KGGL YAPPIR
Sbjct: 298 KQVGNYGEMFERNVGKSSPLGIERGLNALWTKGGLQYAPPIR 339


>gi|192291210|ref|YP_001991815.1| extracellular solute-binding protein family 3 [Rhodopseudomonas
           palustris TIE-1]
 gi|192284959|gb|ACF01340.1| extracellular solute-binding protein family 3 [Rhodopseudomonas
           palustris TIE-1]
          Length = 353

 Score =  377 bits (969), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 165/313 (52%), Positives = 233/313 (74%), Gaps = 3/313 (0%)

Query: 30  IKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERF 89
           +++ G L CG++ GL GF+     G+W G DVD CRA+++A+FDDPSK++++PL+AK+RF
Sbjct: 44  VRENGALSCGVSQGLPGFSAPDDKGNWAGLDVDVCRAIAAAVFDDPSKVKFVPLSAKDRF 103

Query: 90  LALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASIC 149
            ALQS +ID+LSRNT WTL R+ SLG++F  ++Y+DGQGF+  K   ++S  +L+GASIC
Sbjct: 104 TALQSGEIDVLSRNTTWTLSRDTSLGVSFAGVSYYDGQGFMAKKSLKVNSALELNGASIC 163

Query: 150 VQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTND 209
           VQ GTT E  +ADYFK +NMKY  I F   +E   AY + RCD +T D+S LYA +L   
Sbjct: 164 VQTGTTNEQNVADYFKGNNMKYEVIAFANADEAVKAYESGRCDVFTSDVSQLYAQRLKLA 223

Query: 210 RPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTT 269
            P++H +LP++ISK PL P +  GD +W++IV WT +A+V AEELG+TQKN+++++K + 
Sbjct: 224 TPADHAVLPEVISKEPLGPLVRHGDDQWFDIVKWTLFALVNAEELGVTQKNVDEMAK-SD 282

Query: 270 NPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNAL 329
            P+++R  G D   N+GE LGLTKDW  RI++  GNYGE F+RN+G+ S+L+I RG N L
Sbjct: 283 KPELKRVFGTD--GNLGEQLGLTKDWVARIVKATGNYGESFERNVGSGSKLEIARGLNKL 340

Query: 330 WSKGGLMYAPPIR 342
           W+KGG+MYAPPIR
Sbjct: 341 WNKGGIMYAPPIR 353


>gi|148255314|ref|YP_001239899.1| putative amino-acid ABC transporter substrate-binding protein
           [Bradyrhizobium sp. BTAi1]
 gi|146407487|gb|ABQ35993.1| general L-amino acid-binding protein [Bradyrhizobium sp. BTAi1]
          Length = 338

 Score =  377 bits (968), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 172/327 (52%), Positives = 235/327 (71%), Gaps = 3/327 (0%)

Query: 16  FFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDP 75
              S    A  L  +K RG L CG++ GL GF+     G+W G DVD CRA+++AIF+DP
Sbjct: 15  ILASVGAQADTLKTVKDRGMLACGVSQGLPGFSSPDDKGNWTGIDVDVCRAVAAAIFNDP 74

Query: 76  SKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKK 135
           +KI+++PL+AK+RF ALQS +ID+LSRNT WTL R+ SLG  F  +TY+DGQGF++ K  
Sbjct: 75  TKIKFVPLSAKDRFTALQSGEIDVLSRNTTWTLSRDTSLGANFAGVTYYDGQGFMVKKAL 134

Query: 136 GISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYT 195
            ++S  +L+ AS+CVQ GTTTE  LADYFKA+ MKY  I F   +E   AY + RCD YT
Sbjct: 135 KVNSALELNSASVCVQTGTTTEQNLADYFKANKMKYEVIAFAGADETVKAYESGRCDVYT 194

Query: 196 GDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELG 255
            D+S LYA +L    P++HV+LP++ISK PL P +  GD +W++IV WT +A+VTAEELG
Sbjct: 195 TDVSGLYAERLKLANPADHVVLPEVISKEPLGPMVRHGDDQWFDIVKWTLFALVTAEELG 254

Query: 256 ITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLG 315
           +TQ N+++++K +  P+ +R  G D   N+GE LGLTKDW  RI++ +GNYGE+++RN+G
Sbjct: 255 VTQANVDEMAK-SDKPEFKRAFGTD--GNLGEQLGLTKDWFSRIVKAVGNYGEVYERNVG 311

Query: 316 NQSELKIPRGYNALWSKGGLMYAPPIR 342
             S+L+I RG N LW+KGGL YAPPIR
Sbjct: 312 AGSKLQIARGLNQLWNKGGLQYAPPIR 338


>gi|288958131|ref|YP_003448472.1| general L-amino acid transport system substrate-binding protein
           [Azospirillum sp. B510]
 gi|288910439|dbj|BAI71928.1| general L-amino acid transport system substrate-binding protein
           [Azospirillum sp. B510]
          Length = 339

 Score =  376 bits (966), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 169/317 (53%), Positives = 237/317 (74%), Gaps = 4/317 (1%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           L  +K+RGF++CG+N GL GF    + G+W G DVD+CRA++ AIF D +K+++ PL+A+
Sbjct: 26  LDTVKQRGFVQCGVNAGLPGFGNPDSAGNWTGLDVDYCRAVAVAIFGDANKVKFTPLSAQ 85

Query: 87  ERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGA 146
           +RF A+QS ++D+LSRNT  TL R+ S+GL F P+TY+DGQGF++ KK G+ S  +L+GA
Sbjct: 86  QRFPAIQSGEVDLLSRNTTVTLTRDTSVGLNFAPVTYYDGQGFMVPKKLGVKSAKELNGA 145

Query: 147 SICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKL 206
           ++CVQ+GTTTEL LADYF+A+NM Y+P+V E  +E++AAY A RCD  T D+S L   + 
Sbjct: 146 TVCVQSGTTTELNLADYFRANNMTYNPVVIESNDEVNAAYFAGRCDVLTTDVSGLAGTRA 205

Query: 207 -TNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVS 265
                P +HVILP++ISK PLAPA+  GD +W++IV WT YA + AEE GIT KNI++ +
Sbjct: 206 GVAPVPDDHVILPEVISKEPLAPAVRHGDDQWFDIVKWTVYATIQAEEFGITSKNIDEFA 265

Query: 266 KDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRG 325
            ++ NPD+QRFLG   S  +G+A+GL + W Y I++ +GNY E+FDRN+G  + LK+ RG
Sbjct: 266 -NSKNPDIQRFLGT--SPGMGKAMGLDEKWAYNIVKKVGNYAEIFDRNVGPATPLKLERG 322

Query: 326 YNALWSKGGLMYAPPIR 342
            NALW+KGGLMYA P R
Sbjct: 323 LNALWTKGGLMYAQPFR 339


>gi|118589034|ref|ZP_01546441.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Stappia aggregata IAM 12614]
 gi|118438363|gb|EAV44997.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Stappia aggregata IAM 12614]
          Length = 326

 Score =  376 bits (965), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 165/316 (52%), Positives = 230/316 (72%), Gaps = 3/316 (0%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           L D+K +GF++CG++ GL GF+   A G+W G DVD+CRA+++A+F D S ++Y PL+AK
Sbjct: 14  LEDVKAKGFIQCGVSQGLPGFSNPDAQGNWTGIDVDYCRAMAAAVFGDASAVKYTPLSAK 73

Query: 87  ERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGA 146
           ERF ALQS ++D+LSRNT WT+ R+  LGL F  + Y+DGQGF++ K  G++S  +LSGA
Sbjct: 74  ERFTALQSGEVDVLSRNTTWTMSRDTQLGLNFAGVNYYDGQGFMVRKDLGVTSALELSGA 133

Query: 147 SICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKL 206
           S+C   GTTTEL +ADYF+A+NM Y  + FE+ +E+ AAY A RCD YT D S LYA +L
Sbjct: 134 SVCTNTGTTTELNVADYFRANNMPYEIVAFEKADEVVAAYDAGRCDVYTTDASGLYAQRL 193

Query: 207 TNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSK 266
               P +H++LP+IISK PL P + QGD EW+NI  WT  AM+ AEELG+T +N++++ K
Sbjct: 194 KLTNPGDHMVLPEIISKEPLGPVVRQGDDEWFNIAKWTLNAMLNAEELGVTSENVDEM-K 252

Query: 267 DTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGY 326
            + NP ++R LG++ +   GEA+GL  DW Y II+++GNY E F+ N+G  + L I RG 
Sbjct: 253 SSDNPSIKRLLGVEGA--FGEAIGLPNDWAYAIIKNVGNYEESFNANVGPDTPLGISRGV 310

Query: 327 NALWSKGGLMYAPPIR 342
           NALW+ GG MYAPP+R
Sbjct: 311 NALWNDGGFMYAPPVR 326


>gi|299133835|ref|ZP_07027029.1| cationic amino acid ABC transporter, periplasmic binding protein
           [Afipia sp. 1NLS2]
 gi|298591671|gb|EFI51872.1| cationic amino acid ABC transporter, periplasmic binding protein
           [Afipia sp. 1NLS2]
          Length = 339

 Score =  374 bits (960), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 170/335 (50%), Positives = 238/335 (71%), Gaps = 5/335 (1%)

Query: 10  LCLIILFFTSFS-TNA-SILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRAL 67
           + +  +F  S S  NA + L  +++RG L CG++ GL GF+     G W G DVDFCRAL
Sbjct: 8   IVMTSVFLGSLSPVNAQATLKAVQERGVLSCGVSQGLPGFSAPDDTGKWSGLDVDFCRAL 67

Query: 68  SSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQ 127
           ++ + +DP K++++PL+AK+RF ALQS +ID+LSRNT W+L R+ SLGL F  + Y+DGQ
Sbjct: 68  AAVVLNDPLKVKFVPLSAKDRFTALQSGEIDVLSRNTTWSLSRDTSLGLNFTAVMYYDGQ 127

Query: 128 GFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYR 187
           GF++ K   ++S  +L+GAS+CVQ GTT E  LADYF+A+NMKY  + F   +E   AY 
Sbjct: 128 GFLVRKALKVNSALELNGASVCVQTGTTNEQNLADYFRANNMKYEVVAFSTADETIKAYE 187

Query: 188 AHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYA 247
           + RCD +T D+S LYA +L    P +HV+LP+IISK PL P +  GD +W++IV WT +A
Sbjct: 188 SGRCDVFTSDVSQLYAERLKLTVPDDHVVLPEIISKEPLGPVVRHGDDQWFDIVKWTLFA 247

Query: 248 MVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYG 307
           M+ AEEL +TQKN+ +++K +  P++ R LG D   N+GE LGLTKDW  RI++ +GNYG
Sbjct: 248 MINAEELNVTQKNVGEMTK-SNKPEIARLLGTD--GNLGEQLGLTKDWVVRIVKAVGNYG 304

Query: 308 EMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           E FDRN+G  S+L+I RG N LW++GG+ YAPPIR
Sbjct: 305 ESFDRNVGAGSKLRISRGLNKLWNQGGIQYAPPIR 339


>gi|327479738|gb|AEA83048.1| extracellular solute-binding protein [Pseudomonas stutzeri DSM
           4166]
          Length = 342

 Score =  374 bits (960), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 165/326 (50%), Positives = 236/326 (72%), Gaps = 2/326 (0%)

Query: 17  FTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPS 76
            +  +   + L  ++K+GF++CGI+ GL GF+   A G ++G DVD CRA+++A+F D +
Sbjct: 19  ISGLAQAGATLDAVQKKGFVQCGISDGLPGFSFADAKGQFQGIDVDVCRAVAAAVFGDAT 78

Query: 77  KIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKG 136
           K++Y PL AKERF ALQS ++D+LSRNT WT  R+ ++GL F  +TY+DGQGF+++K+ G
Sbjct: 79  KVKYSPLTAKERFTALQSGEVDVLSRNTTWTSSRDAAMGLNFTGVTYYDGQGFLVNKELG 138

Query: 137 ISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTG 196
           +SS  +L GA++C+QAGTTTEL L+DYF+A+  KY PI ++  +E   +  + RCD  T 
Sbjct: 139 VSSAKELDGATVCIQAGTTTELNLSDYFRANGHKYTPITYDTSDESAKSLESGRCDVLTS 198

Query: 197 DISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGI 256
           D S LYA ++   +P ++V+LP++ISK PL PA+ QGD EW++IV WT +AM+ AEELG+
Sbjct: 199 DQSQLYAQRIKLAKPDDYVVLPEVISKEPLGPAVRQGDEEWFDIVRWTLFAMLNAEELGV 258

Query: 257 TQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGN 316
           T  N+  ++K T NPDV R LG +     G+ L L KDW  +I++ +GNYGE+FDRN+G 
Sbjct: 259 TSANVEDMAKSTKNPDVARLLGAE--GEYGKDLRLPKDWAVQIVKQVGNYGEIFDRNVGA 316

Query: 317 QSELKIPRGYNALWSKGGLMYAPPIR 342
            SELKI RG NALW+KGGL YAPP+R
Sbjct: 317 GSELKIERGLNALWNKGGLQYAPPVR 342


>gi|92117599|ref|YP_577328.1| extracellular solute-binding protein [Nitrobacter hamburgensis X14]
 gi|91800493|gb|ABE62868.1| amino acid ABC transporter substrate-binding protein, PAAT family
           [Nitrobacter hamburgensis X14]
          Length = 344

 Score =  373 bits (958), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 165/318 (51%), Positives = 232/318 (72%), Gaps = 3/318 (0%)

Query: 25  SILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLN 84
           + L  +K RG L CG++ GL GF+     G+W G DVD CRA+++ +F+DP+K++++PL+
Sbjct: 30  TTLEAVKTRGMLSCGVSQGLPGFSAPDDKGNWTGLDVDVCRAIAAVVFNDPTKVKFVPLS 89

Query: 85  AKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLS 144
           AK+RF+ALQS +ID+LSRNT WTL R+ SLG  F  +TY+DGQGF++ K   ++S  +L+
Sbjct: 90  AKDRFIALQSGEIDVLSRNTTWTLSRDTSLGANFTGVTYYDGQGFLVRKSLKVNSALELN 149

Query: 145 GASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYAL 204
            AS+CVQ GTTTE  LADYFK++ MKY  I F   +E   AY + RCD +T DIS LYA 
Sbjct: 150 SASVCVQTGTTTEQNLADYFKSNKMKYEVIAFSTADETIKAYESGRCDVFTSDISQLYAE 209

Query: 205 KLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQV 264
           +L    P++H +LP++ISK PL P +  GD +W+++V WT +AM+ AEELGITQKN++++
Sbjct: 210 RLKLSNPADHAVLPEVISKEPLGPMVRHGDDQWFDLVKWTLFAMIDAEELGITQKNVDEM 269

Query: 265 SKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPR 324
           +K + NP+++R  G D   N GE LG+TKDW  RI++ +GNYGE FDRN+G  S+L I R
Sbjct: 270 AK-SNNPELKRVFGTD--GNFGEQLGVTKDWVSRIVKAVGNYGESFDRNVGAGSKLGIAR 326

Query: 325 GYNALWSKGGLMYAPPIR 342
           G N LW++GG+ YAPPIR
Sbjct: 327 GLNRLWNQGGIQYAPPIR 344


>gi|86750029|ref|YP_486525.1| extracellular solute-binding protein [Rhodopseudomonas palustris
           HaA2]
 gi|86573057|gb|ABD07614.1| extracellular solute-binding protein, family 3 [Rhodopseudomonas
           palustris HaA2]
          Length = 337

 Score =  373 bits (958), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 167/322 (51%), Positives = 231/322 (71%), Gaps = 3/322 (0%)

Query: 21  STNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQY 80
           S  A  L  +K RG L CG++ GL GF+     G+W G DVD CR +++AIFDDPSK+++
Sbjct: 19  SAGAQTLKTVKDRGILSCGVSQGLPGFSAPDDKGNWTGLDVDVCRGIAAAIFDDPSKVKF 78

Query: 81  LPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSV 140
           +PL+AK+RF ALQS +ID+LSRNT WTL R+ SLG+ F  ++Y+DGQGF++ K   ++S 
Sbjct: 79  VPLSAKDRFTALQSGEIDVLSRNTTWTLSRDTSLGVNFAGVSYYDGQGFLVKKALKVNSA 138

Query: 141 SQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISA 200
            +L+ AS+CVQ GTT E  +ADYFK +NMKY  I F   +E   AY + RCD +T D+S 
Sbjct: 139 LELNSASVCVQTGTTNEQNVADYFKGNNMKYEVIAFANADEAIKAYESGRCDVFTSDVSQ 198

Query: 201 LYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKN 260
           LYA +L    P++HV+LP++ISK PL P +  GD +W+++V WT +AM+ AEELG+TQ N
Sbjct: 199 LYAQRLKLATPADHVVLPEVISKEPLGPLVRHGDDQWFDVVKWTLFAMINAEELGVTQSN 258

Query: 261 INQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSEL 320
           + +++K +  P+++R  G D   N+GE LGLTKDW  RII+  GNYGE F+RN+G  S+L
Sbjct: 259 VAEMAK-SDKPELRRVFGTD--GNLGEQLGLTKDWVARIIKATGNYGESFERNVGAGSKL 315

Query: 321 KIPRGYNALWSKGGLMYAPPIR 342
           +I RG N  W+KGG+MYAPPIR
Sbjct: 316 EIARGLNKPWNKGGIMYAPPIR 337


>gi|209885181|ref|YP_002289038.1| general L-amino acid-binding periplasmic protein AapJ [Oligotropha
           carboxidovorans OM5]
 gi|209873377|gb|ACI93173.1| general L-amino acid-binding periplasmic protein AapJ [Oligotropha
           carboxidovorans OM5]
          Length = 338

 Score =  373 bits (957), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 169/320 (52%), Positives = 228/320 (71%), Gaps = 3/320 (0%)

Query: 23  NASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLP 82
           +A  L  IK RG L CG++ GL GF+     G W G DVDFCRALS+AIF+DP K++++P
Sbjct: 22  SAQTLKTIKDRGVLSCGVSQGLPGFSAPDDTGKWSGLDVDFCRALSAAIFNDPLKVKFVP 81

Query: 83  LNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQ 142
           L+AK+RF ALQS +ID+LSRNT W++ R+ SLGL F  + Y+DGQGF++ K   ++S  +
Sbjct: 82  LSAKDRFTALQSGEIDVLSRNTTWSMSRDTSLGLNFTAVMYYDGQGFLVRKSLKVNSALE 141

Query: 143 LSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALY 202
           L+GAS+CVQ GTT E  LADYF+A+ MKY  + F   +E   AY + RCDA+T D+S LY
Sbjct: 142 LNGASVCVQTGTTNEQNLADYFRANGMKYEVVAFATADETMKAYESGRCDAFTSDVSQLY 201

Query: 203 ALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNIN 262
           A +L    P +H +LPDIISK PL P +  GD +W++IV WT +A++ AEEL +TQKN+ 
Sbjct: 202 AERLKLTVPDDHAVLPDIISKEPLGPVVRHGDDQWFDIVKWTLFALLNAEELAVTQKNVG 261

Query: 263 QVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKI 322
            + K +  P++ R LG D   N GE LGLTKDW  RI++ +GNYGE FDRN+G  S+L+I
Sbjct: 262 DMVK-SNKPEIARLLGSD--GNFGEQLGLTKDWVVRIVKAVGNYGESFDRNVGAGSKLRI 318

Query: 323 PRGYNALWSKGGLMYAPPIR 342
            RG N LW++GG+ YAPP+R
Sbjct: 319 SRGLNKLWNQGGIQYAPPVR 338


>gi|89092424|ref|ZP_01165378.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Oceanospirillum sp. MED92]
 gi|89083512|gb|EAR62730.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Oceanospirillum sp. MED92]
          Length = 354

 Score =  373 bits (957), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 168/337 (49%), Positives = 230/337 (68%), Gaps = 3/337 (0%)

Query: 6   FVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCR 65
             S++   +    SF   A  L D++KRG + CG++TGL GF++   NG W G DVD CR
Sbjct: 21  LTSVIATGLALGLSFGAQAGTLEDVQKRGSVSCGVSTGLAGFSQKDENGTWSGLDVDVCR 80

Query: 66  ALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFD 125
           ++++A+  D SK+QY PL AKERF ALQS +IDILSRNT WT  R+ SLGL F  + Y+D
Sbjct: 81  SVAAAVLGDASKVQYKPLTAKERFTALQSGEIDILSRNTTWTHTRDTSLGLNFAGVNYYD 140

Query: 126 GQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAA 185
           GQGF++ K  G+SS   L GA++C+QAGTTTEL LADYF+A+ + Y+ I F+  ++  A 
Sbjct: 141 GQGFMVSKDLGVSSALDLDGAAVCIQAGTTTELNLADYFRANGITYNAITFDTSDQTRAG 200

Query: 186 YRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTH 245
           + + RCD  T D S LYAL++    PS  ++LP++ISK PL P + QGD +W+NIV W+ 
Sbjct: 201 FESGRCDVLTSDQSQLYALRIGLKDPSSAMVLPEVISKEPLGPVVRQGDDQWFNIVKWSV 260

Query: 246 YAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGN 305
           YAMV AE +GI   N +Q +K   NP  QR +G+D  S  GE +G++ DW Y I++ +GN
Sbjct: 261 YAMVEAEFMGINSANADQ-AKSQGNPGQQRLMGVDTDS--GEKMGISNDWAYNIVKQVGN 317

Query: 306 YGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           YGE F+RN+G  S LKI RG NA W+KGG+MY+ P+R
Sbjct: 318 YGESFERNVGQGSPLKISRGLNAQWNKGGIMYSSPVR 354


>gi|254504024|ref|ZP_05116175.1| lysine-arginine-ornithine-binding periplasmic protein [Labrenzia
           alexandrii DFL-11]
 gi|222440095|gb|EEE46774.1| lysine-arginine-ornithine-binding periplasmic protein [Labrenzia
           alexandrii DFL-11]
          Length = 325

 Score =  373 bits (957), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 163/316 (51%), Positives = 228/316 (72%), Gaps = 3/316 (0%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           L D+K +GF++CG++ GL GF+   A G+W G DVD CRA+++A+F D S +++ PL+AK
Sbjct: 13  LEDVKGKGFIQCGVSQGLPGFSNPDAQGNWTGLDVDLCRAMAAAVFGDASAVKFTPLSAK 72

Query: 87  ERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGA 146
           ERF ALQS ++D+LSRNT WT+ R+  LGL F  + Y+DGQGF++ K  G++S  ++SGA
Sbjct: 73  ERFTALQSGEVDVLSRNTTWTMSRDTQLGLNFAGVNYYDGQGFMVRKDLGVTSALEMSGA 132

Query: 147 SICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKL 206
           S+C   GTTTEL +ADYF+A+NM Y  + FE+ +E+ AAY A RCD YT D S LYA +L
Sbjct: 133 SVCTNTGTTTELNVADYFRANNMPYEIVAFEKADEVVAAYDAGRCDVYTTDASGLYAQRL 192

Query: 207 TNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSK 266
               P +H++LP+IISK PL P + QGD EW+NI  WT  AM+ AEELG+T  N++++ K
Sbjct: 193 KLTNPGDHMVLPEIISKEPLGPVVRQGDDEWFNIAKWTLNAMINAEELGVTSANVDEM-K 251

Query: 267 DTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGY 326
            + NP V+R LG + +   GEA+GL+ DW Y I++++GNY E F+ N+G  + L I RG 
Sbjct: 252 ASDNPSVKRLLGAEGA--FGEAIGLSNDWAYNIVKNVGNYEESFNANVGPDTPLGISRGV 309

Query: 327 NALWSKGGLMYAPPIR 342
           NALWS GG +YAPP+R
Sbjct: 310 NALWSNGGFLYAPPVR 325


>gi|89093226|ref|ZP_01166176.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Oceanospirillum sp. MED92]
 gi|89082522|gb|EAR61744.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Oceanospirillum sp. MED92]
          Length = 337

 Score =  372 bits (956), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 168/337 (49%), Positives = 230/337 (68%), Gaps = 3/337 (0%)

Query: 6   FVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCR 65
             S++   +    SF   A  L D++KRG + CG++TGL GF++   NG W G DVD CR
Sbjct: 4   LTSVIATGLALGLSFGAQAGTLEDVQKRGSVSCGVSTGLAGFSQKDENGTWSGLDVDVCR 63

Query: 66  ALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFD 125
           ++++A+  D SK+QY PL AKERF ALQS +IDILSRNT WT  R+ SLGL F  + Y+D
Sbjct: 64  SVAAAVLGDASKVQYKPLTAKERFTALQSGEIDILSRNTTWTHTRDTSLGLNFAGVNYYD 123

Query: 126 GQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAA 185
           GQGF++ K  G+SS   L GA++C+QAGTTTEL LADYF+A+ + Y+ I F+  ++  A 
Sbjct: 124 GQGFMVSKDLGVSSALDLDGAAVCIQAGTTTELNLADYFRANGITYNAITFDTSDQTRAG 183

Query: 186 YRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTH 245
           + + RCD  T D S LYAL++    PS  ++LP++ISK PL P + QGD +W+NIV W+ 
Sbjct: 184 FESGRCDVLTSDQSQLYALRIGLKDPSSAMVLPEVISKEPLGPVVRQGDDQWFNIVKWSV 243

Query: 246 YAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGN 305
           YAMV AE +GI   N +Q +K   NP  QR +G+D  S  GE +G++ DW Y I++ +GN
Sbjct: 244 YAMVEAEFMGINSANADQ-AKSQGNPGQQRLMGVDTDS--GEKMGISNDWAYNIVKQVGN 300

Query: 306 YGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           YGE F+RN+G  S LKI RG NA W+KGG+MY+ P+R
Sbjct: 301 YGESFERNVGQGSPLKISRGLNAQWNKGGIMYSSPVR 337


>gi|75677073|ref|YP_319494.1| extracellular solute-binding protein [Nitrobacter winogradskyi
           Nb-255]
 gi|74421943|gb|ABA06142.1| amino acid ABC transporter substrate-binding protein, PAAT family
           [Nitrobacter winogradskyi Nb-255]
          Length = 345

 Score =  372 bits (956), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 167/311 (53%), Positives = 225/311 (72%), Gaps = 3/311 (0%)

Query: 32  KRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERFLA 91
           +R  + CG+NTGL GF+     G+W GFDVDFCRA+++AIFDDPSK++++PL A ERF  
Sbjct: 38  RRDAVLCGVNTGLPGFSSSDEKGNWSGFDVDFCRAVAAAIFDDPSKVKFVPLAADERFKE 97

Query: 92  LQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASICVQ 151
           LQS+++DIL+RN+ W++ RE +  L F  + Y+DG+GF++   +   S   L    ICVQ
Sbjct: 98  LQSRKVDILARNSTWSMSRETNFNLYFPAVAYYDGEGFMVRTSRKADSALDLGDTKICVQ 157

Query: 152 AGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTNDRP 211
           + TTT+L LADYF+A+N+KY  I FE++E++  AY   RCD  T D+S LYAL+L   +P
Sbjct: 158 SATTTQLNLADYFRANNLKYEEIRFEKLEDVLRAYDEARCDVVTADVSQLYALRLRLTKP 217

Query: 212 SEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTTNP 271
           +E  ILPD+ISK PLAP + Q D +W  I+ WT YAM+ AEELG+T KNI++  K +T P
Sbjct: 218 NESFILPDVISKEPLAPVVRQRDDDWMMIIKWTLYAMINAEELGVTSKNIDEAMK-STKP 276

Query: 272 DVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNALWS 331
           DV R +G +     GEALGLTKDW  RIIRH+GNYGE++DRN+G +S LKIPRG N  W+
Sbjct: 277 DVMRLVGTE--GQYGEALGLTKDWAARIIRHVGNYGEVYDRNIGTESRLKIPRGLNQPWN 334

Query: 332 KGGLMYAPPIR 342
            GG+MYAPP+R
Sbjct: 335 AGGIMYAPPLR 345


>gi|126668363|ref|ZP_01739321.1| Lysine-arginine-ornithine-binding periplasmic protein [Marinobacter
           sp. ELB17]
 gi|126627179|gb|EAZ97818.1| Lysine-arginine-ornithine-binding periplasmic protein [Marinobacter
           sp. ELB17]
          Length = 340

 Score =  372 bits (956), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 170/338 (50%), Positives = 236/338 (69%), Gaps = 3/338 (0%)

Query: 5   FFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFC 64
             V+I   +     + S  A+ L D+K RG ++CG+ +GL GF++   NG+W G DVD C
Sbjct: 6   LLVAIATTLGGTLMAGSVQAATLDDVKSRGHVQCGVTSGLPGFSQPDENGNWTGIDVDTC 65

Query: 65  RALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYF 124
           RA+++A+F    K+Q+ PL AKERF ALQS +IDILSRNT WTL R+ SLGL F    Y+
Sbjct: 66  RAVAAAVFGSADKVQFTPLTAKERFTALQSGEIDILSRNTTWTLTRDASLGLNFAGTNYY 125

Query: 125 DGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDA 184
           DGQGF++ K  G+ +  QL GA+IC+QAGTTTEL LADYF+   MK++P+VF+  E+  +
Sbjct: 126 DGQGFLVSKSLGVDNAEQLDGATICIQAGTTTELNLADYFRTKGMKFNPLVFDTSEQTVS 185

Query: 185 AYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWT 244
            + A RCD  T D S L AL+   + PS  VILP+IISK PL P + QGD +W+NIV WT
Sbjct: 186 GFAAGRCDVLTSDRSQLAALRSKLEDPSSAVILPNIISKEPLGPVVRQGDDQWFNIVKWT 245

Query: 245 HYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMG 304
            +  + AEELG+TQ N++ + K +TNP++QR LG   + ++GE LG+  D+ +RII+ +G
Sbjct: 246 LFVQINAEELGVTQANVSDM-KSSTNPEIQRLLGT--TGDMGEKLGVPADFGFRIIQTVG 302

Query: 305 NYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           NYGEM++RN+G  + L + RG NALW+ GG+MYAPP+R
Sbjct: 303 NYGEMYERNVGPDTPLGLDRGLNALWNNGGIMYAPPVR 340


>gi|92119138|ref|YP_578867.1| extracellular solute-binding protein [Nitrobacter hamburgensis X14]
 gi|91802032|gb|ABE64407.1| amino acid ABC transporter substrate-binding protein, PAAT family
           [Nitrobacter hamburgensis X14]
          Length = 345

 Score =  372 bits (955), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 168/311 (54%), Positives = 227/311 (72%), Gaps = 3/311 (0%)

Query: 32  KRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERFLA 91
           +R  + CG+NTGL GF+ V   G+W GFDVDFCRA+++AIFDDP+K++++PL A ERF  
Sbjct: 38  RRDAVLCGVNTGLPGFSNVDEKGNWSGFDVDFCRAVAAAIFDDPAKVKFVPLAADERFKE 97

Query: 92  LQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASICVQ 151
           LQS+++DIL+RN+ W++ RE +  L F  + Y+DG+GF++   +  +S   L G  ICVQ
Sbjct: 98  LQSRKVDILARNSTWSMSRETNFDLYFPAVAYYDGEGFMVRTSRKAASALDLGGTKICVQ 157

Query: 152 AGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTNDRP 211
            GTTT+L LADYFKA+N+ Y  I F ++E++  AY   +CD  T D++ LYA++L   +P
Sbjct: 158 DGTTTKLNLADYFKANNLTYEEIKFGKLEDMLKAYDEAKCDVVTSDVAQLYAMRLRLTKP 217

Query: 212 SEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTTNP 271
           SE  ILPD+ISK PLAP + Q D +W  IV WT YAMV AEELG+T KNI++  K +  P
Sbjct: 218 SESFILPDVISKEPLAPVVRQRDDDWMMIVKWTLYAMVNAEELGVTSKNIDEAMK-SKKP 276

Query: 272 DVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNALWS 331
           DV R +G + +   GEALGLTKDW  RIIRH+GNYGE++DRN+G  S+LKIPRG N LW+
Sbjct: 277 DVMRLVGTEGA--YGEALGLTKDWAARIIRHVGNYGEVYDRNVGADSKLKIPRGLNQLWN 334

Query: 332 KGGLMYAPPIR 342
            GG+MYAPP+R
Sbjct: 335 AGGIMYAPPLR 345


>gi|262404012|ref|ZP_06080567.1| amino acid ABC transporter amino acid-binding protein [Vibrio sp.
           RC586]
 gi|262349044|gb|EEY98182.1| amino acid ABC transporter amino acid-binding protein [Vibrio sp.
           RC586]
          Length = 342

 Score =  371 bits (953), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 169/328 (51%), Positives = 231/328 (70%), Gaps = 3/328 (0%)

Query: 15  LFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDD 74
           L   S S   S L  +  +GF+ CG++TGL GF+   A GDW+G DV++C+AL++A+  D
Sbjct: 18  LMTYSASAAESTLDKVLSQGFITCGVSTGLPGFSNPNAKGDWEGIDVEYCQALAAAVLGD 77

Query: 75  PSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKK 134
            +K++++PL AKERF ALQS +ID+LSRNT WTL R+ +LGL F  + Y+DGQGF++ K 
Sbjct: 78  KTKVKFVPLTAKERFTALQSGEIDVLSRNTTWTLQRDSALGLNFVGVNYYDGQGFMVKKD 137

Query: 135 KGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAY 194
            GI S  +L GAS+CVQ+GTTTEL LADYF+ + MKY P+VF+   +    + A RCD  
Sbjct: 138 LGIKSAKELDGASVCVQSGTTTELNLADYFRNNGMKYKPVVFDTSAQTSKGFDAGRCDVL 197

Query: 195 TGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEEL 254
           T D S LYAL+L  ++P   V+LP+IISK PL P + Q D +W+N+  W  YAMV AEE 
Sbjct: 198 TTDQSGLYALRLNLEKPDAAVVLPEIISKEPLGPVVRQDDDKWFNVAKWVLYAMVNAEEY 257

Query: 255 GITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNL 314
           GIT KN++++ K + NP+V+R LG+D     G  LG+  DW+Y+I++ +GNYGE F+R +
Sbjct: 258 GITSKNVDEMMK-SENPEVKRILGLDGPKGTG--LGIRDDWSYQIVKQVGNYGESFERTV 314

Query: 315 GNQSELKIPRGYNALWSKGGLMYAPPIR 342
           G+ S LKI RG NALW+ GG MYAPPIR
Sbjct: 315 GSGSPLKIDRGVNALWNAGGFMYAPPIR 342


>gi|330446205|ref|ZP_08309857.1| putative amino acid ABC transporter, periplasmic amino acid-binding
           protein [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
 gi|328490396|dbj|GAA04354.1| putative amino acid ABC transporter, periplasmic amino acid-binding
           protein [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
          Length = 342

 Score =  370 bits (950), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 163/337 (48%), Positives = 237/337 (70%), Gaps = 3/337 (0%)

Query: 6   FVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCR 65
           F ++     LF  + +  A+ L  + K+G+++CG++ GL GF+   A G W+G DV+FC+
Sbjct: 9   FAALASSTALFAANVNAEAT-LDKVMKQGYVQCGVSAGLPGFSNPNAKGQWEGLDVEFCQ 67

Query: 66  ALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFD 125
           A+++A   D SK++Y+PL AKERF ALQS +ID+LSRNT WTL R+ +LGL F  + Y+D
Sbjct: 68  AIAAATIGDKSKVKYIPLTAKERFTALQSGEIDVLSRNTTWTLHRDTALGLNFTGVNYYD 127

Query: 126 GQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAA 185
           GQGF++ K  GI S  +L GA++CVQ+GTTTEL LADYF+ + M+Y P+VF+   +    
Sbjct: 128 GQGFMVKKDMGIKSAKELDGAAVCVQSGTTTELNLADYFRVNGMEYKPVVFDTAPQTSKG 187

Query: 186 YRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTH 245
           + + RCD  T D S LYAL+L    P+  V+LP+IISK PL P + QGD +W+NIV WT 
Sbjct: 188 FDSGRCDVLTTDQSGLYALRLNLKDPNSAVVLPEIISKEPLGPVVRQGDDQWFNIVRWTL 247

Query: 246 YAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGN 305
           + M+ AEE G+T  N+++++K++ +P+++R +G+D     G+ LGL  DW Y+II+ +GN
Sbjct: 248 FTMINAEEFGVTAANVDKLAKESKDPNIRRLIGLDGPK--GKGLGLKDDWGYQIIKQVGN 305

Query: 306 YGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           YGE F+R +G  S LKI RG NALW++GG+ YAPPIR
Sbjct: 306 YGESFERTVGEGSPLKIKRGLNALWTQGGIQYAPPIR 342


>gi|312115908|ref|YP_004013504.1| extracellular solute-binding protein family 3 [Rhodomicrobium
           vannielii ATCC 17100]
 gi|311221037|gb|ADP72405.1| extracellular solute-binding protein family 3 [Rhodomicrobium
           vannielii ATCC 17100]
          Length = 338

 Score =  370 bits (949), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 164/337 (48%), Positives = 234/337 (69%), Gaps = 2/337 (0%)

Query: 6   FVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCR 65
           + ++ C + L        A  L D+K RG L CG+  GL GF+   A+G+W G DVDFCR
Sbjct: 4   YGTLYCALALMLFCAGARAGTLDDVKARGKLNCGVTQGLAGFSSADASGNWAGLDVDFCR 63

Query: 66  ALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFD 125
           A+++AIFDDPSK+ ++PL++K+RF ALQS +ID+LSR + WT+  + +LG++F  + Y D
Sbjct: 64  AVAAAIFDDPSKVNFVPLSSKQRFTALQSGEIDVLSRVSTWTMQNDTALGISFVGVIYHD 123

Query: 126 GQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAA 185
           GQG ++ KK  + S  +LSGA +C   GTTTEL +AD+F++ +M Y  + FE+ +E   A
Sbjct: 124 GQGLMVRKKLEVQSALELSGAEVCTNTGTTTELNIADFFRSRSMPYRIVAFEKSDEALKA 183

Query: 186 YRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTH 245
           Y A RCD Y+ D S+L A ++   +P EHVILPD+ISK PLAPA+ Q D +W ++V WT 
Sbjct: 184 YEAERCDVYSTDASSLSAQRVKLAQPDEHVILPDLISKEPLAPAVRQNDPQWESLVRWTL 243

Query: 246 YAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGN 305
           +A++ AEEL +T+ N +++S+    P V+R LG +  S+ G ALGL KDW  + IR +GN
Sbjct: 244 FALINAEELAVTKANADKLSRTDAAPGVRRLLGAE--SDYGRALGLDKDWALKAIRAVGN 301

Query: 306 YGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           YGE+FDRNLG QS LKI RG N LW+ GG+++APP+R
Sbjct: 302 YGEIFDRNLGQQSPLKIERGLNKLWNNGGILFAPPVR 338


>gi|260768536|ref|ZP_05877470.1| amino acid ABC transporter amino acid-binding protein [Vibrio
           furnissii CIP 102972]
 gi|260616566|gb|EEX41751.1| amino acid ABC transporter amino acid-binding protein [Vibrio
           furnissii CIP 102972]
 gi|315180248|gb|ADT87162.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Vibrio furnissii NCTC 11218]
          Length = 342

 Score =  369 bits (948), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 169/328 (51%), Positives = 230/328 (70%), Gaps = 3/328 (0%)

Query: 15  LFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDD 74
           L   S S   S L  +  +GFL CG++TGL GF+   A G+W+G DV++C+AL++A+  D
Sbjct: 18  LMANSASAADSTLDKVLSQGFLTCGVSTGLPGFSNPNAKGEWEGIDVEYCQALAAAVLGD 77

Query: 75  PSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKK 134
            +K++Y+PL AKERF ALQS +ID+LSRNT WTL R+ +LGL F  + Y+DGQGF++ K 
Sbjct: 78  KTKVKYVPLTAKERFTALQSGEIDVLSRNTTWTLHRDSALGLNFVGVNYYDGQGFMVKKD 137

Query: 135 KGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAY 194
            GISS  +L GAS+CVQ+GTTTEL LADYF+ + M Y P+VF+   +    + A RCD  
Sbjct: 138 LGISSAKELDGASVCVQSGTTTELNLADYFRNNGMSYKPVVFDTAAQTSKGFDAGRCDVL 197

Query: 195 TGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEEL 254
           T D S LYAL+L  ++P   V+LP+IISK PL P + Q D +W+N+  WT +AMV AEE 
Sbjct: 198 TTDQSGLYALRLNLEKPDSAVVLPEIISKEPLGPVVRQDDDKWFNVAKWTLFAMVNAEEY 257

Query: 255 GITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNL 314
           GIT KN +++ K + NP+V+R LG+D     G+ LG+  DW Y+I++ +GNYGE F+R +
Sbjct: 258 GITSKNADEMLK-SDNPEVKRILGVDGPK--GKGLGIRDDWGYQIVKQVGNYGESFERTV 314

Query: 315 GNQSELKIPRGYNALWSKGGLMYAPPIR 342
           G  S L+I RG NALW+ GG MYAPPIR
Sbjct: 315 GKGSPLQISRGVNALWNAGGFMYAPPIR 342


>gi|115524735|ref|YP_781646.1| cationic amino acid ABC transporter, periplasmic binding protein
           [Rhodopseudomonas palustris BisA53]
 gi|115518682|gb|ABJ06666.1| cationic amino acid ABC transporter, periplasmic binding protein
           [Rhodopseudomonas palustris BisA53]
          Length = 337

 Score =  369 bits (948), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 166/316 (52%), Positives = 228/316 (72%), Gaps = 3/316 (0%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           L  I+ RG L CG++ GL GF+     G+W G DVD CRA+++A+F+DP+K++++PL+AK
Sbjct: 25  LKTIQDRGVLSCGVSQGLPGFSTPDDKGNWTGLDVDICRAIAAAVFNDPTKVKFVPLSAK 84

Query: 87  ERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGA 146
           +RF ALQS +ID+LSRNT WT+ R+ SLG+ F  +TY+DGQGF++ K   ++S  +L+GA
Sbjct: 85  DRFTALQSGEIDVLSRNTTWTISRDTSLGVNFTGVTYYDGQGFLVKKALKVNSALELNGA 144

Query: 147 SICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKL 206
           SICVQ GTT E  +ADYFK +NMKY  I F   +E   AY A RCD +T D+S LYAL+L
Sbjct: 145 SICVQTGTTNEQNVADYFKGNNMKYEVIAFSTADEALKAYEAGRCDVFTSDVSQLYALRL 204

Query: 207 TNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSK 266
                ++H +LP++ISK PL P +  GD +W++IV WT +AM+ AEE G+TQKN+   +K
Sbjct: 205 KLAAVADHAVLPEVISKEPLGPLVRHGDDQWFDIVKWTLFAMINAEEFGVTQKNVEDQAK 264

Query: 267 DTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGY 326
               PD++R  G D   N+GE LGLTKDW  RI++  GNYGE+F+RN+G+ S+L I RG 
Sbjct: 265 -LDKPDLKRMFGTD--GNLGEQLGLTKDWVIRIVKATGNYGEVFERNVGSGSKLGIARGL 321

Query: 327 NALWSKGGLMYAPPIR 342
           N LW+KGG+ YAPPIR
Sbjct: 322 NQLWNKGGIQYAPPIR 337


>gi|27379557|ref|NP_771086.1| ABC transporter amino acid-binding protein [Bradyrhizobium
           japonicum USDA 110]
 gi|27352709|dbj|BAC49711.1| ABC transporter amino acid-binding protein [Bradyrhizobium
           japonicum USDA 110]
          Length = 338

 Score =  369 bits (947), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 171/320 (53%), Positives = 231/320 (72%), Gaps = 3/320 (0%)

Query: 23  NASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLP 82
           +A  L  +K RG L CG++ GL GF+     G+W G DVD CRA+++AIF+DP+K++++P
Sbjct: 22  DAQTLKTVKDRGTLSCGVSQGLPGFSAPDDKGNWTGLDVDVCRAIAAAIFNDPTKVKFVP 81

Query: 83  LNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQ 142
            +AK+RF ALQS +ID+LSRNT WT+ R+ SLG  F  +TY+DGQGF++ K   ++S  +
Sbjct: 82  TSAKDRFTALQSGEIDVLSRNTTWTISRDTSLGANFTGVTYYDGQGFMVKKSLKVNSALE 141

Query: 143 LSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALY 202
           L+ AS+CVQ GTTTE  LADYFKA+NMKY  I F   +E   AY A RCD +T D S LY
Sbjct: 142 LNSASVCVQTGTTTEQNLADYFKANNMKYEVIAFGTNDETVKAYEAGRCDVFTTDQSGLY 201

Query: 203 ALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNIN 262
           A +L    P++H++LP+IISK PL P +  GD +W++IV WT +A+VT EELG+T KN++
Sbjct: 202 ANRLKLANPNDHMVLPEIISKEPLGPMVRHGDDQWFDIVKWTLFALVTTEELGVTSKNVD 261

Query: 263 QVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKI 322
           + +K   +P+++R LG D   N GE LGLTKDW  RI++ +GNYGE+FDRN+G  S L I
Sbjct: 262 EKAK-LESPELKRVLGSD--GNFGEQLGLTKDWVVRIVKAVGNYGEVFDRNVGAGSPLAI 318

Query: 323 PRGYNALWSKGGLMYAPPIR 342
            RG N LW+KGGL YAPPIR
Sbjct: 319 NRGLNNLWNKGGLQYAPPIR 338


>gi|90424048|ref|YP_532418.1| lysine-arginine-ornithine-binding periplasmic protein
           [Rhodopseudomonas palustris BisB18]
 gi|90106062|gb|ABD88099.1| Lysine-arginine-ornithine-binding periplasmic protein
           [Rhodopseudomonas palustris BisB18]
          Length = 350

 Score =  369 bits (947), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 165/326 (50%), Positives = 232/326 (71%), Gaps = 3/326 (0%)

Query: 17  FTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPS 76
           F + +  A  L  ++ RG L CG++ GL GF+     G+W G DVD CRA+++A+F+DP+
Sbjct: 28  FLTQAAGAQTLKTVQDRGVLSCGVSQGLPGFSAPDDKGNWTGIDVDVCRAIAAAVFNDPT 87

Query: 77  KIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKG 136
           K++++PL+AK+RF ALQS +ID+LSRNT WT+ R+ SLG+ F  +TY+DGQGF++ K   
Sbjct: 88  KVKFVPLSAKDRFTALQSGEIDVLSRNTTWTVSRDTSLGVNFTGVTYYDGQGFLVRKALK 147

Query: 137 ISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTG 196
           ++S  +L+ ASICVQ GTT E  +ADYFK +NMKY  I F   +E   AY + RCD +T 
Sbjct: 148 VNSALELNSASICVQTGTTNEQNVADYFKGNNMKYEVIAFGTADEAVKAYESGRCDVFTS 207

Query: 197 DISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGI 256
           D+S LYAL+L    P++H +LP++ISK PL P +  GD +W++IV WT +A++ AEELG+
Sbjct: 208 DVSQLYALRLKLATPADHAVLPEVISKEPLGPLVRHGDDQWFDIVKWTLFALLNAEELGV 267

Query: 257 TQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGN 316
            QKN++  +K    P+++R  G D   N+GE LGLTKDW  RI++  GNYGE+FDRN+G 
Sbjct: 268 NQKNVDDQAK-LDKPELKRVFGTD--GNLGEQLGLTKDWVIRIVKATGNYGEIFDRNVGA 324

Query: 317 QSELKIPRGYNALWSKGGLMYAPPIR 342
            S+L I RG N LW+KGG+ YAPPIR
Sbjct: 325 GSKLGIARGLNQLWNKGGIQYAPPIR 350


>gi|261210913|ref|ZP_05925203.1| amino acid ABC transporter amino acid-binding protein [Vibrio sp.
           RC341]
 gi|260839888|gb|EEX66488.1| amino acid ABC transporter amino acid-binding protein [Vibrio sp.
           RC341]
          Length = 342

 Score =  369 bits (947), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 165/318 (51%), Positives = 227/318 (71%), Gaps = 3/318 (0%)

Query: 25  SILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLN 84
           S L  +  +GF+ CG++TGL GF+   A GDW+G DV++C+AL++A+  D +K++++PL 
Sbjct: 28  STLDKVLSQGFITCGVSTGLPGFSNPNAKGDWEGIDVEYCQALAAAVLGDKTKVKFVPLT 87

Query: 85  AKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLS 144
           AKERF ALQS +ID+LSRNT WTL R+ +LGL F  + Y+DGQGF++ K  G+ S  +L 
Sbjct: 88  AKERFTALQSGEIDVLSRNTTWTLQRDSALGLNFVGVNYYDGQGFMVKKDLGVKSAKELD 147

Query: 145 GASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYAL 204
           GAS+CVQ+GTTTEL LADYF+   MKY P+VF+   +    + A RCD  T D S LYAL
Sbjct: 148 GASVCVQSGTTTELNLADYFRNSGMKYKPVVFDTAAQTSKGFDAGRCDVLTTDQSGLYAL 207

Query: 205 KLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQV 264
           +L  ++P   V+LP+IISK PL P + Q D +W+N+  WT YAMV AEE GIT KN++++
Sbjct: 208 RLNLEKPDSAVVLPEIISKEPLGPVVRQDDDKWFNVAKWTLYAMVNAEEYGITSKNVDEM 267

Query: 265 SKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPR 324
            K + NP+V+R LG+D     G  LG+  DW+Y+I++ +GNYGE F+R +G  S L+I R
Sbjct: 268 MK-SENPEVKRILGLDGPK--GTGLGIRDDWSYQIVKQVGNYGESFERTVGKGSPLQIDR 324

Query: 325 GYNALWSKGGLMYAPPIR 342
           G NALW+ GG MYAPPIR
Sbjct: 325 GVNALWNAGGFMYAPPIR 342


>gi|85716216|ref|ZP_01047190.1| extracellular solute-binding protein, family 3 [Nitrobacter sp.
           Nb-311A]
 gi|85696888|gb|EAQ34772.1| extracellular solute-binding protein, family 3 [Nitrobacter sp.
           Nb-311A]
          Length = 344

 Score =  369 bits (947), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 166/313 (53%), Positives = 229/313 (73%), Gaps = 3/313 (0%)

Query: 30  IKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERF 89
           +K+RG L CG+  GL GF+     G+W G DVD CRA+++ +F+DPSK++++PL+AK+RF
Sbjct: 35  VKERGVLSCGVTQGLPGFSTPDDKGNWTGLDVDICRAIAAVVFNDPSKVKFVPLSAKDRF 94

Query: 90  LALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASIC 149
           +ALQ  +ID+LSR+T WTL R+ SLG  F  +TY+DGQGF++ K   ++S  +L+ AS+C
Sbjct: 95  IALQWGEIDVLSRDTSWTLSRDTSLGGNFTGVTYYDGQGFLVRKSLKVNSALELNSASVC 154

Query: 150 VQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTND 209
           VQ GTT+E  LADYFK++ MKY  I F   +E   AY + RCD +T DIS LYA +L   
Sbjct: 155 VQTGTTSEQNLADYFKSNKMKYEVIAFGTADETLKAYESGRCDVFTSDISQLYAQRLKLL 214

Query: 210 RPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTT 269
            P++H +LP++ISK PL P + QGD +W++IV WT +AM+ AEELGITQKN+++ +K + 
Sbjct: 215 NPADHAVLPEVISKEPLGPMVRQGDDQWFDIVKWTLFAMINAEELGITQKNVDEKAK-SE 273

Query: 270 NPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNAL 329
           NP+++R LG D   N GE LG+TKDW  RII+ +GNYGE FDRN+G  S L I RG N L
Sbjct: 274 NPEIKRVLGTD--GNFGEQLGVTKDWVSRIIKAVGNYGEAFDRNVGAGSPLGITRGLNRL 331

Query: 330 WSKGGLMYAPPIR 342
           W++GG+ YAPPIR
Sbjct: 332 WNQGGIQYAPPIR 344


>gi|260778552|ref|ZP_05887444.1| amino acid ABC transporter amino acid-binding protein [Vibrio
           coralliilyticus ATCC BAA-450]
 gi|260604716|gb|EEX31011.1| amino acid ABC transporter amino acid-binding protein [Vibrio
           coralliilyticus ATCC BAA-450]
          Length = 342

 Score =  369 bits (947), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 170/328 (51%), Positives = 229/328 (69%), Gaps = 3/328 (0%)

Query: 15  LFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDD 74
           L  TS S   S L  + K+GFL CG++TGL GF+   + G+W+G DV++C+AL+SA+  D
Sbjct: 18  LMSTSASAADSTLDKVTKQGFLTCGVSTGLPGFSNPNSKGEWEGIDVEYCQALASAVLGD 77

Query: 75  PSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKK 134
            SK++Y+PL AKERF ALQS +ID+LSRNT WTL R+ +LGL F  + Y+DGQGF++ K 
Sbjct: 78  KSKVKYVPLTAKERFTALQSGEIDVLSRNTTWTLHRDTALGLNFVGVNYYDGQGFMVKKD 137

Query: 135 KGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAY 194
            G+ S  +L GAS+CVQ+GTTTEL LADYF+ + M Y P+VF+   +    + A RCD  
Sbjct: 138 LGLKSAKELDGASVCVQSGTTTELNLADYFRNNGMSYKPVVFDTAAQTSKGFDAGRCDVL 197

Query: 195 TGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEEL 254
           T D S LYAL+L    PS   +LP+IISK PL P + QGD +W+NI  WT  AMV AEE 
Sbjct: 198 TTDQSGLYALRLNLQDPSSAEVLPEIISKEPLGPVVRQGDDQWFNIAKWTLSAMVNAEEY 257

Query: 255 GITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNL 314
           GI+ KN +++ K + +P+V+R LG+D     G+ LG+  DW Y++I+ +GNYGE F+R +
Sbjct: 258 GISSKNADEMLK-SKDPNVKRILGVDGPK--GKGLGIRDDWGYQVIKQVGNYGESFERTV 314

Query: 315 GNQSELKIPRGYNALWSKGGLMYAPPIR 342
           G  S L+I RG NALW+ GG MYAPPIR
Sbjct: 315 GKGSPLQISRGVNALWNAGGFMYAPPIR 342


>gi|271498820|ref|YP_003331845.1| family 3 extracellular solute-binding protein [Dickeya dadantii
           Ech586]
 gi|270342375|gb|ACZ75140.1| extracellular solute-binding protein family 3 [Dickeya dadantii
           Ech586]
          Length = 343

 Score =  369 bits (947), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 167/343 (48%), Positives = 237/343 (69%), Gaps = 3/343 (0%)

Query: 1   MYKDFFVSILCLIILF-FTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGF 59
           M K    +++    LF F + +   + L  I+K+GF++CGI+ GL GF+   ANG + G 
Sbjct: 3   MKKVIMSTLVASASLFAFINQAHAGATLDAIQKKGFVQCGISDGLPGFSYADANGKYSGI 62

Query: 60  DVDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFR 119
           DVD CR +++AIF D +K++Y PL AKERF ALQS ++D+LSRNT WT  R+ S+GL F 
Sbjct: 63  DVDVCRGVAAAIFGDANKVKYTPLTAKERFTALQSGEVDVLSRNTTWTSSRDGSMGLLFT 122

Query: 120 PITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERV 179
            +TY+DG GF+ H K G+ S  +L GA++C+QAGT TEL +ADYFK HNMKY P+ F+R 
Sbjct: 123 GVTYYDGIGFLAHNKAGLKSAKELDGATVCIQAGTDTELNVADYFKTHNMKYTPVTFDRS 182

Query: 180 EEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYN 239
           +E   A  + RCD    D S LYAL++   +P++ V+LP++ISK PL P + +GD +W+ 
Sbjct: 183 DESAKALDSGRCDTLASDQSQLYALRIKLGKPADFVVLPEVISKEPLGPVVRRGDEDWFA 242

Query: 240 IVSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRI 299
           IV WT +AM+ AEE+G+T +N++Q++   T PD+   LG  K  N G+ L L  DW Y+I
Sbjct: 243 IVRWTLFAMLDAEEMGVTSQNVDQMAAKPTTPDMAHLLG--KEGNFGKDLKLPNDWAYKI 300

Query: 300 IRHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           ++ +GNYGE+F+RN+G  SELKI RG N LW+KGG+ YAP +R
Sbjct: 301 VKQVGNYGEVFERNVGQGSELKIKRGLNELWNKGGIQYAPAVR 343


>gi|296272121|ref|YP_003654752.1| cationic amino acid ABC transporter periplasmic binding protein
           [Arcobacter nitrofigilis DSM 7299]
 gi|296096296|gb|ADG92246.1| cationic amino acid ABC transporter, periplasmic binding protein
           [Arcobacter nitrofigilis DSM 7299]
          Length = 338

 Score =  369 bits (947), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 172/333 (51%), Positives = 227/333 (68%), Gaps = 3/333 (0%)

Query: 10  LCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSS 69
           L +  L   S  ++A  L    K G L CG+NTGL GFA   ++G WKG DVD CRA+++
Sbjct: 9   LSIAALAIASTVSSADTLDTTIKNGKLSCGLNTGLPGFAAPDSDGVWKGIDVDVCRAVAA 68

Query: 70  AIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGF 129
           A+  D +K++Y  LNAKERF ALQS +ID+L+RNT WT  R+ SLGL F  + Y+DGQGF
Sbjct: 69  AVLGDATKVKYAHLNAKERFTALQSGEIDVLARNTTWTATRDTSLGLNFTGVNYYDGQGF 128

Query: 130 IMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAH 189
           ++ KK G+ S  +L GA+ C+QAGTTTEL L DYFK+HNMKY PI ++   +    +   
Sbjct: 129 LVSKKLGVKSAKELDGATFCIQAGTTTELNLTDYFKSHNMKYTPITYDTSAQTIQGFEEG 188

Query: 190 RCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMV 249
           RCDA T D S LYAL+     PS  ++LP+IISK PL P + QGD +W+NIV WT  AM+
Sbjct: 189 RCDALTSDSSQLYALRTQLKNPSSAIVLPEIISKEPLGPVVRQGDDKWFNIVKWTEIAML 248

Query: 250 TAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEM 309
            AE+LG+  KN++++ K +TNP++QR LG+  + +IG+ LGL   W Y II+ +GNYGE 
Sbjct: 249 NAEDLGVNSKNVDEMLK-STNPNIQRLLGV--TGDIGKNLGLDPKWAYNIIKQVGNYGES 305

Query: 310 FDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           F+RN+G  S LKI RG NALW  GGL Y  PIR
Sbjct: 306 FERNVGQGSPLKIERGLNALWKNGGLQYGAPIR 338


>gi|298291387|ref|YP_003693326.1| cationic amino acid ABC transporter periplasmic protein [Starkeya
           novella DSM 506]
 gi|296927898|gb|ADH88707.1| cationic amino acid ABC transporter, periplasmic binding protein
           [Starkeya novella DSM 506]
          Length = 339

 Score =  369 bits (946), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 167/326 (51%), Positives = 231/326 (70%), Gaps = 6/326 (1%)

Query: 19  SFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKI 78
           + S  A+ L  +K +GF++CG++ GL GF+     G+W G DVDFCRA+++A+F+DP+K+
Sbjct: 18  AVSAQAAKLDQVKSKGFIQCGVSQGLPGFSTPDDKGNWTGLDVDFCRAVAAAVFNDPTKV 77

Query: 79  QYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGIS 138
           ++ PL+AK+RF ALQS  IDILSRNT WT+ R+ SLGL F  +TY+DGQGF++ K K ++
Sbjct: 78  KFTPLSAKDRFTALQSGDIDILSRNTTWTITRDTSLGLNFTGVTYYDGQGFMIRKDKKVN 137

Query: 139 SVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDI 198
           S  +LSGAS+C Q GTTTE  LADYF+A+NM Y  I F   +E+  AY A RCD  T D 
Sbjct: 138 SALELSGASVCTQTGTTTEQNLADYFRANNMTYEVIAFATNDEVVKAYDAGRCDVLTTDR 197

Query: 199 SALYA--LKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGI 256
           S L    LKLTN  P +HV+LP+IISK PL P +  GD +W++IV W  +A + AEELG+
Sbjct: 198 SGLAGERLKLTN--PDDHVVLPEIISKEPLGPVVAHGDDQWFDIVKWVLFAQINAEELGV 255

Query: 257 TQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGN 316
           T KN+++  K  TNP+++R +G +     GE +G+  DW Y++I+ +GNYGEM+DRN+G 
Sbjct: 256 TSKNVDEQLKSATNPEIKRLVGTE--GKFGEGMGIGNDWAYQVIKGVGNYGEMYDRNVGP 313

Query: 317 QSELKIPRGYNALWSKGGLMYAPPIR 342
            + LK+ RG NALW+KGG  Y  PIR
Sbjct: 314 ATPLKLERGANALWTKGGQQYGMPIR 339


>gi|89073072|ref|ZP_01159619.1| putative amino acid ABC transporter, periplasmic amino acid-binding
           protein [Photobacterium sp. SKA34]
 gi|89051290|gb|EAR56746.1| putative amino acid ABC transporter, periplasmic amino acid-binding
           protein [Photobacterium sp. SKA34]
          Length = 342

 Score =  369 bits (946), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 163/337 (48%), Positives = 235/337 (69%), Gaps = 3/337 (0%)

Query: 6   FVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCR 65
           F ++     LF  + +  A+ L  + K+G+++CG++ GL GF+   A G W+G DV+FC+
Sbjct: 9   FAALASSTALFAANANAEAT-LDKVMKQGYVQCGVSAGLPGFSNPNAKGQWEGLDVEFCQ 67

Query: 66  ALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFD 125
           A+++A   D SK++Y+PL AKERF ALQS +ID+LSRNT WTL R+ SLGL F  + Y+D
Sbjct: 68  AIAAATIGDKSKVKYIPLTAKERFTALQSGEIDVLSRNTTWTLHRDTSLGLNFTGVNYYD 127

Query: 126 GQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAA 185
           GQGF++ K  GI+S  +L GA++CVQ+GTTTEL LADYF+ + M Y P+VF+   +    
Sbjct: 128 GQGFMVKKDMGITSAKELDGAAVCVQSGTTTELNLADYFRVNGMTYKPVVFDTAPQTSKG 187

Query: 186 YRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTH 245
           + + RCD  T D S LYAL+L    PS  V+LP+IISK PL P + QGD +W+N+V WT 
Sbjct: 188 FDSGRCDVLTTDQSGLYALRLNLKDPSSAVVLPEIISKEPLGPVVRQGDDQWFNVVRWTL 247

Query: 246 YAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGN 305
           + M+ AEE  +T  N+++++K++ +P+++R +G+D     G+ LGL  DW Y+II+ +GN
Sbjct: 248 FTMINAEEFNVTSANVDKLAKESKDPNIRRLIGLDGPK--GKGLGLKDDWGYQIIKQVGN 305

Query: 306 YGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           YGE F+R +G  S LKI RG NALW+ GG+ YAPPIR
Sbjct: 306 YGESFERTVGEGSPLKIKRGLNALWTNGGIQYAPPIR 342


>gi|114706424|ref|ZP_01439326.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Fulvimarina pelagi HTCC2506]
 gi|114538285|gb|EAU41407.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Fulvimarina pelagi HTCC2506]
          Length = 339

 Score =  369 bits (946), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 168/342 (49%), Positives = 238/342 (69%), Gaps = 3/342 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           M   F  + L L +    +    A   G +K+RG L+CG+NTGL GFA     G+W+G D
Sbjct: 1   MTIKFLTAALGLSVAALATAGAQAQTAGTVKERGSLRCGVNTGLPGFASQNDQGEWQGLD 60

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
           VD+CRA+++A+  DP  + + PL+A +RF ALQ+ +ID+L+RNT WT+ R+ +LGL F  
Sbjct: 61  VDYCRAVATAVLGDPQAVTFSPLSAVQRFPALQNNEIDLLARNTTWTMDRDTALGLDFAG 120

Query: 121 ITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVE 180
           + Y+DGQGF++    G++S  +LSGA++CVQ+GTTTEL LADYF+A++M Y+P+V E   
Sbjct: 121 VNYYDGQGFMVKNDLGVNSALELSGATVCVQSGTTTELNLADYFEANDMDYNPVVIESQS 180

Query: 181 EIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNI 240
           ++++AY + RCD  T D S L A +L    P  H ILP+IISK PL PA+ QGD +W +I
Sbjct: 181 DVNSAYDSGRCDVLTTDASGLAASRLEMSNPDNHTILPEIISKEPLGPAVRQGDDQWADI 240

Query: 241 VSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRII 300
           V WTHYA++ AEELG+ Q N+ ++ K++ NPD++R LG D  SN GE LGL +DW  ++I
Sbjct: 241 VRWTHYALLNAEELGVNQGNVEEM-KNSDNPDIRRLLGQD--SNFGEPLGLPQDWAAQVI 297

Query: 301 RHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
             +GNYGE+F+RN+G  + LKI RG NALW+ GGL Y  P+R
Sbjct: 298 SAVGNYGEIFERNIGVNTPLKIQRGQNALWTDGGLQYGMPVR 339


>gi|91227965|ref|ZP_01262075.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Vibrio alginolyticus 12G01]
 gi|91188286|gb|EAS74584.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Vibrio alginolyticus 12G01]
          Length = 342

 Score =  369 bits (946), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 166/328 (50%), Positives = 230/328 (70%), Gaps = 3/328 (0%)

Query: 15  LFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDD 74
           +  TS     + L  + K+GFL CG++TGL GF+   + G+W+G DV++C+AL++A+  D
Sbjct: 18  MMATSAQAADTTLDKVTKQGFLTCGVSTGLPGFSNPNSKGEWEGIDVEYCQALAAAVLGD 77

Query: 75  PSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKK 134
            +K++Y+PL AKERF ALQS +ID+LSRNT WTL R+ +LGL F  + Y+DGQGF++ K+
Sbjct: 78  KTKVKYVPLTAKERFTALQSGEIDVLSRNTTWTLHRDTALGLNFVGVNYYDGQGFMVKKE 137

Query: 135 KGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAY 194
            GISS  +L GAS+CVQ+GTTTEL LADYF+   M Y P+VF+   +    + A RCD  
Sbjct: 138 LGISSAKELDGASVCVQSGTTTELNLADYFRNQGMAYKPVVFDTAAQTSKGFDAGRCDVL 197

Query: 195 TGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEEL 254
           T D S LYAL+L    PS   +LP+IISK PL P + QGD +W+NI  WT  AM+ AEE 
Sbjct: 198 TTDQSGLYALRLNLKDPSSAAVLPEIISKEPLGPVVRQGDDQWFNIAKWTLSAMINAEEY 257

Query: 255 GITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNL 314
           GI+ KN +++ K +T+P+++R LG+D     G+ LG+  DW Y++I+ +GNYGE F+R +
Sbjct: 258 GISSKNADEMLK-STDPNIKRILGVDGPK--GKGLGIRDDWGYQVIKQVGNYGESFERTV 314

Query: 315 GNQSELKIPRGYNALWSKGGLMYAPPIR 342
           G  S L+I RG NALW+ GG MYAPPIR
Sbjct: 315 GTGSPLEISRGVNALWNAGGFMYAPPIR 342


>gi|269968795|ref|ZP_06182784.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Vibrio alginolyticus 40B]
 gi|269826607|gb|EEZ80952.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Vibrio alginolyticus 40B]
          Length = 350

 Score =  368 bits (945), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 166/328 (50%), Positives = 230/328 (70%), Gaps = 3/328 (0%)

Query: 15  LFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDD 74
           +  TS     + L  + K+GFL CG++TGL GF+   + G+W+G DV++C+AL++A+  D
Sbjct: 26  MMATSAQAADTTLDKVTKQGFLTCGVSTGLPGFSNPNSKGEWEGIDVEYCQALAAAVLGD 85

Query: 75  PSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKK 134
            +K++Y+PL AKERF ALQS +ID+LSRNT WTL R+ +LGL F  + Y+DGQGF++ K+
Sbjct: 86  KTKVKYVPLTAKERFTALQSGEIDVLSRNTTWTLHRDTALGLNFVGVNYYDGQGFMVKKE 145

Query: 135 KGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAY 194
            GISS  +L GAS+CVQ+GTTTEL LADYF+   M Y P+VF+   +    + A RCD  
Sbjct: 146 LGISSAKELDGASVCVQSGTTTELNLADYFRNQGMAYKPVVFDTAAQTSKGFDAGRCDVL 205

Query: 195 TGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEEL 254
           T D S LYAL+L    PS   +LP+IISK PL P + QGD +W+NI  WT  AM+ AEE 
Sbjct: 206 TTDQSGLYALRLNLKDPSSAAVLPEIISKEPLGPVVRQGDDQWFNIAKWTLSAMINAEEY 265

Query: 255 GITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNL 314
           GI+ KN +++ K +T+P+++R LG+D     G+ LG+  DW Y++I+ +GNYGE F+R +
Sbjct: 266 GISSKNADEMLK-STDPNIKRILGVDGPK--GKGLGIRDDWGYQVIKQVGNYGESFERTV 322

Query: 315 GNQSELKIPRGYNALWSKGGLMYAPPIR 342
           G  S L+I RG NALW+ GG MYAPPIR
Sbjct: 323 GTGSPLEISRGVNALWNAGGFMYAPPIR 350


>gi|153835228|ref|ZP_01987895.1| general L-amino acid-binding periplasmic protein AapJ [Vibrio
           harveyi HY01]
 gi|148868294|gb|EDL67426.1| general L-amino acid-binding periplasmic protein AapJ [Vibrio
           harveyi HY01]
          Length = 342

 Score =  368 bits (945), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 165/328 (50%), Positives = 229/328 (69%), Gaps = 3/328 (0%)

Query: 15  LFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDD 74
           +  TS     + L  + K+GF+ CG++TGL GF+   + G+W+G DV++C+AL++A+  D
Sbjct: 18  MMATSAQAADTTLDKVTKQGFITCGVSTGLPGFSNPNSKGEWEGIDVEYCQALAAAVLGD 77

Query: 75  PSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKK 134
            +K++Y+PL AKERF ALQS +ID+LSRNT WTL R+ +LGL F  + Y+DGQGF++ K 
Sbjct: 78  KTKVKYVPLTAKERFTALQSGEIDVLSRNTTWTLHRDTALGLNFVGVNYYDGQGFMVKKD 137

Query: 135 KGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAY 194
            G+SS  +L GAS+CVQ+GTTTEL LADYF+   M Y P+VF+   +    + A RCD  
Sbjct: 138 LGVSSAKELDGASVCVQSGTTTELNLADYFRNQGMAYKPVVFDTAAQTSKGFDAGRCDVL 197

Query: 195 TGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEEL 254
           T D S LYAL+L    PS   +LP+IISK PL P + QGD +W+NI  WT +AMV AEE 
Sbjct: 198 TTDQSGLYALRLNLKDPSSATVLPEIISKEPLGPVVRQGDDQWFNIAKWTLFAMVNAEEY 257

Query: 255 GITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNL 314
           GI+ KN +++ K + +P+++R LG+D     G+ LG+  DW Y++I+ +GNYGE F+R +
Sbjct: 258 GISSKNADEMLK-SKDPNIKRILGVDGPK--GKGLGIRDDWGYQVIKQVGNYGESFERTV 314

Query: 315 GNQSELKIPRGYNALWSKGGLMYAPPIR 342
           G  S LKI RG NALW+ GG MYAPPIR
Sbjct: 315 GTGSPLKISRGVNALWNAGGFMYAPPIR 342


>gi|323492614|ref|ZP_08097758.1| amino acid ABC transporter periplasmic amino acid-binding protein
           [Vibrio brasiliensis LMG 20546]
 gi|323312989|gb|EGA66109.1| amino acid ABC transporter periplasmic amino acid-binding protein
           [Vibrio brasiliensis LMG 20546]
          Length = 342

 Score =  367 bits (943), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 168/328 (51%), Positives = 229/328 (69%), Gaps = 3/328 (0%)

Query: 15  LFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDD 74
           L  TS +   S L  + K+GFL CG++TGL GF+   + G+W+G DV++C+AL+SA+  D
Sbjct: 18  LMSTSAAAADSTLDKVTKQGFLTCGVSTGLPGFSNPNSKGEWEGIDVEYCQALASAVLGD 77

Query: 75  PSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKK 134
            +K++Y+PL AKERF ALQS +ID+LSRNT WTL R+ +LGL F  + Y+DGQGF++ K 
Sbjct: 78  KTKVKYVPLTAKERFTALQSGEIDVLSRNTTWTLHRDTALGLNFVGVNYYDGQGFMVKKD 137

Query: 135 KGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAY 194
            G++S  +L GAS+CVQ+GTTTEL LADYF+   M Y P+VF+   +    + A RCD  
Sbjct: 138 LGLTSAKELDGASVCVQSGTTTELNLADYFRNSGMSYKPVVFDTAAQTSKGFDAGRCDVL 197

Query: 195 TGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEEL 254
           T D S LYAL+L    PS   +LP+IISK PL P + QGD +W+NI  WT  AMV AEE 
Sbjct: 198 TTDQSGLYALRLNLQDPSSAQVLPEIISKEPLGPVVRQGDDQWFNIAKWTLAAMVNAEEY 257

Query: 255 GITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNL 314
           GIT KN +++ K + +P+++R LG+D     G+ LG+  DW Y++I+ +GNYGE F+R +
Sbjct: 258 GITSKNADEMLK-SKDPNIKRILGVDGPK--GKGLGIRDDWGYQVIKQVGNYGESFERTV 314

Query: 315 GNQSELKIPRGYNALWSKGGLMYAPPIR 342
           G  S L+I RG NALW+ GG MYAPPIR
Sbjct: 315 GEGSPLQISRGVNALWNAGGFMYAPPIR 342


>gi|307129011|ref|YP_003881027.1| amino acid ABC transporter periplasmic amino acid-binding protein
           [Dickeya dadantii 3937]
 gi|306526540|gb|ADM96470.1| Amino acid ABC transporter, periplasmic amino acid-binding protein
           [Dickeya dadantii 3937]
          Length = 341

 Score =  367 bits (943), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 168/343 (48%), Positives = 236/343 (68%), Gaps = 3/343 (0%)

Query: 1   MYKDFFVSILCLIILF-FTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGF 59
           M K    +++    LF F + +   + L  I+K+GF++CGI+ GL GF+   ANG + G 
Sbjct: 1   MKKVIMSTLVASASLFAFINQAHAGATLDAIQKKGFVQCGISDGLPGFSYADANGKYSGI 60

Query: 60  DVDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFR 119
           DVD CR +++AIF D +K+++ PL AKERF ALQS ++D+LSRNT WT  R+  +GL F 
Sbjct: 61  DVDVCRGVAAAIFGDANKVKFTPLTAKERFTALQSGEVDLLSRNTTWTSSRDGGMGLLFT 120

Query: 120 PITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERV 179
            +TY+DG GF+ H K G+ S  +L GA++C+QAGT TEL +ADYFK HNMKY P+ F+R 
Sbjct: 121 GVTYYDGIGFLTHNKAGLKSAKELDGATVCIQAGTDTELNVADYFKTHNMKYTPVTFDRS 180

Query: 180 EEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYN 239
           +E   A  + RCD    D S LYAL++   +P++ V+LP++ISK PL P + +GD +WY 
Sbjct: 181 DESAKALDSGRCDTLASDQSQLYALRIKLGKPADFVVLPEVISKEPLGPVVRRGDEDWYA 240

Query: 240 IVSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRI 299
           IV WT +AM+ AEE+GIT +N++Q++   T PD+   LG  K  N G+ L L  DW Y+I
Sbjct: 241 IVRWTLFAMLNAEEMGITSQNVDQMAAKPTTPDMSHLLG--KEGNYGKDLKLPADWAYKI 298

Query: 300 IRHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           ++ +GNYGE+F+RN+G  SELKI RG N LW+KGG+ YAP IR
Sbjct: 299 VKQVGNYGEVFERNVGQGSELKIKRGLNELWNKGGIQYAPAIR 341


>gi|119946447|ref|YP_944127.1| ABC amino acid transporter extracellular solute-binding protein,
           family 3 [Psychromonas ingrahamii 37]
 gi|119865051|gb|ABM04528.1| ABC amino acid transporter extracellular solute-binding protein,
           family 3 [Psychromonas ingrahamii 37]
          Length = 337

 Score =  367 bits (943), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 164/320 (51%), Positives = 229/320 (71%), Gaps = 3/320 (0%)

Query: 23  NASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLP 82
           +AS L ++ K+G + CGI+TG+ GF+   + G W+G DVDFC+++++A+F D SK++Y+P
Sbjct: 21  SASTLEEVVKKGDINCGISTGIAGFSSTDSKGVWEGLDVDFCKSVAAAVFGDASKVKYIP 80

Query: 83  LNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQ 142
           L AKERF ALQS +ID+LSR T WT  R+ SLGL F  + Y+DGQGF+++KK GISS  +
Sbjct: 81  LTAKERFTALQSGEIDVLSRATTWTATRDTSLGLNFAGVNYYDGQGFLVNKKLGISSAKE 140

Query: 143 LSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALY 202
           LSGA+ C+QAGTT+EL L DYF+++NM+Y  + ++   +    +++ RCD  T D S LY
Sbjct: 141 LSGATFCIQAGTTSELNLTDYFQSNNMEYRAVTYDTSGQTVNGFKSGRCDVITSDASQLY 200

Query: 203 ALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNIN 262
            LKL  D P   ++LP+IISK PL P + QGD EW+NIV WT +A + AEELG++  N++
Sbjct: 201 GLKLKLDDPDSAIVLPEIISKEPLGPVVRQGDDEWFNIVRWTMFATLEAEELGVSSANVD 260

Query: 263 QVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKI 322
            + K + NP + R LG  KS   GE LGL  DW Y+I++ +GNYGEMFD+N+G  S L I
Sbjct: 261 AMLK-SENPSIMRLLG--KSGTAGENLGLKGDWVYQIVKQVGNYGEMFDKNVGKDSPLNI 317

Query: 323 PRGYNALWSKGGLMYAPPIR 342
            RG N LW++GGLMY+ PIR
Sbjct: 318 DRGLNKLWNQGGLMYSMPIR 337


>gi|156974643|ref|YP_001445550.1| hypothetical protein VIBHAR_02361 [Vibrio harveyi ATCC BAA-1116]
 gi|156526237|gb|ABU71323.1| hypothetical protein VIBHAR_02361 [Vibrio harveyi ATCC BAA-1116]
          Length = 350

 Score =  367 bits (943), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 165/328 (50%), Positives = 229/328 (69%), Gaps = 3/328 (0%)

Query: 15  LFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDD 74
           +  TS     + L  + K+GF+ CG++TGL GF+   + G+W+G DV++C+AL++A+  D
Sbjct: 26  MMATSAQAADTTLDKVTKQGFITCGVSTGLPGFSNPNSKGEWEGIDVEYCQALAAAVLGD 85

Query: 75  PSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKK 134
            +K++Y+PL AKERF ALQS +ID+LSRNT WTL R+ +LGL F  + Y+DGQGF++ K 
Sbjct: 86  KTKVKYVPLTAKERFTALQSGEIDVLSRNTTWTLHRDTALGLNFVGVNYYDGQGFMVKKD 145

Query: 135 KGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAY 194
            G+SS  +L GAS+CVQ+GTTTEL LADYF+   M Y P+VF+   +    + A RCD  
Sbjct: 146 LGVSSAKELDGASVCVQSGTTTELNLADYFRNQGMAYKPVVFDTAAQTSKGFDAGRCDIL 205

Query: 195 TGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEEL 254
           T D S LYAL+L    PS   +LP+IISK PL P + QGD +W+NI  WT +AMV AEE 
Sbjct: 206 TTDQSGLYALRLNLKDPSSATVLPEIISKEPLGPVVRQGDDQWFNIAKWTLFAMVNAEEY 265

Query: 255 GITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNL 314
           GI+ KN +++ K + +P+++R LG+D     G+ LG+  DW Y++I+ +GNYGE F+R +
Sbjct: 266 GISSKNADEMLK-SKDPNIKRILGVDGPK--GKGLGIRDDWGYQVIKQVGNYGESFERTV 322

Query: 315 GNQSELKIPRGYNALWSKGGLMYAPPIR 342
           G  S LKI RG NALW+ GG MYAPPIR
Sbjct: 323 GTGSPLKISRGVNALWNAGGFMYAPPIR 350


>gi|28898394|ref|NP_797999.1| amino acid ABC transporter periplasmic amino acid-binding protein
           [Vibrio parahaemolyticus RIMD 2210633]
 gi|153839329|ref|ZP_01991996.1| general L-amino acid-binding periplasmic protein AapJ [Vibrio
           parahaemolyticus AQ3810]
 gi|260366020|ref|ZP_05778498.1| general L-amino acid-binding periplasmic protein AapJ [Vibrio
           parahaemolyticus K5030]
 gi|260876625|ref|ZP_05888980.1| general L-amino acid-binding periplasmic protein AapJ [Vibrio
           parahaemolyticus AN-5034]
 gi|260898001|ref|ZP_05906497.1| general L-amino acid-binding periplasmic protein AapJ [Vibrio
           parahaemolyticus Peru-466]
 gi|260901584|ref|ZP_05909979.1| general L-amino acid-binding periplasmic protein AapJ [Vibrio
           parahaemolyticus AQ4037]
 gi|28806611|dbj|BAC59883.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Vibrio parahaemolyticus RIMD 2210633]
 gi|149747161|gb|EDM58149.1| general L-amino acid-binding periplasmic protein AapJ [Vibrio
           parahaemolyticus AQ3810]
 gi|308088041|gb|EFO37736.1| general L-amino acid-binding periplasmic protein AapJ [Vibrio
           parahaemolyticus Peru-466]
 gi|308094322|gb|EFO44017.1| general L-amino acid-binding periplasmic protein AapJ [Vibrio
           parahaemolyticus AN-5034]
 gi|308108540|gb|EFO46080.1| general L-amino acid-binding periplasmic protein AapJ [Vibrio
           parahaemolyticus AQ4037]
 gi|308114193|gb|EFO51733.1| general L-amino acid-binding periplasmic protein AapJ [Vibrio
           parahaemolyticus K5030]
 gi|328473628|gb|EGF44463.1| amino acid ABC transporter periplasmic amino acid-binding protein
           [Vibrio parahaemolyticus 10329]
          Length = 342

 Score =  367 bits (941), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 166/328 (50%), Positives = 228/328 (69%), Gaps = 3/328 (0%)

Query: 15  LFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDD 74
           +  TS     + L  + K+GFL CG++TGL GF+   + G+W+G DV++C+AL++A+  D
Sbjct: 18  MMATSAQAADTTLDKVTKQGFLTCGVSTGLPGFSNPNSKGEWEGIDVEYCQALAAAVLGD 77

Query: 75  PSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKK 134
            +K++Y+PL AKERF ALQS +ID+LSRNT WTL R+ +LGL F  + Y+DGQGF++ K 
Sbjct: 78  KTKVKYVPLTAKERFTALQSGEIDVLSRNTTWTLHRDTALGLNFVGVNYYDGQGFMVKKD 137

Query: 135 KGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAY 194
            GISS  +L GAS+CVQ+GTTTEL LADYF+   M Y P+VF+   +    + A RCD  
Sbjct: 138 LGISSAKELDGASVCVQSGTTTELNLADYFRNSGMSYKPVVFDTAAQTSKGFDAGRCDVL 197

Query: 195 TGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEEL 254
           T D S LYAL+L    PS   +LP+IISK PL P + QGD +W+NI  WT  AMV AEE 
Sbjct: 198 TTDQSGLYALRLNLKDPSSAAVLPEIISKEPLGPVVRQGDDQWFNIAKWTLAAMVNAEEY 257

Query: 255 GITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNL 314
           GIT KN +++ K + +P+++R LG+D     G+ LG+  DW Y++++ +GNYGE F+R +
Sbjct: 258 GITSKNADEMLK-SQDPNIKRILGVDGPK--GKGLGIRDDWGYQVVKQVGNYGESFERTV 314

Query: 315 GNQSELKIPRGYNALWSKGGLMYAPPIR 342
           G  S L+I RG NALW+ GG MYAPPIR
Sbjct: 315 GKGSPLEIARGVNALWNAGGFMYAPPIR 342


>gi|90578887|ref|ZP_01234697.1| putative amino acid ABC transporter, periplasmic amino acid-binding
           protein [Vibrio angustum S14]
 gi|90439720|gb|EAS64901.1| putative amino acid ABC transporter, periplasmic amino acid-binding
           protein [Vibrio angustum S14]
          Length = 342

 Score =  367 bits (941), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 162/337 (48%), Positives = 234/337 (69%), Gaps = 3/337 (0%)

Query: 6   FVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCR 65
           F ++     LF  + +  A+ L  + K+G+++CG++ GL GF+   A G W+G DV+FC+
Sbjct: 9   FAALASSTALFAANANAEAT-LDKVMKQGYVQCGVSAGLPGFSNPNAKGQWEGLDVEFCQ 67

Query: 66  ALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFD 125
           A+++A   D SK++Y+PL AKERF ALQS +ID+LSRNT WTL R+ SLGL F  + Y+D
Sbjct: 68  AIAAATIGDKSKVKYIPLTAKERFTALQSGEIDVLSRNTTWTLHRDTSLGLNFTGVNYYD 127

Query: 126 GQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAA 185
           GQGF++ K  GI S  +L GA++CVQ+GTTTEL LADYF+ + M Y P+VF+   +    
Sbjct: 128 GQGFMVKKDMGIKSAKELDGAAVCVQSGTTTELNLADYFRVNGMTYKPVVFDTAPQTSKG 187

Query: 186 YRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTH 245
           + + RCD  T D S LYAL+L    P+  V+LP+IISK PL P + QGD +W+N+V WT 
Sbjct: 188 FDSGRCDVLTTDQSGLYALRLNLKDPNSAVVLPEIISKEPLGPVVRQGDDQWFNVVRWTL 247

Query: 246 YAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGN 305
           + M+ AEE  +T  N+++++K++ +P+++R +G+D     G+ LGL  DW Y+II+ +GN
Sbjct: 248 FTMINAEEFNVTSANVDKLAKESKDPNIRRLIGLDGPK--GKGLGLKDDWGYQIIKQVGN 305

Query: 306 YGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           YGE F+R +G  S LKI RG NALW+ GG+ YAPPIR
Sbjct: 306 YGESFERTVGEGSPLKIKRGLNALWTNGGIQYAPPIR 342


>gi|119946443|ref|YP_944123.1| ABC amino acid transporter extracellular solute-binding protein,
           family 3 [Psychromonas ingrahamii 37]
 gi|119865047|gb|ABM04524.1| ABC amino acid transporter extracellular solute-binding protein,
           family 3 [Psychromonas ingrahamii 37]
          Length = 337

 Score =  366 bits (940), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 163/320 (50%), Positives = 229/320 (71%), Gaps = 3/320 (0%)

Query: 23  NASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLP 82
           +AS L ++ K+G + CGI+TG+ GF+   + G W+G DVDFC+++++A+F D SK++Y+P
Sbjct: 21  SASTLEEVVKKGDISCGISTGIAGFSSTDSKGVWEGLDVDFCKSVAAAVFGDASKVKYIP 80

Query: 83  LNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQ 142
           L AKERF ALQS +ID+LSR T WT  R+ SLGL F  + Y+DGQGF+++KK G++S  +
Sbjct: 81  LTAKERFTALQSGEIDVLSRATTWTATRDTSLGLNFAGVNYYDGQGFLVNKKIGVTSAKE 140

Query: 143 LSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALY 202
           LSGA+ C+QAGTT+EL L DYF+A+NM+Y  + ++   +    +++ RCD  T D S LY
Sbjct: 141 LSGATFCIQAGTTSELNLTDYFQANNMEYRAVTYDTSGQTINGFKSGRCDVITSDASQLY 200

Query: 203 ALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNIN 262
            LKL  D P   ++LP+IISK PL P + QGD EW+NIV WT +A + AEELG++  N++
Sbjct: 201 GLKLKLDDPDSAIVLPEIISKEPLGPVVRQGDDEWFNIVRWTMFATLEAEELGVSSANVD 260

Query: 263 QVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKI 322
            + K + NP + R LG  KS   GE LGL  DW Y+I++ +GNYGEMFD+N+G  S L I
Sbjct: 261 AMLK-SENPSIMRLLG--KSGTAGENLGLKGDWVYQIVKQVGNYGEMFDKNVGKDSPLNI 317

Query: 323 PRGYNALWSKGGLMYAPPIR 342
            RG N LW++GGLMY+ PIR
Sbjct: 318 DRGLNKLWNQGGLMYSMPIR 337


>gi|15641374|ref|NP_231006.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Vibrio cholerae O1 biovar El Tor str. N16961]
 gi|121587999|ref|ZP_01677751.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Vibrio cholerae 2740-80]
 gi|121728530|ref|ZP_01681553.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Vibrio cholerae V52]
 gi|153212726|ref|ZP_01948383.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Vibrio cholerae 1587]
 gi|153819348|ref|ZP_01972015.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Vibrio cholerae NCTC 8457]
 gi|153821335|ref|ZP_01974002.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Vibrio cholerae B33]
 gi|153825294|ref|ZP_01977961.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Vibrio cholerae MZO-2]
 gi|153828770|ref|ZP_01981437.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Vibrio cholerae 623-39]
 gi|183179360|ref|ZP_02957571.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Vibrio cholerae MZO-3]
 gi|227081533|ref|YP_002810084.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Vibrio cholerae M66-2]
 gi|229505057|ref|ZP_04394567.1| amino acid ABC transporter amino acid-binding protein [Vibrio
           cholerae BX 330286]
 gi|229511273|ref|ZP_04400752.1| amino acid ABC transporter amino acid-binding protein [Vibrio
           cholerae B33]
 gi|229515734|ref|ZP_04405193.1| amino acid ABC transporter amino acid-binding protein [Vibrio
           cholerae TMA 21]
 gi|229518391|ref|ZP_04407835.1| amino acid ABC transporter amino acid-binding protein [Vibrio
           cholerae RC9]
 gi|229521468|ref|ZP_04410887.1| amino acid ABC transporter amino acid-binding protein [Vibrio
           cholerae TM 11079-80]
 gi|229529562|ref|ZP_04418952.1| amino acid ABC transporter amino acid-binding protein [Vibrio
           cholerae 12129(1)]
 gi|229608061|ref|YP_002878709.1| amino acid ABC transporter amino acid-binding protein [Vibrio
           cholerae MJ-1236]
 gi|254225346|ref|ZP_04918958.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Vibrio cholerae V51]
 gi|254286186|ref|ZP_04961146.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Vibrio cholerae AM-19226]
 gi|254848484|ref|ZP_05237834.1| amino acid ABC transporter [Vibrio cholerae MO10]
 gi|255745749|ref|ZP_05419697.1| amino acid ABC transporter amino acid-binding protein [Vibrio
           cholera CIRS 101]
 gi|262158973|ref|ZP_06030085.1| amino acid ABC transporter amino acid-binding protein [Vibrio
           cholerae INDRE 91/1]
 gi|262192389|ref|ZP_06050542.1| amino acid ABC transporter amino acid-binding protein [Vibrio
           cholerae CT 5369-93]
 gi|297578947|ref|ZP_06940875.1| amino acid ABC transporter [Vibrio cholerae RC385]
 gi|298498554|ref|ZP_07008361.1| amino acid ABC transporter [Vibrio cholerae MAK 757]
 gi|9655856|gb|AAF94520.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Vibrio cholerae O1 biovar El Tor str. N16961]
 gi|121547740|gb|EAX57831.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Vibrio cholerae 2740-80]
 gi|121629194|gb|EAX61634.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Vibrio cholerae V52]
 gi|124116376|gb|EAY35196.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Vibrio cholerae 1587]
 gi|125622187|gb|EAZ50509.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Vibrio cholerae V51]
 gi|126510093|gb|EAZ72687.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Vibrio cholerae NCTC 8457]
 gi|126521153|gb|EAZ78376.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Vibrio cholerae B33]
 gi|148875723|gb|EDL73858.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Vibrio cholerae 623-39]
 gi|149741122|gb|EDM55181.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Vibrio cholerae MZO-2]
 gi|150423855|gb|EDN15796.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Vibrio cholerae AM-19226]
 gi|183012771|gb|EDT88071.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Vibrio cholerae MZO-3]
 gi|227009421|gb|ACP05633.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Vibrio cholerae M66-2]
 gi|229333336|gb|EEN98822.1| amino acid ABC transporter amino acid-binding protein [Vibrio
           cholerae 12129(1)]
 gi|229341566|gb|EEO06569.1| amino acid ABC transporter amino acid-binding protein [Vibrio
           cholerae TM 11079-80]
 gi|229345106|gb|EEO10080.1| amino acid ABC transporter amino acid-binding protein [Vibrio
           cholerae RC9]
 gi|229347503|gb|EEO12463.1| amino acid ABC transporter amino acid-binding protein [Vibrio
           cholerae TMA 21]
 gi|229351238|gb|EEO16179.1| amino acid ABC transporter amino acid-binding protein [Vibrio
           cholerae B33]
 gi|229357280|gb|EEO22197.1| amino acid ABC transporter amino acid-binding protein [Vibrio
           cholerae BX 330286]
 gi|229370716|gb|ACQ61139.1| amino acid ABC transporter amino acid-binding protein [Vibrio
           cholerae MJ-1236]
 gi|254844189|gb|EET22603.1| amino acid ABC transporter [Vibrio cholerae MO10]
 gi|255736824|gb|EET92221.1| amino acid ABC transporter amino acid-binding protein [Vibrio
           cholera CIRS 101]
 gi|262029158|gb|EEY47810.1| amino acid ABC transporter amino acid-binding protein [Vibrio
           cholerae INDRE 91/1]
 gi|262031742|gb|EEY50327.1| amino acid ABC transporter amino acid-binding protein [Vibrio
           cholerae CT 5369-93]
 gi|297536541|gb|EFH75374.1| amino acid ABC transporter [Vibrio cholerae RC385]
 gi|297542887|gb|EFH78937.1| amino acid ABC transporter [Vibrio cholerae MAK 757]
 gi|327484032|gb|AEA78439.1| Glutamate Aspartate periplasmic binding protein precursor GltI
           [Vibrio cholerae LMA3894-4]
          Length = 342

 Score =  366 bits (940), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 163/318 (51%), Positives = 227/318 (71%), Gaps = 3/318 (0%)

Query: 25  SILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLN 84
           S L  +  +GF+ CG++TGL GF+   A G+W+G DV++C+A+++A+  D +K++++PL 
Sbjct: 28  STLDKVLSQGFITCGVSTGLPGFSNPNAKGEWEGIDVEYCQAMAAAVLGDKTKVKFVPLT 87

Query: 85  AKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLS 144
           AKERF ALQS +ID+LSRNT WTL R+ +LGL F  + Y+DGQGF++ K  G+ S  +L+
Sbjct: 88  AKERFTALQSGEIDVLSRNTTWTLQRDSALGLNFVGVNYYDGQGFMVKKDLGVKSAKELN 147

Query: 145 GASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYAL 204
           GAS+CVQ+GTTTEL LADYF+   M Y P+VF+   +    + A RCD  T D S LYAL
Sbjct: 148 GASVCVQSGTTTELNLADYFRNSGMTYKPVVFDTAAQTSKGFDAGRCDVLTTDQSGLYAL 207

Query: 205 KLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQV 264
           +L  ++P   V+LP+IISK PL P + Q D +W+N+  W  YAMV AEE GIT KN++++
Sbjct: 208 RLNLEKPDSAVVLPEIISKEPLGPVVRQDDDKWFNVAKWVLYAMVNAEEYGITSKNVDEM 267

Query: 265 SKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPR 324
            K + NP+V+R LG+D     G  LG+  DW+Y+I++ +GNYGE FDR +G+ S LKI R
Sbjct: 268 MK-SDNPEVKRILGLDGPK--GTGLGIRDDWSYQIVKQVGNYGESFDRTVGSGSPLKIDR 324

Query: 325 GYNALWSKGGLMYAPPIR 342
           G NALW+ GG MYAPPIR
Sbjct: 325 GVNALWNAGGFMYAPPIR 342


>gi|258621541|ref|ZP_05716574.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Vibrio mimicus VM573]
 gi|258627556|ref|ZP_05722333.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Vibrio mimicus VM603]
 gi|262171608|ref|ZP_06039286.1| amino acid ABC transporter amino acid-binding protein [Vibrio
           mimicus MB-451]
 gi|258580138|gb|EEW05110.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Vibrio mimicus VM603]
 gi|258586159|gb|EEW10875.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Vibrio mimicus VM573]
 gi|261892684|gb|EEY38670.1| amino acid ABC transporter amino acid-binding protein [Vibrio
           mimicus MB-451]
          Length = 342

 Score =  366 bits (940), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 164/318 (51%), Positives = 227/318 (71%), Gaps = 3/318 (0%)

Query: 25  SILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLN 84
           S L  +  +GF+ CG++TGL GF+   A GDW+G DV++C+AL++A+  D +K++++PL 
Sbjct: 28  STLDKVLAQGFITCGVSTGLPGFSNPNAKGDWEGIDVEYCQALAAAVLGDKTKVKFVPLT 87

Query: 85  AKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLS 144
           AKERF ALQS +ID+LSRNT WTL R+ +LGL F  + Y+DGQGF++ K  GI S  +L 
Sbjct: 88  AKERFTALQSGEIDVLSRNTTWTLQRDSALGLNFVGVNYYDGQGFMVKKDLGIKSAKELD 147

Query: 145 GASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYAL 204
           GAS+CVQ+GTTTEL LADYF+   MKY P+VF+   +    + A RCD  T D S LYAL
Sbjct: 148 GASVCVQSGTTTELNLADYFRNSGMKYKPVVFDTAAQTSKGFDAGRCDVLTTDQSGLYAL 207

Query: 205 KLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQV 264
           +L  ++P   ++LP+IISK PL P + Q D +W+N+  W  YAMV AEE GIT KN++++
Sbjct: 208 RLNLEKPDSALVLPEIISKEPLGPVVRQDDDKWFNVAKWVLYAMVNAEEYGITSKNVDEM 267

Query: 265 SKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPR 324
            K + NP+V+R LG+D     G  LG+  DW+Y+I++ +GNYGE F+R +G+ S L+I R
Sbjct: 268 MK-SDNPEVKRILGLDGPK--GTGLGIRDDWSYQIVKQVGNYGESFERTVGSGSPLQIDR 324

Query: 325 GYNALWSKGGLMYAPPIR 342
           G NALW+ GG MYAPPIR
Sbjct: 325 GVNALWNAGGFMYAPPIR 342


>gi|149191354|ref|ZP_01869607.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Vibrio shilonii AK1]
 gi|148834833|gb|EDL51817.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Vibrio shilonii AK1]
          Length = 342

 Score =  366 bits (940), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 168/328 (51%), Positives = 229/328 (69%), Gaps = 3/328 (0%)

Query: 15  LFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDD 74
           +  TS S     L  + K G L CG++TGL GF+   + G+W+G DV++C+AL++A+  D
Sbjct: 18  MMSTSASAADGTLDKVTKAGVLTCGVSTGLPGFSNPNSKGEWEGIDVEYCQALAAAVLGD 77

Query: 75  PSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKK 134
            SK++Y+PL AKERF ALQS +ID+LSRNT WTL R+ +LGL F  + Y+DGQGF++ K 
Sbjct: 78  KSKVKYVPLTAKERFTALQSGEIDVLSRNTTWTLHRDSALGLNFVGVNYYDGQGFMVKKD 137

Query: 135 KGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAY 194
            G+SS  +L GAS+CVQ+GTTTEL LADYF+ + M+Y P+VF+   +    + + RCD  
Sbjct: 138 LGLSSAKELDGASVCVQSGTTTELNLADYFRNNGMEYKPVVFDTAAQTSKGFDSGRCDVL 197

Query: 195 TGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEEL 254
           T D S LYAL+L    PS  V+LP+IISK PL P + QGD +W+NI  WT  AMV AEE 
Sbjct: 198 TTDQSGLYALRLNLQDPSSAVVLPEIISKEPLGPVVRQGDDQWFNIAKWTLAAMVNAEEY 257

Query: 255 GITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNL 314
           GIT KN +++ K + +P+++R LG+D     G+ LG+  DW Y+II+ +GNYGE F+R +
Sbjct: 258 GITSKNADEMLK-SKDPNIKRILGVDGPK--GKGLGIRDDWGYQIIKQVGNYGESFERTV 314

Query: 315 GNQSELKIPRGYNALWSKGGLMYAPPIR 342
           G  S L+I RG NALW+ GG MYAPPIR
Sbjct: 315 GEGSPLQISRGVNALWNAGGFMYAPPIR 342


>gi|251791415|ref|YP_003006136.1| extracellular solute-binding protein family 3 [Dickeya zeae
           Ech1591]
 gi|247540036|gb|ACT08657.1| extracellular solute-binding protein family 3 [Dickeya zeae
           Ech1591]
          Length = 343

 Score =  366 bits (939), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 166/343 (48%), Positives = 236/343 (68%), Gaps = 3/343 (0%)

Query: 1   MYKDFFVSILCLIILF-FTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGF 59
           M K    +++    LF F + +   + L  I+K+GF++CGI+ GL GF+   ANG + G 
Sbjct: 3   MKKVIMSTLVASASLFAFINQAHAGATLDAIQKKGFVQCGISDGLPGFSYADANGKYSGI 62

Query: 60  DVDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFR 119
           DVD CR +++AIF D +K++Y PL AKERF ALQS ++D+LSRNT WT  R+  +GL F 
Sbjct: 63  DVDVCRGVAAAIFGDANKVKYTPLTAKERFTALQSGEVDLLSRNTTWTSSRDGGMGLLFT 122

Query: 120 PITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERV 179
            +TY+DG GF+ H K G+ S  +L GA++C+QAGT TEL +ADYFK HNMKY P+ F+R 
Sbjct: 123 GVTYYDGIGFLTHNKAGLKSAKELDGATVCIQAGTDTELNVADYFKTHNMKYTPVTFDRS 182

Query: 180 EEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYN 239
           +E   A  + RCD    D S LYAL++   +P++ V+LP++ISK PL P + +GD +W+ 
Sbjct: 183 DESAKALDSGRCDTLASDQSQLYALRIKLGKPADFVVLPEVISKEPLGPVVRRGDEDWFA 242

Query: 240 IVSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRI 299
           IV WT +AM+ AEE+GIT +N++Q++   T PD+   LG  K  N G+ L L  DW ++I
Sbjct: 243 IVRWTLFAMLNAEEMGITSQNVDQMAAKPTTPDMAHLLG--KEGNFGKDLKLPADWAFKI 300

Query: 300 IRHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           ++ +GNYGE+F+RN+G  SELKI RG N LW+KGG+ YAP +R
Sbjct: 301 VKQVGNYGEVFERNVGQGSELKIKRGLNELWNKGGIQYAPTVR 343


>gi|90410648|ref|ZP_01218664.1| putative amino acid ABC transporter, periplasmic amino acid-binding
           protein [Photobacterium profundum 3TCK]
 gi|90328889|gb|EAS45173.1| putative amino acid ABC transporter, periplasmic amino acid-binding
           protein [Photobacterium profundum 3TCK]
          Length = 342

 Score =  366 bits (939), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 161/338 (47%), Positives = 237/338 (70%), Gaps = 3/338 (0%)

Query: 5   FFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFC 64
            F +I     LF  + S   + L  + K+G+++CG++ GL GF+   + G+W+G DV+FC
Sbjct: 8   LFAAIATTSALFAVNASAANTTLEKVMKQGYVQCGVSAGLPGFSNPNSKGEWEGLDVEFC 67

Query: 65  RALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYF 124
           +A+++A   D +K++Y+PL AKERF ALQS +ID+LSRNT WTL R+ +LGL F  ++Y+
Sbjct: 68  QAIAAATVGDKTKVKYIPLTAKERFTALQSGEIDVLSRNTTWTLHRDSALGLNFAGVSYY 127

Query: 125 DGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDA 184
           DGQGF++ K+ G+SS  +L GA++CVQ+GTTTEL LADYF+ + MKY P+VF+   +   
Sbjct: 128 DGQGFMVKKELGVSSAKELDGAAVCVQSGTTTELNLADYFRVNGMKYSPVVFDTAPQTSK 187

Query: 185 AYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWT 244
            + + RCD  T D S LYAL+L    P+  V+LP++ISK PL P + QGD +W+NIV WT
Sbjct: 188 GFDSGRCDVLTTDQSGLYALRLNLAEPASAVVLPEVISKEPLGPVVRQGDDQWFNIVKWT 247

Query: 245 HYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMG 304
             AM+ AEE G+T  N++++ K++ +P+++R +G+D     G+ LGL+ DW Y+I++ +G
Sbjct: 248 LSAMLNAEEYGVTSANVDKM-KESKDPNIRRLIGLDGPK--GKGLGLSDDWGYQIVKQVG 304

Query: 305 NYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           NYGE F+R +G  S LKI RG NALW  GG+ YA PIR
Sbjct: 305 NYGESFERTVGTGSPLKIERGLNALWKDGGIQYAAPIR 342


>gi|262394189|ref|YP_003286043.1| amino acid ABC transporter amino acid-binding protein [Vibrio sp.
           Ex25]
 gi|262337783|gb|ACY51578.1| amino acid ABC transporter amino acid-binding protein [Vibrio sp.
           Ex25]
          Length = 342

 Score =  365 bits (937), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 165/328 (50%), Positives = 228/328 (69%), Gaps = 3/328 (0%)

Query: 15  LFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDD 74
           +  TS     + L  + K+GFL CG++TGL GF+   + G+W+G DV++C+AL++A+  D
Sbjct: 18  MMATSAQAADTTLDKVTKQGFLTCGVSTGLPGFSNPNSKGEWEGIDVEYCQALAAAVLGD 77

Query: 75  PSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKK 134
            +K++Y+PL AKERF ALQS +ID+LSRNT WTL R+ +LGL F  + Y+DGQGF++ K 
Sbjct: 78  KTKVKYVPLTAKERFTALQSGEIDVLSRNTTWTLHRDTALGLNFVGVNYYDGQGFMVKKD 137

Query: 135 KGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAY 194
            GISS  +L GAS+CVQ+GTTTEL LADYF+   M Y P+VF+   +    + A RCD  
Sbjct: 138 LGISSAKELDGASVCVQSGTTTELNLADYFRNSGMSYKPVVFDTAAQTSKGFDAGRCDVL 197

Query: 195 TGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEEL 254
           T D S LYAL+L    PS   +LP+IISK PL P + QGD +W+NI  WT  AM+ AEE 
Sbjct: 198 TTDQSGLYALRLNLKDPSSAAVLPEIISKEPLGPVVRQGDDQWFNIAKWTLSAMINAEEY 257

Query: 255 GITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNL 314
           GI+ KN +++ K + +P+++R LG+D     G+ LG+  DW Y++I+ +GNYGE F+R +
Sbjct: 258 GISSKNADEMLK-SKDPNIKRILGVDGPK--GKGLGIRDDWGYQVIKQVGNYGESFERTV 314

Query: 315 GNQSELKIPRGYNALWSKGGLMYAPPIR 342
           G  S L+I RG NALW+ GG MYAPPIR
Sbjct: 315 GTGSPLEISRGVNALWNAGGFMYAPPIR 342


>gi|27365994|ref|NP_761522.1| amino acid ABC transporter periplasmic amino acid-binding protein
           [Vibrio vulnificus CMCP6]
 gi|320156509|ref|YP_004188888.1| glutamate aspartate periplasmic binding protein GltI [Vibrio
           vulnificus MO6-24/O]
 gi|27362194|gb|AAO11049.1| Amino acid ABC transporter, periplasmic amino acid-binding protein
           [Vibrio vulnificus CMCP6]
 gi|319931821|gb|ADV86685.1| glutamate Aspartate periplasmic binding protein precursor GltI
           [Vibrio vulnificus MO6-24/O]
          Length = 342

 Score =  365 bits (937), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 169/341 (49%), Positives = 236/341 (69%), Gaps = 8/341 (2%)

Query: 7   VSILCLIILFFTS-FSTNA----SILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDV 61
           ++IL  ++   T+  S+NA    S L  + K+GFL CG++TGL GF+   + G+W+G DV
Sbjct: 5   LTILASLVAASTAMLSSNAFAAESTLDKVTKQGFLTCGVSTGLPGFSNPNSKGEWEGIDV 64

Query: 62  DFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPI 121
           ++C+A+++A+  D +K++Y+PL AKERF ALQS +ID+LSRNT WTL R+ +LGL F  +
Sbjct: 65  EYCQAIAAAVLGDKTKVKYVPLTAKERFTALQSGEIDVLSRNTTWTLHRDTALGLNFVGV 124

Query: 122 TYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEE 181
            Y+DGQGF++ K  GI S  +L GAS+CVQ+GTTTEL LADYF+   M Y P+VF+   +
Sbjct: 125 NYYDGQGFMVKKDLGIKSAKELDGASVCVQSGTTTELNLADYFRNSGMSYKPVVFDTAAQ 184

Query: 182 IDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIV 241
               + A RCD  T D S LYAL+L    P+  V+LP+IISK PL P + QGD +W+NI 
Sbjct: 185 TSKGFDAGRCDVLTTDQSGLYALRLNLQDPNSAVVLPEIISKEPLGPVVRQGDDQWFNIA 244

Query: 242 SWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIR 301
            WT  AM+ AEE GIT KN  ++ K + +P+V+R LG+D     G+ LG+  DW Y++++
Sbjct: 245 KWTLNAMINAEEYGITSKNAEEMLK-SNDPNVKRILGVDGPK--GKGLGIRDDWGYQVVK 301

Query: 302 HMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
            +GNYGE F+R +G  S L+I RG NALW+ GG MYAPPIR
Sbjct: 302 QVGNYGESFERTVGTGSPLQISRGVNALWNAGGFMYAPPIR 342


>gi|323498373|ref|ZP_08103373.1| amino acid ABC transporter amino acid-binding protein [Vibrio
           sinaloensis DSM 21326]
 gi|323316615|gb|EGA69626.1| amino acid ABC transporter amino acid-binding protein [Vibrio
           sinaloensis DSM 21326]
          Length = 342

 Score =  365 bits (937), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 167/339 (49%), Positives = 232/339 (68%), Gaps = 4/339 (1%)

Query: 5   FFVSILCLIILFF-TSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDF 63
              S++     F  TS S   S L  + K+GFL CG++TGL GF+   + G+W+G DV++
Sbjct: 7   LLASVVAASTAFMATSASAADSTLDKVTKQGFLTCGVSTGLPGFSNPNSKGEWEGIDVEY 66

Query: 64  CRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITY 123
           C+AL++A+  D +K++Y+PL AKERF ALQS +ID+LSRNT WTL R+ +LGL F  + Y
Sbjct: 67  CQALAAAVLGDKTKVKYVPLTAKERFTALQSGEIDVLSRNTTWTLHRDTALGLNFVGVNY 126

Query: 124 FDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEID 183
           +DGQGF++ K  G+ S ++L GAS+CVQ+GTTTEL LADYF+   M Y P+VF+   +  
Sbjct: 127 YDGQGFMVKKDLGLKSATELDGASVCVQSGTTTELNLADYFRNSGMSYKPVVFDTAAQTS 186

Query: 184 AAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSW 243
             + A RCD  T D S LYAL+L    PS   +LP+IISK PL P + QGD +W+NI  W
Sbjct: 187 KGFDAGRCDVLTTDQSGLYALRLNLQDPSSAQVLPEIISKEPLGPVVRQGDDQWFNIAKW 246

Query: 244 THYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHM 303
           T  AM+ AEE GI+ KN +++ K + +P+++R LG+D     G+ LG+  DW Y++I+ +
Sbjct: 247 TLSAMINAEEYGISSKNADEMLK-SKDPNIKRILGVDGPK--GKGLGIRDDWGYQVIKQV 303

Query: 304 GNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           GNYGE F+R +G  S L+I RG NALW+ GG MYAPPIR
Sbjct: 304 GNYGESFERTVGTGSPLQISRGVNALWNAGGFMYAPPIR 342


>gi|311277770|ref|YP_003940001.1| extracellular solute-binding protein family 3 [Enterobacter cloacae
           SCF1]
 gi|308746965|gb|ADO46717.1| extracellular solute-binding protein family 3 [Enterobacter cloacae
           SCF1]
          Length = 341

 Score =  365 bits (936), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 167/343 (48%), Positives = 233/343 (67%), Gaps = 3/343 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGD-IKKRGFLKCGINTGLVGFAEVKANGDWKGF 59
           M K    S +   +LF  +   +A    D IKK+GF++CGI+ GL GF+   A+G + G 
Sbjct: 1   MKKTTIASFVAAGVLFAIASQAHAGATFDAIKKKGFVQCGISDGLPGFSYADADGKFTGI 60

Query: 60  DVDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFR 119
           DVD CR +++A+F D SK++Y PL AKERF ALQS ++D+LSRNT WT  R+  +GL+F 
Sbjct: 61  DVDVCRGVAAAVFGDASKVKYTPLTAKERFTALQSGEVDLLSRNTTWTSSRDAGMGLSFT 120

Query: 120 PITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERV 179
            +TY+DG GF+ H K G+ S  +L GA++C+QAGT TEL +ADYFKA+NMKY P+ F+R 
Sbjct: 121 GVTYYDGIGFLTHDKAGLKSAKELDGATVCIQAGTDTELNVADYFKANNMKYTPVTFDRS 180

Query: 180 EEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYN 239
           +E   A  + RCD    D S LYAL++   +P+E V+LP++ISK PL P + +GD EW+ 
Sbjct: 181 DESAKALESGRCDTLASDQSQLYALRIKLSKPTEWVVLPEVISKEPLGPVVRRGDDEWFA 240

Query: 240 IVSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRI 299
           IV WT +AM+ AEE+GI  KN+++ + + +NPD+   LG  K  + G+ L L   W Y I
Sbjct: 241 IVRWTLFAMLNAEEMGINSKNVDEKAANPSNPDMSHLLG--KEGDFGKDLKLDNKWAYNI 298

Query: 300 IRHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           I+ +GNY E+FDRN+G  S LKI RG N LW+ GG+ YAPP+R
Sbjct: 299 IKQVGNYAEIFDRNVGADSPLKIKRGQNNLWNNGGIQYAPPVR 341


>gi|83592340|ref|YP_426092.1| lysine-arginine-ornithine-binding periplasmic protein
           [Rhodospirillum rubrum ATCC 11170]
 gi|83575254|gb|ABC21805.1| Lysine-arginine-ornithine-binding periplasmic protein
           [Rhodospirillum rubrum ATCC 11170]
          Length = 340

 Score =  365 bits (936), Expect = 8e-99,   Method: Compositional matrix adjust.
 Identities = 166/319 (52%), Positives = 226/319 (70%), Gaps = 3/319 (0%)

Query: 24  ASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPL 83
           AS L  +K RG + CG+N GL GFA     G W G DVD CRA+++A+F D  K++++PL
Sbjct: 25  ASTLDTVKSRGEVTCGVNNGLPGFALPDDKGHWTGIDVDICRAVAAAVFGDAKKVKFVPL 84

Query: 84  NAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQL 143
           NAKERF ALQS +ID+LSRNT WT  R+ SLGL F  + Y+DGQGF++ K+ G+SS  +L
Sbjct: 85  NAKERFTALQSGEIDVLSRNTTWTQTRDASLGLIFAGVNYYDGQGFMVKKELGVSSAKEL 144

Query: 144 SGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYA 203
           +GASIC+Q+GTTTEL LADYF+A+ M Y P+VF+  ++    +   RCD  T D S LYA
Sbjct: 145 NGASICIQSGTTTELNLADYFRANAMTYSPVVFDTSDQTVQGFAGGRCDVLTSDQSQLYA 204

Query: 204 LKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQ 263
           L++  + P   ++LP++ISK PL P + QGD +W NIV W+ +A + AEELG+T  N ++
Sbjct: 205 LRIKLEDPKSAIVLPEVISKEPLGPMVRQGDDQWLNIVRWSLFAQLNAEELGVTSANADE 264

Query: 264 VSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIP 323
           V K  T+ +V+R LG +    +G+ LGL  DW Y I++ +GNYGEMF+RN+G  S L+I 
Sbjct: 265 V-KAGTDQNVKRLLGTE--GEMGKQLGLGNDWAYAIVKQVGNYGEMFERNIGKGSPLEIE 321

Query: 324 RGYNALWSKGGLMYAPPIR 342
           RG NALW+KGG+ YAPPIR
Sbjct: 322 RGLNALWNKGGIQYAPPIR 340


>gi|37679741|ref|NP_934350.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Vibrio vulnificus YJ016]
 gi|37198486|dbj|BAC94321.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Vibrio vulnificus YJ016]
          Length = 375

 Score =  364 bits (935), Expect = 9e-99,   Method: Compositional matrix adjust.
 Identities = 169/341 (49%), Positives = 236/341 (69%), Gaps = 8/341 (2%)

Query: 7   VSILCLIILFFTS-FSTNA----SILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDV 61
           ++IL  ++   T+  S+NA    S L  + K+GFL CG++TGL GF+   + G+W+G DV
Sbjct: 38  LTILASLVAASTAMLSSNAFAAESTLDKVTKQGFLTCGVSTGLPGFSNPNSKGEWEGIDV 97

Query: 62  DFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPI 121
           ++C+A+++A+  D +K++Y+PL AKERF ALQS +ID+LSRNT WTL R+ +LGL F  +
Sbjct: 98  EYCQAIAAAVLGDKTKVKYVPLTAKERFTALQSGEIDVLSRNTTWTLHRDTALGLNFVGV 157

Query: 122 TYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEE 181
            Y+DGQGF++ K  GI S  +L GAS+CVQ+GTTTEL LADYF+   M Y P+VF+   +
Sbjct: 158 NYYDGQGFMVKKDLGIKSAKELDGASVCVQSGTTTELNLADYFRNSGMSYKPVVFDTAAQ 217

Query: 182 IDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIV 241
               + A RCD  T D S LYAL+L    P+  V+LP+IISK PL P + QGD +W+NI 
Sbjct: 218 TSKGFDAGRCDVLTTDQSGLYALRLNLQDPNSAVVLPEIISKEPLGPVVRQGDDQWFNIA 277

Query: 242 SWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIR 301
            WT  AM+ AEE GIT KN  ++ K + +P+V+R LG+D     G+ LG+  DW Y++++
Sbjct: 278 KWTLNAMINAEEYGITSKNAEEMLK-SNDPNVKRILGVDGPK--GKGLGIRDDWGYQVVK 334

Query: 302 HMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
            +GNYGE F+R +G  S L+I RG NALW+ GG MYAPPIR
Sbjct: 335 QVGNYGESFERTVGTGSPLQISRGVNALWNAGGFMYAPPIR 375


>gi|261342745|ref|ZP_05970603.1| general amino acid ABC transporter, periplasmic binding protein
           [Enterobacter cancerogenus ATCC 35316]
 gi|288315398|gb|EFC54336.1| general amino acid ABC transporter, periplasmic binding protein
           [Enterobacter cancerogenus ATCC 35316]
          Length = 341

 Score =  364 bits (935), Expect = 9e-99,   Method: Compositional matrix adjust.
 Identities = 162/343 (47%), Positives = 237/343 (69%), Gaps = 3/343 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNA-SILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGF 59
           M K    S+    +LF  +   +A + L  +KK+GF++CGI+ GL GF+   ANG + G 
Sbjct: 1   MKKTMIASLAAAGVLFAVASQAHAGTTLDAVKKKGFVQCGISDGLPGFSYADANGKFTGI 60

Query: 60  DVDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFR 119
           DVD CR +++A+F D SK++Y PL AKERF ALQS ++D+LSRNT WT  R+  +G++F 
Sbjct: 61  DVDVCRGVAAAVFGDDSKVKYTPLTAKERFTALQSGEVDMLSRNTTWTSSRDAGMGMSFT 120

Query: 120 PITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERV 179
            +TY+DG GF+ H K G+ S  +L GA++C+QAGT TEL +ADYFKA++MKY P+ F+R 
Sbjct: 121 GVTYYDGIGFLTHNKAGLKSAKELDGATVCIQAGTDTELNVADYFKANSMKYTPVTFDRS 180

Query: 180 EEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYN 239
           +E   A  + RCD    D S LYAL++    P+E ++LP++ISK PL P + +GD +W++
Sbjct: 181 DESAKALESGRCDTLASDQSQLYALRIKLSNPAEWIVLPEVISKEPLGPVVRRGDEDWFS 240

Query: 240 IVSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRI 299
           IV WT +AM+ AEE+GIT KN+++ + + + PD+   LG  K  + G+ L L   W Y I
Sbjct: 241 IVRWTLFAMLNAEEMGITSKNVDEKAANPSTPDMSHLLG--KEGDFGKDLKLDNKWAYHI 298

Query: 300 IRHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           ++ +GNYGE+F+RN+G++S LKI RG N LW+ GG+ YAPP+R
Sbjct: 299 VKQVGNYGEIFERNVGSESPLKIKRGQNNLWNNGGIQYAPPVR 341


>gi|261252934|ref|ZP_05945507.1| amino acid ABC transporter amino acid-binding protein [Vibrio
           orientalis CIP 102891]
 gi|260936325|gb|EEX92314.1| amino acid ABC transporter amino acid-binding protein [Vibrio
           orientalis CIP 102891]
          Length = 342

 Score =  364 bits (934), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 165/328 (50%), Positives = 228/328 (69%), Gaps = 3/328 (0%)

Query: 15  LFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDD 74
           L  TS S   S L  + K+GF+ CG++TGL GF+   + G+W+G DV++C+ L++A+  D
Sbjct: 18  LMSTSASAADSTLDKVTKQGFITCGVSTGLPGFSNPNSKGEWEGIDVEYCQGLAAAVLGD 77

Query: 75  PSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKK 134
            +K++Y+PL AKERF ALQS +ID+LSRNT WTL R+ +LGL F  + Y+DGQGF++ K 
Sbjct: 78  KTKVKYVPLTAKERFTALQSGEIDVLSRNTTWTLHRDTALGLNFVGVNYYDGQGFMVKKD 137

Query: 135 KGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAY 194
            G++S  +L GAS+CVQ+GTTTEL LADYF+   M Y P+VF+   +    + A RCD  
Sbjct: 138 LGLTSAKELDGASVCVQSGTTTELNLADYFRNSGMSYKPVVFDTAAQTSKGFDAGRCDVL 197

Query: 195 TGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEEL 254
           T D S LYAL+L    PS   +LP+IISK PL P + QGD +W+NI  WT  AMV AEE 
Sbjct: 198 TTDQSGLYALRLNLQDPSSAQVLPEIISKEPLGPVVRQGDDQWFNIAKWTLAAMVNAEEY 257

Query: 255 GITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNL 314
           GI+ KN +++ K + +P+++R LG+D     G+ LG+  DW Y++I+ +GNYGE F+R +
Sbjct: 258 GISSKNADEMLK-SKDPNIKRILGVDGPK--GKGLGIRDDWGYQVIKQVGNYGESFERTV 314

Query: 315 GNQSELKIPRGYNALWSKGGLMYAPPIR 342
           G  S L+I RG NALW+ GG MYAPPIR
Sbjct: 315 GEGSPLQISRGVNALWNAGGFMYAPPIR 342


>gi|254508781|ref|ZP_05120893.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Vibrio parahaemolyticus 16]
 gi|219548301|gb|EED25314.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Vibrio parahaemolyticus 16]
          Length = 342

 Score =  363 bits (933), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 167/339 (49%), Positives = 231/339 (68%), Gaps = 4/339 (1%)

Query: 5   FFVSILCLIILFF-TSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDF 63
              S++     F  TS S   S L  + K+GF+ CG++TGL GF+   + G+W+G DV++
Sbjct: 7   LLASVVAASTAFMATSASAADSTLDKVTKQGFITCGVSTGLPGFSNPNSKGEWEGIDVEY 66

Query: 64  CRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITY 123
           C+AL++A+  D SK++Y+PL AKERF ALQS +ID+LSRNT WTL R+ +LGL F  + Y
Sbjct: 67  CQALAAAVLGDKSKVKYVPLTAKERFTALQSGEIDVLSRNTTWTLHRDTALGLNFVGVNY 126

Query: 124 FDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEID 183
           +DGQGF++ K  G+ S  +L GAS+CVQ+GTTTEL LADYF+   M Y P+VF+   +  
Sbjct: 127 YDGQGFMVKKDLGLKSAKELDGASVCVQSGTTTELNLADYFRNSGMSYKPVVFDTAAQTS 186

Query: 184 AAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSW 243
             + A RCD  T D S LYAL+L    P+   +LP+IISK PL P + QGD +W+NI  W
Sbjct: 187 KGFDAGRCDVLTTDQSGLYALRLNLQDPASAQVLPEIISKEPLGPVVRQGDDQWFNIAKW 246

Query: 244 THYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHM 303
           T  AM+ AEE GI+ KN +++ K + +P+V+R LG+D     G+ LG+  DW Y++I+ +
Sbjct: 247 TLNAMINAEEYGISSKNADEMLK-SKDPNVKRILGVDGPK--GKGLGIRDDWGYQVIKQV 303

Query: 304 GNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           GNYGE F+R +G  S L+I RG NALW+ GG MYAPPIR
Sbjct: 304 GNYGESFERTVGTGSPLQISRGVNALWNAGGFMYAPPIR 342


>gi|260772752|ref|ZP_05881668.1| amino acid ABC transporter amino acid-binding protein [Vibrio
           metschnikovii CIP 69.14]
 gi|260611891|gb|EEX37094.1| amino acid ABC transporter amino acid-binding protein [Vibrio
           metschnikovii CIP 69.14]
          Length = 340

 Score =  363 bits (933), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 170/339 (50%), Positives = 230/339 (67%), Gaps = 5/339 (1%)

Query: 6   FVSILCLIILFFTSFSTNAS--ILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDF 63
             +++C + L  T+    AS   L  +  +G L CGI+TGL GF++  A G W+G DVD+
Sbjct: 5   LATLVCAVSLSLTTHLAFASPTTLDRVLTQGKLTCGISTGLAGFSDADAKGQWQGLDVDY 64

Query: 64  CRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITY 123
           CRAL++A+  D +K++Y+PL A+ERF ALQS Q+D+LSRNT WT  R+ ++GL F  + +
Sbjct: 65  CRALAAAVLGDKNKVEYVPLTARERFNALQSGQVDVLSRNTTWTFERDTTMGLNFVGVNF 124

Query: 124 FDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEID 183
           +DGQGF++ KK  I+ VSQL+   ICVQ+ TTT+L L DYF+ H M Y P+VF+   +I 
Sbjct: 125 YDGQGFMVTKKSAITQVSQLNNRPICVQSETTTKLNLDDYFRHHGMSYQPVVFDTAIQIA 184

Query: 184 AAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSW 243
            A+ A RC A T D S LYAL+L   +P   +ILP+IISK PL P I +GD  W NI  W
Sbjct: 185 RAFNAERCVAVTADKSGLYALRLNLAKPDSAIILPEIISKEPLGPVIREGDDRWLNITRW 244

Query: 244 THYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHM 303
           T  AM+ AEELGIT  N++Q  K +TNP+++R LG++    IG  LG+  DW Y+II+ +
Sbjct: 245 TLAAMINAEELGITSANVDQQRK-STNPEIRRLLGVE--GEIGRPLGINNDWAYQIIKQV 301

Query: 304 GNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           GNY E F RN+G  S L IPRG NALW+ GG+MYA PIR
Sbjct: 302 GNYSESFQRNVGEDSPLAIPRGLNALWNAGGIMYATPIR 340


>gi|149908408|ref|ZP_01897071.1| general L-amino acid-binding protein [Moritella sp. PE36]
 gi|149808571|gb|EDM68506.1| general L-amino acid-binding protein [Moritella sp. PE36]
          Length = 337

 Score =  363 bits (932), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 163/320 (50%), Positives = 224/320 (70%), Gaps = 3/320 (0%)

Query: 23  NASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLP 82
           NA+ L  + K+G L CG++TG+ GF+   + G WKG DVDFCR++++A+  D SK++Y+P
Sbjct: 21  NAATLEQVMKKGVLNCGVSTGIPGFSATDSKGVWKGIDVDFCRSVAAAVLGDASKVKYIP 80

Query: 83  LNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQ 142
           L AKERF ALQS +ID+LSR + WT  R+ SLGL F  + Y+DGQGF++ K+ G++S  +
Sbjct: 81  LTAKERFTALQSGEIDLLSRASTWTATRDTSLGLNFAGVNYYDGQGFLVKKEIGVTSAKE 140

Query: 143 LSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALY 202
           L GAS C+QAGTTTEL L DYFK++NM+Y  + F+   +   A++  RCDA T D S LY
Sbjct: 141 LDGASFCIQAGTTTELNLTDYFKSNNMEYKAVTFDTSGQTIDAFKKGRCDAVTSDASQLY 200

Query: 203 ALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNIN 262
            L++  D P   ++LPDIISK PL P + QGD  W+N+V W+ +A + AEELG+T  N++
Sbjct: 201 GLRIKLDDPKSAIVLPDIISKEPLGPVVRQGDDAWFNVVRWSLFATLEAEELGVTASNVD 260

Query: 263 QVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKI 322
           +  K + NP V+R LG+  +   GE LGL  DW Y+I++ +GNY EMFD N+G  S L I
Sbjct: 261 KQLK-SNNPSVKRLLGV--TGKAGENLGLKSDWAYQIVKQVGNYEEMFDNNVGKNSPLNI 317

Query: 323 PRGYNALWSKGGLMYAPPIR 342
            RG N LW+KGGLMYA PIR
Sbjct: 318 DRGLNNLWNKGGLMYAMPIR 337


>gi|75675721|ref|YP_318142.1| extracellular solute-binding protein [Nitrobacter winogradskyi
           Nb-255]
 gi|74420591|gb|ABA04790.1| amino acid ABC transporter substrate-binding protein, PAAT family
           [Nitrobacter winogradskyi Nb-255]
          Length = 346

 Score =  363 bits (931), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 162/318 (50%), Positives = 230/318 (72%), Gaps = 3/318 (0%)

Query: 25  SILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLN 84
           + L  +K RG L CG++ GL GF+     G+W G DVD CRA+++ +F+DP+K++++PL+
Sbjct: 32  TTLEAVKARGALSCGVSQGLPGFSAPDDKGNWTGLDVDICRAIAAVVFNDPTKVKFVPLS 91

Query: 85  AKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLS 144
           AK+RF+ALQS +ID+LSR+T WTL R+ SLG  F  +TY+DGQGF++ K   ++S  +L+
Sbjct: 92  AKDRFIALQSGEIDVLSRDTTWTLSRDTSLGANFTGVTYYDGQGFLIRKSLKVNSALELN 151

Query: 145 GASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYAL 204
            AS+CVQ GTT E  LADYFK++ MKY  I F   +E   AY + RCD +T DIS LYA 
Sbjct: 152 SASVCVQTGTTNEQNLADYFKSNKMKYEVIAFSTADETIKAYESGRCDVFTSDISQLYAQ 211

Query: 205 KLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQV 264
           +L    P++H +LP++ISK P A  +  GD +W+++V WT +AM+ AEELGIT+KN++++
Sbjct: 212 RLKLINPADHAVLPEVISKEPHATMVRHGDDQWFDLVKWTLFAMINAEELGITKKNVDEM 271

Query: 265 SKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPR 324
           ++ + NP+++R  G D   N GE LG+TKDW  RII+ +GNYGE FDRN+G  S L I R
Sbjct: 272 AR-SENPELKRIFGTD--GNFGEQLGVTKDWVSRIIKAVGNYGESFDRNVGAGSPLGIAR 328

Query: 325 GYNALWSKGGLMYAPPIR 342
           G N LW++GG+MYAPPIR
Sbjct: 329 GLNKLWNQGGIMYAPPIR 346


>gi|163800832|ref|ZP_02194732.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Vibrio sp. AND4]
 gi|159175181|gb|EDP59978.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Vibrio sp. AND4]
          Length = 342

 Score =  363 bits (931), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 165/334 (49%), Positives = 225/334 (67%), Gaps = 3/334 (0%)

Query: 9   ILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALS 68
           I     +  T+       L  + K+GFL CG++TGL GF+   A G+W+G DV++C+AL+
Sbjct: 12  IAASTTMLATTAHAADGTLEKVTKQGFLNCGVSTGLPGFSNPNAKGEWEGIDVEYCQALA 71

Query: 69  SAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQG 128
           +A+  D SK++Y+PL AKERF ALQS +ID+LSRNT WTL R+ +LGL F  + Y+DGQG
Sbjct: 72  AAVLGDKSKVKYVPLTAKERFTALQSGEIDVLSRNTTWTLHRDTALGLNFVGVNYYDGQG 131

Query: 129 FIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRA 188
           F++ K   +SS   L GAS+CVQ+GTTTEL LADYF+   M Y P+VF+   +    + A
Sbjct: 132 FMVKKDLEVSSAKDLDGASVCVQSGTTTELNLADYFRNQGMAYKPVVFDTAAQTSKGFDA 191

Query: 189 HRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAM 248
            RCD  T D S LYAL+L  + PS   +LP+IISK PL P + QGD  W+NI  WT   M
Sbjct: 192 GRCDVLTTDQSGLYALRLNLEDPSSATVLPEIISKEPLGPVVRQGDDRWFNIAKWTLATM 251

Query: 249 VTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGE 308
           V AEE GI+ KN++++ K + +P+++R LG+D     G+ LG+  DW Y++I+ +GNYGE
Sbjct: 252 VNAEEYGISSKNVDEMKK-SKDPNIKRILGVDGPK--GKGLGIRDDWGYQVIKQVGNYGE 308

Query: 309 MFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
            F+R +G  S L I RG NALW+ GG MYAPPIR
Sbjct: 309 SFERTVGTASPLNISRGVNALWNAGGFMYAPPIR 342


>gi|242241099|ref|YP_002989280.1| extracellular solute-binding protein family 3 [Dickeya dadantii
           Ech703]
 gi|242133156|gb|ACS87458.1| extracellular solute-binding protein family 3 [Dickeya dadantii
           Ech703]
          Length = 343

 Score =  362 bits (930), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 166/343 (48%), Positives = 234/343 (68%), Gaps = 3/343 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNA-SILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGF 59
           M K    +++    LF  +   +A + L  I+K+GF++CGI+ GL GF+   A G + G 
Sbjct: 3   MKKVIMSTLVAGASLFALANQAHAGATLDAIQKKGFVQCGISDGLPGFSYADAGGKYTGI 62

Query: 60  DVDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFR 119
           DVD CR +++A+F D +K++Y PL AKERF ALQS ++DILSRNT WT  R+  +GL F 
Sbjct: 63  DVDVCRGVAAAVFGDANKVKYTPLTAKERFTALQSGEVDILSRNTTWTSSRDGGMGLLFT 122

Query: 120 PITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERV 179
            +TY+DG GF+ H K G+ S  +L GA++C+QAGT TEL +ADYFK +NMKY P+ F+R 
Sbjct: 123 GVTYYDGIGFLTHNKAGLKSAKELDGATVCIQAGTDTELNVADYFKTNNMKYTPVTFDRS 182

Query: 180 EEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYN 239
           +E   A  + RCD    D S LYAL++   +P+E V+LP++ISK PL P + +GD +W+ 
Sbjct: 183 DESAKALDSGRCDTLASDQSQLYALRIKLGKPTEFVVLPEVISKEPLGPVVRRGDEDWFA 242

Query: 240 IVSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRI 299
           IV WT +AM+ AEE+GIT KN++ ++   T PD+   LG  K  N G+ L L  DW Y+I
Sbjct: 243 IVRWTLFAMLNAEEMGITSKNVDALAAKPTTPDMAHLLG--KEGNFGKDLKLPNDWAYKI 300

Query: 300 IRHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           ++ +GNYGE+F+RN+G  SELKI RG N LW+KGG+ YAP +R
Sbjct: 301 VKQVGNYGEVFERNVGQGSELKIKRGLNELWNKGGIQYAPAVR 343


>gi|54309363|ref|YP_130383.1| putative amino acid ABC transporter, periplasmic amino acid-binding
           protein [Photobacterium profundum SS9]
 gi|46913799|emb|CAG20581.1| putative amino acid ABC transporter, periplasmic amino acid-binding
           protein [Photobacterium profundum SS9]
          Length = 342

 Score =  362 bits (928), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 160/338 (47%), Positives = 235/338 (69%), Gaps = 3/338 (0%)

Query: 5   FFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFC 64
              +I     LF  + S   + L  + K+G+++CG++ GL GF+   + G+W+G DV+FC
Sbjct: 8   LLAAIATTSALFAVNASAANTTLEKVMKQGYVQCGVSAGLPGFSNPNSKGEWEGLDVEFC 67

Query: 65  RALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYF 124
           +A+++A   D +K++Y+PL AKERF ALQS +ID+LSRNT WTL R+ +LGL F  ++Y+
Sbjct: 68  QAIAAATVGDKTKVKYIPLTAKERFTALQSGEIDVLSRNTTWTLHRDSALGLNFAGVSYY 127

Query: 125 DGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDA 184
           DGQGF++ K+ G+SS  +L GA++CVQ+GTTTEL LADYF+ + MKY P+VF+   +   
Sbjct: 128 DGQGFMVKKELGVSSAKELDGAAVCVQSGTTTELNLADYFRVNGMKYSPVVFDTAPQTSK 187

Query: 185 AYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWT 244
            + + RCD  T D S LYAL+L    P+  V+LP++ISK PL P + QGD +W+NIV WT
Sbjct: 188 GFDSGRCDVLTTDQSGLYALRLNLADPASAVVLPEVISKEPLGPVVRQGDDQWFNIVKWT 247

Query: 245 HYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMG 304
             AM+ AEE G+T  N++++ K++ +P+++R +G+D     G+ LGL  DW Y+I++ +G
Sbjct: 248 LSAMLNAEEYGVTSANVDKM-KESKDPNIRRLIGLDGPK--GKGLGLNDDWGYQIVKQVG 304

Query: 305 NYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           NYGE F+R +G  S LKI RG NALW  GG+ YA PIR
Sbjct: 305 NYGESFERTVGTGSPLKIERGLNALWKDGGIQYAAPIR 342


>gi|147674492|ref|YP_001216921.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Vibrio cholerae O395]
 gi|262169332|ref|ZP_06037024.1| amino acid ABC transporter amino acid-binding protein [Vibrio
           cholerae RC27]
 gi|146316375|gb|ABQ20914.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Vibrio cholerae O395]
 gi|227013279|gb|ACP09489.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Vibrio cholerae O395]
 gi|262022145|gb|EEY40854.1| amino acid ABC transporter amino acid-binding protein [Vibrio
           cholerae RC27]
          Length = 342

 Score =  362 bits (928), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 162/318 (50%), Positives = 226/318 (71%), Gaps = 3/318 (0%)

Query: 25  SILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLN 84
           S L  +  +GF+ CG++TGL GF+   A G+W+G DV++C+A+++A+  D +K++++PL 
Sbjct: 28  STLDKVLSQGFITCGVSTGLPGFSNPNAKGEWEGIDVEYCQAMAAAVLGDKTKVKFVPLT 87

Query: 85  AKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLS 144
           AKERF ALQS +ID+LSRNT WTL R+ +LGL F  + Y+DGQGF++ K  G+ S  +L+
Sbjct: 88  AKERFTALQSGEIDVLSRNTTWTLQRDSALGLNFVGVNYYDGQGFMVKKDLGVKSAKELN 147

Query: 145 GASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYAL 204
           GAS+CVQ+GTTTEL LADYF+   M Y P+VF+   +    + A RCD  T D S LYAL
Sbjct: 148 GASVCVQSGTTTELNLADYFRNSGMTYKPVVFDTAAQTSKGFDAGRCDVLTTDQSGLYAL 207

Query: 205 KLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQV 264
           +L  ++P   V+LP+IISK PL P + Q D +W+N+  W  YAMV AEE GIT KN++++
Sbjct: 208 RLNLEKPDSAVVLPEIISKEPLGPVVRQDDDKWFNVAKWVLYAMVNAEEYGITSKNVDEM 267

Query: 265 SKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPR 324
            K + NP+V+R LG+D     G  LG+  D +Y+I++ +GNYGE FDR +G+ S LKI R
Sbjct: 268 MK-SDNPEVKRILGLDGPK--GTGLGIRDDCSYQIVKQVGNYGESFDRTVGSGSPLKIDR 324

Query: 325 GYNALWSKGGLMYAPPIR 342
           G NALW+ GG MYAPPIR
Sbjct: 325 GVNALWNAGGFMYAPPIR 342


>gi|306841324|ref|ZP_07474033.1| amino-acid ABC transporter-binding protein yhdW precursor [Brucella
           sp. BO2]
 gi|306288627|gb|EFM59963.1| amino-acid ABC transporter-binding protein yhdW precursor [Brucella
           sp. BO2]
          Length = 339

 Score =  362 bits (928), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 167/342 (48%), Positives = 228/342 (66%), Gaps = 3/342 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           M K  + ++L             A  L  +K+RG + CG++ G+ GF+     G W GFD
Sbjct: 1   MKKTVWGALLAAGFALSVQGGAAADTLSTVKERGKVNCGVSQGVAGFSSPDDQGKWTGFD 60

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
           +DFCRA+S+A+F DP K+ ++PL+ KERF ALQS  +D+LSR T WTL R+  +G+ F  
Sbjct: 61  IDFCRAVSAAVFGDPDKVSFIPLSTKERFTALQSGTVDLLSRQTTWTLSRDAGMGIHFVG 120

Query: 121 ITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVE 180
             Y+DGQGF++ K  G+ S  +L GASIC + GTTTE  +ADYF AHN+KY P+V +  +
Sbjct: 121 TAYYDGQGFMIRKDLGVDSALKLDGASICTEQGTTTEQNVADYFGAHNIKYEPVVIDSAD 180

Query: 181 EIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNI 240
            I  A+   RCD YT D SALYA +L    P  +++LP++ISK PL PA+ QGD +W+NI
Sbjct: 181 GILKAFETGRCDVYTTDASALYAQRLKLAEPDAYMVLPEVISKEPLGPAVRQGDDKWFNI 240

Query: 241 VSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRII 300
           V WT +A++ AEELGITQK + +   D+  PDV+RFLG +  +  G+ LGL   W Y I+
Sbjct: 241 VRWTLFALLEAEELGITQKTV-EADLDSRKPDVRRFLGSEGDN--GQQLGLEPKWAYNIV 297

Query: 301 RHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
             +GNYGEMF+R +G  S LKI RG NALW+KGGLMYAPP++
Sbjct: 298 ASVGNYGEMFERTIGEGSLLKINRGINALWNKGGLMYAPPVK 339


>gi|39937855|ref|NP_950131.1| ABC transporter amino acid binding protein [Rhodopseudomonas
           palustris CGA009]
 gi|39651715|emb|CAE30237.1| ABC transporter, amino acid binding protein [Rhodopseudomonas
           palustris CGA009]
          Length = 344

 Score =  362 bits (928), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 164/311 (52%), Positives = 226/311 (72%), Gaps = 6/311 (1%)

Query: 32  KRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERFLA 91
           +R  + CG+N GL GF+     G+W GFDVDFCRA+++AIFDDP+K+Q++PL+A ERF  
Sbjct: 40  RRDAVLCGVNKGLPGFSTPDDKGNWTGFDVDFCRAVAAAIFDDPTKVQFVPLDANERFKE 99

Query: 92  LQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASICVQ 151
           LQS+++DILSRN+ W++ RE +  L F  + Y+DGQGF++   + I S  +L G+ +CVQ
Sbjct: 100 LQSRKVDILSRNSTWSMSRETNYDLYFPAVAYYDGQGFMVPASRKIDSAVELDGSKVCVQ 159

Query: 152 AGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTNDRP 211
            GTTT+L LADYF+A+NMKY  +  E+ +++  AY+  +CD +T D+S LYAL+ T ++ 
Sbjct: 160 NGTTTQLNLADYFRANNMKYQEVKSEKFDDVVKAYKDGQCDTFTADVSQLYALRKTFEKS 219

Query: 212 SEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTTNP 271
            +H+ILPD+ISK PLAP + Q D +W  IV WT YAM+ AEELGIT +NI +  K +  P
Sbjct: 220 GDHIILPDVISKEPLAPVVRQRDDDWMMIVKWTLYAMINAEELGITSQNIGEALK-SKKP 278

Query: 272 DVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNALWS 331
           DV R +G + +   GE LGL+KDW  RIIRH+GNYGE++DRN+G   +L IPRG N LWS
Sbjct: 279 DVMRLVGTEGA--FGEDLGLSKDWAARIIRHVGNYGEVYDRNVG---KLGIPRGLNQLWS 333

Query: 332 KGGLMYAPPIR 342
            GG+ YAPPIR
Sbjct: 334 NGGIQYAPPIR 344


>gi|260596110|ref|YP_003208681.1| putative amino-acid ABC transporter-binding protein yhdW
           [Cronobacter turicensis z3032]
 gi|260215287|emb|CBA27219.1| Putative amino-acid ABC transporter-binding protein yhdW
           [Cronobacter turicensis z3032]
          Length = 353

 Score =  361 bits (927), Expect = 8e-98,   Method: Compositional matrix adjust.
 Identities = 163/343 (47%), Positives = 233/343 (67%), Gaps = 3/343 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNA-SILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGF 59
           M K    ++     LF  +   +A + L  +KK+GF++CGI+ GL GF+   A G + G 
Sbjct: 13  MKKMMIATLAAAGTLFAVANQAHAGATLDSVKKKGFVQCGISDGLPGFSYADAGGKFTGI 72

Query: 60  DVDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFR 119
           DVD CR +++A+F D SK++Y PL AKERF ALQS ++D+LSRNT WT  R+  +G++F 
Sbjct: 73  DVDVCRGVAAAVFGDASKVKYTPLTAKERFTALQSGEVDVLSRNTTWTSSRDAGMGMSFT 132

Query: 120 PITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERV 179
            +TY+DG GF+ H K G+ S  +L GA++C+QAGT TEL +ADYFKA+NMKY P+ F+R 
Sbjct: 133 GVTYYDGIGFLTHNKAGLKSAKELDGATVCIQAGTDTELNVADYFKANNMKYTPVTFDRS 192

Query: 180 EEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYN 239
           +E   A  + RCD    D S LYAL++    P+E ++LP++ISK PL P + +GD EW++
Sbjct: 193 DESAKALESGRCDTLASDQSQLYALRIKLSNPAEWIVLPEVISKEPLGPVVRRGDEEWFS 252

Query: 240 IVSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRI 299
           IV WT +AM+ AEE+GI  KN++  + + + PD+   LG  K  + G+ L L   W Y I
Sbjct: 253 IVRWTLFAMLNAEEMGIDSKNVDAKAANPSTPDMAHLLG--KEGDYGKDLKLDNKWAYNI 310

Query: 300 IRHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           I+ +GNYGE+F+RN+G +S LKI RG N LW+KGG+ YAPP+R
Sbjct: 311 IKQVGNYGEIFERNVGQESPLKIKRGQNNLWNKGGIQYAPPVR 353


>gi|50119205|ref|YP_048372.1| general L-amino ABC transporter binding protein [Pectobacterium
           atrosepticum SCRI1043]
 gi|227114001|ref|ZP_03827657.1| general L-amino ABC transporter binding protein [Pectobacterium
           carotovorum subsp. brasiliensis PBR1692]
 gi|253686635|ref|YP_003015825.1| extracellular solute-binding protein family 3 [Pectobacterium
           carotovorum subsp. carotovorum PC1]
 gi|49609731|emb|CAG73165.1| general L-amino ABC transporter binding protein [Pectobacterium
           atrosepticum SCRI1043]
 gi|251753213|gb|ACT11289.1| extracellular solute-binding protein family 3 [Pectobacterium
           carotovorum subsp. carotovorum PC1]
          Length = 341

 Score =  361 bits (927), Expect = 8e-98,   Method: Compositional matrix adjust.
 Identities = 158/319 (49%), Positives = 227/319 (71%), Gaps = 2/319 (0%)

Query: 24  ASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPL 83
            + L  I+K+GF++CGI+ GL GF+   A+G + G DVD CR L++A+F D +K++Y PL
Sbjct: 25  GATLDAIQKKGFVQCGISDGLPGFSYADASGKYSGIDVDVCRGLAAAVFGDANKVKYTPL 84

Query: 84  NAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQL 143
            AKERF ALQS ++D+LSRNT WT  R+  +G+ F  +TY+DG GF+ H K G++S  +L
Sbjct: 85  TAKERFTALQSGEVDVLSRNTTWTSSRDGGMGMLFTGVTYYDGIGFLTHNKAGLTSAKEL 144

Query: 144 SGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYA 203
            GA++C+QAGT TEL +ADYFK H M+Y P+ F+R +E   A  + RCD    D S LYA
Sbjct: 145 DGATVCIQAGTDTELNVADYFKTHKMQYTPVTFDRSDESAKALESGRCDTLASDQSQLYA 204

Query: 204 LKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQ 263
           L++   +P+E ++LP++ISK PL P + +GD EW++IV WT +AM+ AEE+G+T KN++Q
Sbjct: 205 LRIKLSKPAEFIVLPEVISKEPLGPVVRRGDEEWFSIVRWTLFAMLNAEEMGVTSKNVDQ 264

Query: 264 VSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIP 323
           ++   T PD+   LG + S   G+ L L  DW ++II+ +GNYGE+F+RN+G  SELKI 
Sbjct: 265 LAAKPTTPDMSHLLGHEGS--YGKDLKLPNDWAFKIIKQVGNYGEIFERNVGMGSELKIK 322

Query: 324 RGYNALWSKGGLMYAPPIR 342
           RG N LW+KGG+ YAP +R
Sbjct: 323 RGLNELWNKGGIQYAPAVR 341


>gi|306846158|ref|ZP_07478720.1| amino-acid ABC transporter-binding protein yhdW precursor [Brucella
           sp. BO1]
 gi|306273409|gb|EFM55270.1| amino-acid ABC transporter-binding protein yhdW precursor [Brucella
           sp. BO1]
          Length = 339

 Score =  361 bits (926), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 167/342 (48%), Positives = 227/342 (66%), Gaps = 3/342 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           M K  + ++L             A  L  +K+RG + CG++ G+ GF+     G W GFD
Sbjct: 1   MKKTVWGALLAAGFALSAQGGAAADTLSTVKERGKVNCGVSQGVAGFSSPDDQGKWTGFD 60

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
           +DFCRA+S+A+F DP K+ ++PL+ KERF ALQS  +D+LSR T WTL R+  +G+ F  
Sbjct: 61  IDFCRAVSAAVFGDPDKVSFIPLSTKERFTALQSGTVDLLSRQTTWTLSRDAGMGIHFVG 120

Query: 121 ITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVE 180
             Y+DGQGF++ K  G+ S  +L GASIC + GTTTE  +ADYF AHN+KY P+V +  +
Sbjct: 121 TAYYDGQGFMIRKDLGVDSALKLDGASICTEQGTTTEQNVADYFGAHNIKYEPVVIDSAD 180

Query: 181 EIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNI 240
            I  A+   RCD YT D SALYA +L    P  +++LP++ISK PL PA+ QGD +W+NI
Sbjct: 181 GILKAFETGRCDVYTTDASALYAQRLKLAEPDAYMVLPEVISKEPLGPAVRQGDDKWFNI 240

Query: 241 VSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRII 300
           V WT +A++ AEELGITQK +     D+  PDV+RFLG +  +  G+ LGL   W Y I+
Sbjct: 241 VRWTLFALLEAEELGITQKTV-AADLDSRKPDVRRFLGSEGDN--GQQLGLEPKWAYNIV 297

Query: 301 RHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
             +GNYGEMF+R +G  S LKI RG NALW+KGGLMYAPP++
Sbjct: 298 ASVGNYGEMFERTIGEGSLLKINRGINALWNKGGLMYAPPVK 339


>gi|148252293|ref|YP_001236878.1| general L-amino acid-binding periplasmic protein [Bradyrhizobium
           sp. BTAi1]
 gi|146404466|gb|ABQ32972.1| amino acid ABC transporter substrate-binding protein, PAAT family
           [Bradyrhizobium sp. BTAi1]
          Length = 345

 Score =  361 bits (926), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 162/311 (52%), Positives = 226/311 (72%), Gaps = 3/311 (0%)

Query: 32  KRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERFLA 91
           +RG + CG+N GL GF+     G+W GFDVDFCRA+++AIFDDP K +++PL+A ERF  
Sbjct: 38  RRGEVLCGVNAGLPGFSIPDDKGNWTGFDVDFCRAVAAAIFDDPKKAKFVPLDANERFKE 97

Query: 92  LQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASICVQ 151
           LQS+++DILSRNT W++ RE +  L F  + Y+DGQGF++ + + + +   L+G+ +CVQ
Sbjct: 98  LQSRKVDILSRNTTWSMAREQNYDLYFPAVAYYDGQGFMVPRSRKLETALDLNGSKVCVQ 157

Query: 152 AGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTNDRP 211
             TT  L LADYF+A+NMKY  I F +++++  AY + +CD +T D+S LYAL+L   +P
Sbjct: 158 DSTTNALNLADYFRANNMKYEEIKFLKLDDVLKAYDSGKCDTFTADVSQLYALRLVLTKP 217

Query: 212 SEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTTNP 271
           ++H ILPD+ISK PLAP + Q D +W  IV WT YAM+ AEELG+T KNI++  K +  P
Sbjct: 218 NDHDILPDMISKEPLAPVVRQRDDDWMMIVKWTLYAMINAEELGVTSKNIDEALK-SKKP 276

Query: 272 DVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNALWS 331
           DV R +G       G+ LGL KDW  RIIRH+GNYGE+++RN+G++S+LKIPRG N LW+
Sbjct: 277 DVMRLVG--NEGTYGQDLGLAKDWAARIIRHVGNYGEVYERNIGSESKLKIPRGMNQLWN 334

Query: 332 KGGLMYAPPIR 342
            GG+ YAPPIR
Sbjct: 335 AGGIQYAPPIR 345


>gi|254720190|ref|ZP_05182001.1| amino-acid ABC transporter-binding protein yhdW precursor [Brucella
           sp. 83/13]
 gi|265985199|ref|ZP_06097934.1| extracellular solute-binding protein family 3 [Brucella sp. 83/13]
 gi|306838669|ref|ZP_07471505.1| amino-acid ABC transporter-binding protein yhdW precursor [Brucella
           sp. NF 2653]
 gi|264663791|gb|EEZ34052.1| extracellular solute-binding protein family 3 [Brucella sp. 83/13]
 gi|306406312|gb|EFM62555.1| amino-acid ABC transporter-binding protein yhdW precursor [Brucella
           sp. NF 2653]
          Length = 339

 Score =  360 bits (925), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 168/342 (49%), Positives = 227/342 (66%), Gaps = 3/342 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           M K  + ++L             A  L  +K+RG + CG++ G+ GF+     G W GFD
Sbjct: 1   MKKTVWGALLAAGFALSAQGGAAADTLSTVKERGKVNCGVSQGVAGFSSPDDQGKWTGFD 60

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
           +DFCRA+S+A+F DP K+ ++PL+ KERF ALQS  +D+LSR T WTL R+  LG+ F  
Sbjct: 61  IDFCRAVSAAVFGDPDKVSFIPLSTKERFTALQSGTVDLLSRQTTWTLSRDAGLGIHFVG 120

Query: 121 ITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVE 180
             Y+DGQGF++ K  G+ S  +L GASIC + GTTTE  +ADYF AHN+KY P+V +  +
Sbjct: 121 TAYYDGQGFMIRKDLGVDSALKLDGASICTEQGTTTEQNVADYFGAHNIKYEPVVIDSAD 180

Query: 181 EIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNI 240
            I  A+   RCD YT D SALYA +L    P  +++LP++ISK PL PA+ QGD +W+NI
Sbjct: 181 GILKAFETGRCDVYTTDASALYAQRLKLAEPEAYMVLPEVISKEPLGPAVRQGDDKWFNI 240

Query: 241 VSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRII 300
           V WT +A++ AEELGITQK +     D+  PDV+RFLG +  +  G+ LGL   W Y I+
Sbjct: 241 VRWTLFALLEAEELGITQKTV-AADLDSRKPDVRRFLGSEGDN--GQQLGLEPKWAYNIV 297

Query: 301 RHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
             +GNYGEMF+R +G  S LKI RG NALW+KGGLMYAPP++
Sbjct: 298 ALVGNYGEMFERTIGEGSLLKINRGINALWNKGGLMYAPPVK 339


>gi|256111139|ref|ZP_05452175.1| amino-acid ABC transporter-binding protein yhdW precursor [Brucella
           melitensis bv. 3 str. Ether]
 gi|265992652|ref|ZP_06105209.1| extracellular solute-binding protein [Brucella melitensis bv. 3
           str. Ether]
 gi|262763522|gb|EEZ09554.1| extracellular solute-binding protein [Brucella melitensis bv. 3
           str. Ether]
          Length = 339

 Score =  360 bits (925), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 167/342 (48%), Positives = 227/342 (66%), Gaps = 3/342 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           M K  + ++L             A  L  +K+RG + CGI+ G+ GF+     G W GFD
Sbjct: 1   MKKTVWGALLAAGFALSAQGGAAADTLSTVKERGKVNCGISQGVAGFSSPDDQGKWTGFD 60

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
           +DFCRA+S+A+F DP K+ ++PL+ KERF ALQS  +D+LSR T WTL R+  +G+ F  
Sbjct: 61  IDFCRAVSAAVFGDPDKVSFIPLSTKERFTALQSGTVDLLSRQTTWTLSRDAGMGIHFVG 120

Query: 121 ITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVE 180
             Y+DGQGF++ K  G+ S  +L GASIC + GTTTE  +ADYF AHN+KY P+V +  +
Sbjct: 121 TAYYDGQGFMIRKDLGVDSALKLDGASICTEQGTTTEQNVADYFGAHNIKYEPVVIDSAD 180

Query: 181 EIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNI 240
            I  A+   RCD YT D SALYA +L    P  +++LP++ISK PL PA+ QGD +W+NI
Sbjct: 181 GILKAFETGRCDVYTTDASALYAQRLKLAEPDAYMVLPEVISKEPLGPAVRQGDDKWFNI 240

Query: 241 VSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRII 300
           V WT +A++ AEELGITQK +     D+  PD++RFLG +  +  G+ LGL   W Y I+
Sbjct: 241 VRWTLFALLEAEELGITQKTV-AADLDSRKPDIRRFLGSEGDN--GQQLGLEPKWAYNIV 297

Query: 301 RHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
             +GNYGEMF+R +G  S LKI RG NALW+KGGLMYAPP++
Sbjct: 298 ASVGNYGEMFERTIGEGSLLKINRGINALWNKGGLMYAPPVK 339


>gi|85714820|ref|ZP_01045806.1| extracellular solute-binding protein, family 3 [Nitrobacter sp.
           Nb-311A]
 gi|85698306|gb|EAQ36177.1| extracellular solute-binding protein, family 3 [Nitrobacter sp.
           Nb-311A]
          Length = 345

 Score =  360 bits (925), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 161/311 (51%), Positives = 221/311 (71%), Gaps = 3/311 (0%)

Query: 32  KRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERFLA 91
           +R  + CG+N G+ GF+     G+W GFDVDFCRA+++AIFDDP+K++++PL + ERF  
Sbjct: 38  RRDAVLCGVNAGVPGFSNSDEKGNWSGFDVDFCRAVAAAIFDDPAKVKFVPLESDERFKE 97

Query: 92  LQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASICVQ 151
           LQS+++DIL+RN+ W++ RE +  L F  + Y+DG+GF++   +   S   L    ICVQ
Sbjct: 98  LQSRKVDILARNSTWSMSRETNYNLYFPAVAYYDGEGFMVRTSRKADSALDLGDTKICVQ 157

Query: 152 AGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTNDRP 211
             TTT+L LADYFKA+N+KY  I F ++E++  AY   +CD  T D+S LYAL+L   +P
Sbjct: 158 DSTTTKLNLADYFKANNLKYEEIKFGKLEDMLRAYDEAKCDVLTADVSHLYALRLRLTKP 217

Query: 212 SEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTTNP 271
           +E  ILPD+ISK PLAP + Q D +W  I+ WT YAM+ AEELG+T KNI++  K +  P
Sbjct: 218 NESFILPDVISKEPLAPVVRQRDDDWMMIIKWTLYAMINAEELGVTSKNIDEAMK-SKKP 276

Query: 272 DVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNALWS 331
           DV R +G D     GE LGLTKDW  RI+RH+GNYGE++DRN+G+ S LKIPRG N LW+
Sbjct: 277 DVMRLVGTD--GQYGEGLGLTKDWAARIVRHVGNYGEVYDRNIGSDSRLKIPRGLNQLWN 334

Query: 332 KGGLMYAPPIR 342
            GG+MYAPP+R
Sbjct: 335 AGGIMYAPPLR 345


>gi|146313341|ref|YP_001178415.1| extracellular solute-binding protein [Enterobacter sp. 638]
 gi|145320217|gb|ABP62364.1| amino acid ABC transporter substrate-binding protein, PAAT family
           [Enterobacter sp. 638]
          Length = 341

 Score =  360 bits (925), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 163/343 (47%), Positives = 232/343 (67%), Gaps = 3/343 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNA-SILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGF 59
           M K    S+    +LF  +   +A + L  +KK+GF++CGI+ GL GF+   ANG + G 
Sbjct: 1   MKKTMIASLAAAGMLFAVAGQAHAGATLDAVKKKGFVQCGISDGLPGFSYADANGKFSGI 60

Query: 60  DVDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFR 119
           DVD CR +++A+F D +K++Y PL AKERF ALQS ++D+LSRNT WT  R+  +G+ F 
Sbjct: 61  DVDVCRGVAAALFGDDTKVKYTPLTAKERFTALQSGEVDVLSRNTTWTSSRDAGMGMTFT 120

Query: 120 PITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERV 179
            +TY+DG GF+ H K G+ S  +L GA++C+QAGT TEL +ADYFKA+ MKY P+ F+R 
Sbjct: 121 GVTYYDGIGFLTHNKAGLKSAKELDGATVCIQAGTDTELNVADYFKANKMKYTPVTFDRS 180

Query: 180 EEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYN 239
           +E   A  + RCD    D S LYAL++    P+E ++LP++ISK PL P + +GD EW +
Sbjct: 181 DESAKALESGRCDTLASDQSQLYALRIKLSNPAEWIVLPEVISKEPLGPVVRRGDEEWTS 240

Query: 240 IVSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRI 299
           IV WT +AM+ AEE+GI  KN+++ +   + PD+   LG  K  + G+ L L   W Y I
Sbjct: 241 IVKWTLFAMLNAEEMGINSKNVDEKAAAPSTPDMAHLLG--KEGDYGKDLKLDNKWAYNI 298

Query: 300 IRHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           I+H+GNYGE+F RN+G++S LKI RG N LW+ GG+ YAPP+R
Sbjct: 299 IKHVGNYGEIFARNVGSESPLKIKRGQNNLWNNGGIQYAPPVR 341


>gi|328543624|ref|YP_004303733.1| Amino acid ABC transporter, periplasmic amino acid-binding protein
           [Polymorphum gilvum SL003B-26A1]
 gi|326413367|gb|ADZ70430.1| Amino acid ABC transporter, periplasmic amino acid-binding protein
           [Polymorphum gilvum SL003B-26A1]
          Length = 300

 Score =  360 bits (925), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 161/303 (53%), Positives = 220/303 (72%), Gaps = 3/303 (0%)

Query: 40  INTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDI 99
           ++ GL GF+   A G+W G DVD CRA+++A+F D S +++ PL+AKERF ALQS +IDI
Sbjct: 1   MSQGLPGFSNPDAQGNWTGLDVDVCRAVAAAVFGDASAVKFTPLSAKERFTALQSGEIDI 60

Query: 100 LSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELT 159
           LSRNT WT+ R+ SLGL F  +TY+DGQGF++ K  G++S  +LSGAS+C   GTTTEL 
Sbjct: 61  LSRNTTWTMSRDTSLGLNFAGVTYYDGQGFMVRKALGVTSALELSGASVCTNTGTTTELN 120

Query: 160 LADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPD 219
           +ADYF+ +NM Y  + FE+ +E+  AY A RCD +T D S LYA +L    P +H++LP+
Sbjct: 121 VADYFRTNNMPYEIVAFEKSDEVVQAYDAGRCDVFTTDASGLYAERLKLSNPGDHMVLPE 180

Query: 220 IISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGI 279
           IISK PL P + QGD +W+NI  WT  AM+ AEELG+T  N++++ K + NP+++R LGI
Sbjct: 181 IISKEPLGPVVRQGDDQWFNIARWTLNAMINAEELGVTSANVDEM-KSSENPEIKRLLGI 239

Query: 280 DKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAP 339
           + +   GE + L+ DW Y II+ +GNYGE FDRN+G  + L I RG NALWSKGG++YAP
Sbjct: 240 EGA--FGEGVSLSNDWAYNIIKQVGNYGEAFDRNVGPDTPLGIARGLNALWSKGGILYAP 297

Query: 340 PIR 342
           PIR
Sbjct: 298 PIR 300


>gi|229523536|ref|ZP_04412941.1| amino acid ABC transporter amino acid-binding protein [Vibrio
           cholerae bv. albensis VL426]
 gi|229337117|gb|EEO02134.1| amino acid ABC transporter amino acid-binding protein [Vibrio
           cholerae bv. albensis VL426]
          Length = 342

 Score =  360 bits (925), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 162/318 (50%), Positives = 223/318 (70%), Gaps = 3/318 (0%)

Query: 25  SILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLN 84
           S L  +  +GF+ CG++TGL GF+   A G+W+G DV++C+A+++A+  D +K++++PL 
Sbjct: 28  STLDKVLSQGFITCGVSTGLPGFSNPNAKGEWEGIDVEYCQAMAAAVLGDKTKVKFVPLT 87

Query: 85  AKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLS 144
           AKERF ALQS +ID+LSRNT WTL R+ +LG  F  + Y+DGQGF++ K  G+ S  +L+
Sbjct: 88  AKERFTALQSGEIDVLSRNTTWTLQRDSALGRNFVGVNYYDGQGFMVKKDLGVKSAKELN 147

Query: 145 GASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYAL 204
           GAS+CVQ+GTTTEL LADYF+   M Y P+VF+   +    + A RCD  T D S LYAL
Sbjct: 148 GASVCVQSGTTTELNLADYFRNSGMTYKPVVFDTAAQTSKGFDAGRCDVLTTDQSGLYAL 207

Query: 205 KLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQV 264
           +L  ++P   V+LP+IISK PL P + Q D +W+N+  W  YAMV AEE GIT KN++++
Sbjct: 208 RLNLEKPDSAVVLPEIISKEPLGPVVRQDDDKWFNVAKWVLYAMVNAEEYGITSKNVDEM 267

Query: 265 SKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPR 324
            K + NP+V R LG D     G  LG+  DW+Y+I++ +GNYGE FDR +G  S LKI R
Sbjct: 268 MK-SDNPEVMRILGRDGPK--GTGLGIRDDWSYQIVKQVGNYGESFDRTVGAGSPLKIDR 324

Query: 325 GYNALWSKGGLMYAPPIR 342
           G NALW+ GG MYAPPIR
Sbjct: 325 GVNALWNAGGFMYAPPIR 342


>gi|296104983|ref|YP_003615129.1| general L-amino acid transport system substrate-binding protein
           [Enterobacter cloacae subsp. cloacae ATCC 13047]
 gi|295059442|gb|ADF64180.1| general L-amino acid transport system substrate-binding protein
           [Enterobacter cloacae subsp. cloacae ATCC 13047]
          Length = 341

 Score =  360 bits (924), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 161/343 (46%), Positives = 235/343 (68%), Gaps = 3/343 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNA-SILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGF 59
           M K    S+    +LF  +   +A + L  +KK+GF++CGI+ GL GF+   ANG + G 
Sbjct: 1   MKKTMIASLAAAGMLFAVAGQAHAGTTLDAVKKKGFVQCGISDGLPGFSYADANGKFTGI 60

Query: 60  DVDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFR 119
           DVD CR +++A+F D SK++Y PL AKERF ALQS ++D+LSRNT WT  R+  +G++F 
Sbjct: 61  DVDVCRGVAAAVFGDDSKVKYTPLTAKERFTALQSGEVDMLSRNTTWTSSRDAGMGMSFT 120

Query: 120 PITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERV 179
            +TY+DG GF+ H K G+ S  +L GA++C+QAGT TEL +ADYFKA+NMKY P+ F+R 
Sbjct: 121 GVTYYDGIGFLTHNKAGLKSAKELDGATVCIQAGTDTELNVADYFKANNMKYTPVTFDRS 180

Query: 180 EEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYN 239
           +E   A  + RCD    D S LYAL++    P+E ++LP++ISK PL P + +GD +W++
Sbjct: 181 DESAKALESGRCDTLASDQSQLYALRIKLSNPAEWIVLPEVISKEPLGPVVRRGDEDWFS 240

Query: 240 IVSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRI 299
           IV WT +AM+ AEE+GI+ KN+++ +   + PD+   LG +   + G+ L L   W Y I
Sbjct: 241 IVRWTLFAMLNAEEMGISSKNVDEKAAKPSTPDMAHLLGTE--GDFGKDLKLDNKWAYHI 298

Query: 300 IRHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           I+ +GNY E+F+RN+G++S LKI RG N LW+ GG+ YAPP+R
Sbjct: 299 IKQVGNYAEIFERNVGSESPLKIKRGQNNLWNNGGIQYAPPVR 341


>gi|148557994|ref|YP_001257868.1| amino acid ABC transporter periplasmic amino acid-binding protein
           [Brucella ovis ATCC 25840]
 gi|225629405|ref|ZP_03787438.1| amino-acid ABC transporter-binding protein yhdW precursor [Brucella
           ceti str. Cudo]
 gi|225686709|ref|YP_002734681.1| amino-acid ABC transporter-binding protein yhdW [Brucella
           melitensis ATCC 23457]
 gi|254705588|ref|ZP_05167416.1| amino-acid ABC transporter-binding protein yhdW precursor [Brucella
           pinnipedialis M163/99/10]
 gi|254710821|ref|ZP_05172632.1| amino-acid ABC transporter-binding protein yhdW precursor [Brucella
           pinnipedialis B2/94]
 gi|256015709|ref|YP_003105718.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Brucella microti CCM 4915]
 gi|256043818|ref|ZP_05446739.1| amino-acid ABC transporter-binding protein yhdW precursor [Brucella
           melitensis bv. 1 str. Rev.1]
 gi|256058889|ref|ZP_05449103.1| amino-acid ABC transporter-binding protein yhdW precursor [Brucella
           neotomae 5K33]
 gi|256157396|ref|ZP_05455314.1| amino-acid ABC transporter-binding protein yhdW precursor [Brucella
           ceti M490/95/1]
 gi|256253625|ref|ZP_05459161.1| amino-acid ABC transporter-binding protein yhdW precursor [Brucella
           ceti B1/94]
 gi|256262158|ref|ZP_05464690.1| solute-binding protein/glutamate receptor [Brucella melitensis bv.
           2 str. 63/9]
 gi|260167705|ref|ZP_05754516.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Brucella sp. F5/99]
 gi|260564999|ref|ZP_05835484.1| solute-binding protein/glutamate receptor [Brucella melitensis bv.
           1 str. 16M]
 gi|261220761|ref|ZP_05935042.1| extracellular solute-binding protein [Brucella ceti B1/94]
 gi|261312993|ref|ZP_05952190.1| extracellular solute-binding protein family 3 [Brucella
           pinnipedialis M163/99/10]
 gi|261318389|ref|ZP_05957586.1| extracellular solute-binding protein family 3 [Brucella
           pinnipedialis B2/94]
 gi|261322825|ref|ZP_05962022.1| extracellular solute-binding protein [Brucella neotomae 5K33]
 gi|261757141|ref|ZP_06000850.1| solute-binding protein/glutamate receptor [Brucella sp. F5/99]
 gi|265990242|ref|ZP_06102799.1| extracellular solute-binding protein family 3 [Brucella melitensis
           bv. 1 str. Rev.1]
 gi|265995884|ref|ZP_06108441.1| extracellular solute-binding protein [Brucella ceti M490/95/1]
 gi|294853902|ref|ZP_06794574.1| general L-amino acid transport system substrate-binding protein
           [Brucella sp. NVSL 07-0026]
 gi|148369279|gb|ABQ62151.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Brucella ovis ATCC 25840]
 gi|225615901|gb|EEH12950.1| amino-acid ABC transporter-binding protein yhdW precursor [Brucella
           ceti str. Cudo]
 gi|225642814|gb|ACO02727.1| amino-acid ABC transporter-binding protein yhdW precursor [Brucella
           melitensis ATCC 23457]
 gi|255998369|gb|ACU50056.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Brucella microti CCM 4915]
 gi|260152642|gb|EEW87735.1| solute-binding protein/glutamate receptor [Brucella melitensis bv.
           1 str. 16M]
 gi|260919345|gb|EEX85998.1| extracellular solute-binding protein [Brucella ceti B1/94]
 gi|261297612|gb|EEY01109.1| extracellular solute-binding protein family 3 [Brucella
           pinnipedialis B2/94]
 gi|261298805|gb|EEY02302.1| extracellular solute-binding protein [Brucella neotomae 5K33]
 gi|261302019|gb|EEY05516.1| extracellular solute-binding protein family 3 [Brucella
           pinnipedialis M163/99/10]
 gi|261737125|gb|EEY25121.1| solute-binding protein/glutamate receptor [Brucella sp. F5/99]
 gi|262550181|gb|EEZ06342.1| extracellular solute-binding protein [Brucella ceti M490/95/1]
 gi|263000911|gb|EEZ13601.1| extracellular solute-binding protein family 3 [Brucella melitensis
           bv. 1 str. Rev.1]
 gi|263091858|gb|EEZ16180.1| solute-binding protein/glutamate receptor [Brucella melitensis bv.
           2 str. 63/9]
 gi|294819557|gb|EFG36557.1| general L-amino acid transport system substrate-binding protein
           [Brucella sp. NVSL 07-0026]
 gi|326411105|gb|ADZ68169.1| amino-acid ABC transporter-binding protein yhdW [Brucella
           melitensis M28]
 gi|326554396|gb|ADZ89035.1| amino-acid ABC transporter-binding protein yhdW [Brucella
           melitensis M5-90]
          Length = 339

 Score =  360 bits (924), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 166/342 (48%), Positives = 227/342 (66%), Gaps = 3/342 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           M K  + ++L             A  L  +K+RG + CG++ G+ GF+     G W GFD
Sbjct: 1   MKKTVWGALLAAGFALSAQGGAAADTLSTVKERGKVNCGVSQGVAGFSSPDDQGKWTGFD 60

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
           +DFCRA+S+A+F DP K+ ++PL+ KERF ALQS  +D+LSR T WTL R+  +G+ F  
Sbjct: 61  IDFCRAVSAAVFGDPDKVSFIPLSTKERFTALQSGTVDLLSRQTTWTLSRDAGMGIHFVG 120

Query: 121 ITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVE 180
             Y+DGQGF++ K  G+ S  +L GASIC + GTTTE  +ADYF AHN+KY P+V +  +
Sbjct: 121 TAYYDGQGFMIRKDLGVDSALKLDGASICTEQGTTTEQNVADYFGAHNIKYEPVVIDSAD 180

Query: 181 EIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNI 240
            I  A+   RCD YT D SALYA +L    P  +++LP++ISK PL PA+ QGD +W+NI
Sbjct: 181 GILKAFETGRCDVYTTDASALYAQRLKLAEPDAYMVLPEVISKEPLGPAVRQGDDKWFNI 240

Query: 241 VSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRII 300
           V WT +A++ AEELGITQK +     D+  PD++RFLG +  +  G+ LGL   W Y I+
Sbjct: 241 VRWTLFALLEAEELGITQKTV-AADLDSRKPDIRRFLGSEGDN--GQQLGLEPKWAYNIV 297

Query: 301 RHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
             +GNYGEMF+R +G  S LKI RG NALW+KGGLMYAPP++
Sbjct: 298 ASVGNYGEMFERTIGEGSLLKINRGINALWNKGGLMYAPPVK 339


>gi|254700150|ref|ZP_05161978.1| hypothetical protein Bsuib55_04721 [Brucella suis bv. 5 str. 513]
 gi|261750642|ref|ZP_05994351.1| extracellular solute-binding protein family 3 [Brucella suis bv. 5
           str. 513]
 gi|261740395|gb|EEY28321.1| extracellular solute-binding protein family 3 [Brucella suis bv. 5
           str. 513]
          Length = 339

 Score =  360 bits (924), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 166/342 (48%), Positives = 227/342 (66%), Gaps = 3/342 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           M K  + ++L             A  L  +K+RG + CG++ G+ GF+     G W GFD
Sbjct: 1   MKKAVWGALLAAGFALSAQGGAAADTLSTVKERGKVNCGVSQGVAGFSSPDDQGKWTGFD 60

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
           +DFCRA+S+A+F DP K+ ++PL+ KERF ALQS  +D+LSR T WTL R+  +G+ F  
Sbjct: 61  IDFCRAVSAAVFGDPDKVSFIPLSTKERFTALQSGAVDLLSRQTTWTLSRDAGMGIHFVG 120

Query: 121 ITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVE 180
             Y+DGQGF++ K  G+ S  +L GASIC + GTTTE  +ADYF AHN+KY P+V +  +
Sbjct: 121 TAYYDGQGFMIRKDLGVDSALKLDGASICTEQGTTTEQNVADYFGAHNIKYEPVVIDSAD 180

Query: 181 EIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNI 240
            I  A+   RCD YT D SALYA +L    P  +++LP++ISK PL PA+ QGD +W+NI
Sbjct: 181 GILKAFETGRCDVYTTDASALYAQRLKLAEPDAYMVLPEVISKEPLGPAVRQGDDKWFNI 240

Query: 241 VSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRII 300
           V WT +A++ AEELGITQK +     D+  PD++RFLG +  +  G+ LGL   W Y I+
Sbjct: 241 VRWTLFALLEAEELGITQKTV-AADLDSRKPDIRRFLGSEGDN--GQQLGLEPKWAYNIV 297

Query: 301 RHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
             +GNYGEMF+R +G  S LKI RG NALW+KGGLMYAPP++
Sbjct: 298 ASVGNYGEMFERTIGEGSLLKINRGINALWNKGGLMYAPPVK 339


>gi|23500674|ref|NP_700114.1| amino acid ABC transporter periplasmic amino acid-binding protein
           [Brucella suis 1330]
 gi|163845062|ref|YP_001622717.1| hypothetical protein BSUIS_B0940 [Brucella suis ATCC 23445]
 gi|23464321|gb|AAN34119.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Brucella suis 1330]
 gi|163675785|gb|ABY39895.1| Hypothetical protein, conserved [Brucella suis ATCC 23445]
          Length = 339

 Score =  360 bits (924), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 166/342 (48%), Positives = 227/342 (66%), Gaps = 3/342 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           M K  + ++L             A  L  +K+RG + CG++ G+ GF+     G W GFD
Sbjct: 1   MKKAVWGALLAAGFALSAQGGAAADTLSTVKERGKVNCGVSQGVAGFSSPDDQGKWTGFD 60

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
           +DFCRA+S+A+F DP K+ ++PL+ KERF ALQS  +D+LSR T WTL R+  +G+ F  
Sbjct: 61  IDFCRAVSAAVFGDPDKVSFIPLSTKERFTALQSGTVDLLSRQTTWTLSRDAGMGIHFVG 120

Query: 121 ITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVE 180
             Y+DGQGF++ K  G+ S  +L GASIC + GTTTE  +ADYF AHN+KY P+V +  +
Sbjct: 121 TAYYDGQGFMIRKDLGVDSALKLDGASICTEQGTTTEQNVADYFGAHNIKYEPVVIDSAD 180

Query: 181 EIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNI 240
            I  A+   RCD YT D SALYA +L    P  +++LP++ISK PL PA+ QGD +W+NI
Sbjct: 181 GILKAFETGRCDVYTTDASALYAQRLKLAEPDAYMVLPEVISKEPLGPAVRQGDDKWFNI 240

Query: 241 VSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRII 300
           V WT +A++ AEELGITQK +     D+  PD++RFLG +  +  G+ LGL   W Y I+
Sbjct: 241 VRWTLFALLEAEELGITQKTV-AADLDSRKPDIRRFLGSEGDN--GQQLGLEPKWAYNIV 297

Query: 301 RHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
             +GNYGEMF+R +G  S LKI RG NALW+KGGLMYAPP++
Sbjct: 298 ASVGNYGEMFERTIGEGSLLKINRGINALWNKGGLMYAPPVK 339


>gi|51245286|ref|YP_065170.1| amino acid ABC transporter, periplasmic substrate-binding protein
           [Desulfotalea psychrophila LSv54]
 gi|50876323|emb|CAG36163.1| probable amino acid ABC transporter, periplasmic substrate-binding
           protein [Desulfotalea psychrophila LSv54]
          Length = 339

 Score =  360 bits (924), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 162/322 (50%), Positives = 231/322 (71%), Gaps = 3/322 (0%)

Query: 21  STNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQY 80
           + +A+ L  +K++G++  G++  ++GF+   + G W+G DVDF RA++SAIFDDP+K ++
Sbjct: 21  TVSATTLDVVKEKGYVNAGVSGKVIGFSAPDSQGVWRGMDVDFVRAVASAIFDDPNKARF 80

Query: 81  LPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSV 140
            P+  KE F ALQS +I+IL+RNT WT  R+  LGL F    ++DGQGF++HK  G+ S 
Sbjct: 81  TPVAFKEAFAALQSGEIEILARNTTWTFQRDTKLGLEFVGPLFYDGQGFLVHKDLGVKSA 140

Query: 141 SQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISA 200
            +L GAS+C Q+GTTTEL +ADYF +H M Y P+V+E  +E    Y   RCD YT D SA
Sbjct: 141 LELDGASVCTQSGTTTELNMADYFASHGMTYLPVVYESADEATVIYDTGRCDVYTTDSSA 200

Query: 201 LYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKN 260
           L A +     P +H ILP+IISK PL PA+ QGD +W ++V WT +A++T EELGIT +N
Sbjct: 201 LAARRTILSNPDDHEILPEIISKEPLGPAVRQGDQQWSDLVRWTLFALITGEELGITSEN 260

Query: 261 INQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSEL 320
           ++Q+   + N +V+RFLG+D  S+ G+ +GL+ DW YRII+H+GNY E+F+RN+G+Q+ L
Sbjct: 261 VDQMLT-SENTEVKRFLGVD--SDFGQHIGLSHDWAYRIIKHVGNYSEVFERNVGSQTAL 317

Query: 321 KIPRGYNALWSKGGLMYAPPIR 342
            + RG NALW+ GGLMYAPPIR
Sbjct: 318 GLDRGLNALWTNGGLMYAPPIR 339


>gi|161621000|ref|YP_001594886.1| amino-acid ABC transporter-binding protein yhdW precursor [Brucella
           canis ATCC 23365]
 gi|260567799|ref|ZP_05838268.1| solute-binding protein/glutamate receptor [Brucella suis bv. 4 str.
           40]
 gi|161337811|gb|ABX64115.1| amino-acid ABC transporter-binding protein yhdW precursor [Brucella
           canis ATCC 23365]
 gi|260154464|gb|EEW89545.1| solute-binding protein/glutamate receptor [Brucella suis bv. 4 str.
           40]
          Length = 339

 Score =  360 bits (923), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 166/342 (48%), Positives = 227/342 (66%), Gaps = 3/342 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           M K  + ++L             A  L  +K+RG + CG++ G+ GF+     G W GFD
Sbjct: 1   MKKAVWGALLAAGFALSAQGGAAADTLSTVKERGKVNCGVSQGVAGFSSPDDRGKWTGFD 60

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
           +DFCRA+S+A+F DP K+ ++PL+ KERF ALQS  +D+LSR T WTL R+  +G+ F  
Sbjct: 61  IDFCRAVSAAVFGDPDKVSFIPLSTKERFTALQSGTVDLLSRQTTWTLSRDAGMGIHFVG 120

Query: 121 ITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVE 180
             Y+DGQGF++ K  G+ S  +L GASIC + GTTTE  +ADYF AHN+KY P+V +  +
Sbjct: 121 TAYYDGQGFMIRKDLGVDSALKLDGASICTEQGTTTEQNVADYFGAHNIKYEPVVIDSAD 180

Query: 181 EIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNI 240
            I  A+   RCD YT D SALYA +L    P  +++LP++ISK PL PA+ QGD +W+NI
Sbjct: 181 GILKAFETGRCDVYTTDASALYAQRLKLAEPDAYMVLPEVISKEPLGPAVRQGDDKWFNI 240

Query: 241 VSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRII 300
           V WT +A++ AEELGITQK +     D+  PD++RFLG +  +  G+ LGL   W Y I+
Sbjct: 241 VRWTLFALLEAEELGITQKTV-AADLDSRKPDIRRFLGSEGDN--GQQLGLEPKWAYNIV 297

Query: 301 RHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
             +GNYGEMF+R +G  S LKI RG NALW+KGGLMYAPP++
Sbjct: 298 ASVGNYGEMFERTIGEGSLLKINRGINALWNKGGLMYAPPVK 339


>gi|192293640|ref|YP_001994245.1| extracellular solute-binding protein family 3 [Rhodopseudomonas
           palustris TIE-1]
 gi|192287389|gb|ACF03770.1| extracellular solute-binding protein family 3 [Rhodopseudomonas
           palustris TIE-1]
          Length = 344

 Score =  360 bits (923), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 162/311 (52%), Positives = 225/311 (72%), Gaps = 6/311 (1%)

Query: 32  KRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERFLA 91
           +R  + CG+N GL GF+     G+W GFDVDFCRA+++AIFDDP+K+Q++PL+A ERF  
Sbjct: 40  RRDAVLCGVNKGLPGFSTPDDKGNWTGFDVDFCRAVAAAIFDDPTKVQFVPLDANERFKE 99

Query: 92  LQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASICVQ 151
           LQS+++DILSRN+ W++ RE +  L F  + Y+DGQGF++   + I S  +L G+ +CVQ
Sbjct: 100 LQSRKVDILSRNSTWSMSRETNYDLYFPAVAYYDGQGFMVPASRKIDSAVELDGSKVCVQ 159

Query: 152 AGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTNDRP 211
            GTTT+L LADYF+ +NMKY  +  E+ +++  AY+  +CD +T D+S LYAL+ T ++ 
Sbjct: 160 NGTTTQLNLADYFRTNNMKYQEVKSEKFDDVVKAYKDGQCDTFTADVSQLYALRKTFEKS 219

Query: 212 SEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTTNP 271
            +H+ILPD+ISK PLAP + Q D +W  IV WT YAM+ AEELGIT +NI +  K +  P
Sbjct: 220 GDHIILPDVISKEPLAPVVRQRDDDWMMIVKWTLYAMINAEELGITSQNIGEALK-SKKP 278

Query: 272 DVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNALWS 331
           DV R +G + +   GE LGL+KDW  R+IRH+GNYGE++DRN+G   +L IPRG N LWS
Sbjct: 279 DVMRLVGTEGA--FGEDLGLSKDWAARVIRHVGNYGEVYDRNVG---KLGIPRGLNQLWS 333

Query: 332 KGGLMYAPPIR 342
            GG+ YAPPIR
Sbjct: 334 NGGIQYAPPIR 344


>gi|17988694|ref|NP_541327.1| general L-amino acid-binding periplasmic protein AAPJ precursor
           [Brucella melitensis bv. 1 str. 16M]
 gi|17984503|gb|AAL53591.1| general l-amino acid-binding periplasmic protein aapj precursor
           [Brucella melitensis bv. 1 str. 16M]
          Length = 331

 Score =  359 bits (922), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 163/319 (51%), Positives = 221/319 (69%), Gaps = 3/319 (0%)

Query: 24  ASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPL 83
           A  L  +K+RG + CG++ G+ GF+     G W GFD+DFCRA+S+A+F DP K+ ++PL
Sbjct: 16  ADTLSTVKERGKVNCGVSQGVAGFSSPDDQGKWTGFDIDFCRAVSAAVFGDPDKVSFIPL 75

Query: 84  NAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQL 143
           + KERF ALQS  +D+LSR T WTL R+  +G+ F    Y+DGQGF++ K  G+ S  +L
Sbjct: 76  STKERFTALQSGTVDLLSRQTTWTLSRDAGMGIHFVGTAYYDGQGFMIRKDLGVDSALKL 135

Query: 144 SGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYA 203
            GASIC + GTTTE  +ADYF AHN+KY P+V +  + I  A+   RCD YT D SALYA
Sbjct: 136 DGASICTEQGTTTEQNVADYFGAHNIKYEPVVIDSADGILKAFETGRCDVYTTDASALYA 195

Query: 204 LKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQ 263
            +L    P  +++LP++ISK PL PA+ QGD +W+NIV WT +A++ AEELGITQK +  
Sbjct: 196 QRLKLAEPDAYMVLPEVISKEPLGPAVRQGDDKWFNIVRWTLFALLEAEELGITQKTV-A 254

Query: 264 VSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIP 323
              D+  PD++RFLG +  +  G+ LGL   W Y I+  +GNYGEMF+R +G  S LKI 
Sbjct: 255 ADLDSRKPDIRRFLGSEGDN--GQQLGLEPKWAYNIVASVGNYGEMFERTIGEGSLLKIN 312

Query: 324 RGYNALWSKGGLMYAPPIR 342
           RG NALW+KGGLMYAPP++
Sbjct: 313 RGINALWNKGGLMYAPPVK 331


>gi|156935788|ref|YP_001439704.1| hypothetical protein ESA_03659 [Cronobacter sakazakii ATCC BAA-894]
 gi|156534042|gb|ABU78868.1| hypothetical protein ESA_03659 [Cronobacter sakazakii ATCC BAA-894]
          Length = 341

 Score =  359 bits (922), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 158/319 (49%), Positives = 224/319 (70%), Gaps = 2/319 (0%)

Query: 24  ASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPL 83
            + L  +KK+GF++CGI+ GL GF+   A G + G DVD CR +++A+F D SK++Y PL
Sbjct: 25  GATLDSVKKKGFVQCGISDGLPGFSYADAGGKFTGIDVDVCRGVAAAVFGDASKVKYTPL 84

Query: 84  NAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQL 143
            AKERF ALQS ++D+LSRNT WT  R+  +G++F  +TY+DG GF+ H K G+ S  +L
Sbjct: 85  TAKERFTALQSGEVDVLSRNTTWTSSRDAGMGMSFTGVTYYDGIGFLTHNKAGLKSAKEL 144

Query: 144 SGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYA 203
            GA++C+QAGT TEL +ADYFKA+NMKY P+ F+R +E   A  + RCD    D S LYA
Sbjct: 145 DGATVCIQAGTDTELNVADYFKANNMKYTPVTFDRSDESAKALESGRCDTLASDQSQLYA 204

Query: 204 LKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQ 263
           L++    P+E ++LP++ISK PL P + +GD EW++IV WT +AM+ AEE+GI  KN++ 
Sbjct: 205 LRIKLSNPAEWIVLPEVISKEPLGPVVRRGDDEWFSIVRWTLFAMLNAEEMGIDSKNVDA 264

Query: 264 VSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIP 323
            + + + PD+   LG  K  + G+ L L   W Y II+ +GNYGE+F+RN+G +S LKI 
Sbjct: 265 KAANPSTPDMAHLLG--KEGDYGKDLKLDNKWAYNIIKQVGNYGEIFERNVGQESPLKIK 322

Query: 324 RGYNALWSKGGLMYAPPIR 342
           RG N LW+KGG+ YAPP+R
Sbjct: 323 RGQNNLWNKGGIQYAPPVR 341


>gi|104783492|ref|YP_609990.1| general amino acid ABC transporter periplasmic binding protein
           [Pseudomonas entomophila L48]
 gi|95112479|emb|CAK17206.1| general amino acid ABC transporter, periplasmic binding protein
           [Pseudomonas entomophila L48]
          Length = 342

 Score =  359 bits (921), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 161/324 (49%), Positives = 227/324 (70%), Gaps = 2/324 (0%)

Query: 19  SFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKI 78
           SF+   + L  +KK+GF++CG++ GL GF+   A G   G D D CRA+++A+F D +K+
Sbjct: 21  SFAQAGATLDAVKKKGFVQCGVSDGLPGFSVPDAQGKIVGIDADVCRAVAAAVFGDATKV 80

Query: 79  QYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGIS 138
           ++  LNAKERF ALQS ++D+LSRNT WT  R+  +GL F  +TY+DG GF+ +KK G+S
Sbjct: 81  KFSQLNAKERFTALQSGEVDVLSRNTTWTSSRDAGMGLVFAGVTYYDGVGFLANKKLGVS 140

Query: 139 SVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDI 198
           S  +L GA+IC+QAGTTTEL ++DYF+A+ +KY PI F+  +E   +  + RCD  T D 
Sbjct: 141 SAKELDGATICIQAGTTTELNVSDYFRANGLKYTPITFDTSDESAKSLESGRCDVLTSDK 200

Query: 199 SALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQ 258
           S L+A +     P+E+V+LP+ ISK PL P + +GD EW++IV WT +AM+ AEE GIT 
Sbjct: 201 SQLFAQRSKLAAPTEYVVLPETISKEPLGPVVRKGDEEWFSIVKWTLFAMLNAEEAGITS 260

Query: 259 KNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQS 318
           KN+   +K T NPDV R LG D     G+ L L KDW  +I++ +GNYGE+F++NLG  +
Sbjct: 261 KNVEAEAKSTKNPDVARLLGAD--GEYGKDLKLPKDWVVQIVKQVGNYGEVFEKNLGQST 318

Query: 319 ELKIPRGYNALWSKGGLMYAPPIR 342
           +LKI RG NALW+ GG+ YAPP+R
Sbjct: 319 DLKIDRGMNALWNNGGIQYAPPVR 342


>gi|254703267|ref|ZP_05165095.1| hypothetical protein Bsuib36_04929 [Brucella suis bv. 3 str. 686]
 gi|261753898|ref|ZP_05997607.1| extracellular solute-binding protein family 3 [Brucella suis bv. 3
           str. 686]
 gi|261743651|gb|EEY31577.1| extracellular solute-binding protein family 3 [Brucella suis bv. 3
           str. 686]
          Length = 339

 Score =  359 bits (921), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 166/342 (48%), Positives = 227/342 (66%), Gaps = 3/342 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           M K  + ++L             A  L  +K+RG + CG++ G+ GF+     G W GFD
Sbjct: 1   MKKAVWGALLAAGFALSAQGGAAADTLSTVKERGKVNCGVSQGVAGFSSPDGWGKWTGFD 60

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
           +DFCRA+S+A+F DP K+ ++PL+ KERF ALQS  +D+LSR T WTL R+  +G+ F  
Sbjct: 61  IDFCRAVSAAVFGDPDKVSFIPLSTKERFTALQSGTVDLLSRQTTWTLSRDAGMGIHFVG 120

Query: 121 ITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVE 180
             Y+DGQGF++ K  G+ S  +L GASIC + GTTTE  +ADYF AHN+KY P+V +  +
Sbjct: 121 TAYYDGQGFMIRKDLGVDSALKLDGASICTEQGTTTEQNVADYFGAHNIKYEPVVIDSAD 180

Query: 181 EIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNI 240
            I  A+   RCD YT D SALYA +L    P  +++LP++ISK PL PA+ QGD +W+NI
Sbjct: 181 GILKAFETGRCDVYTTDASALYAQRLKLAEPDAYMVLPEVISKEPLGPAVRQGDDKWFNI 240

Query: 241 VSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRII 300
           V WT +A++ AEELGITQK +     D+  PD++RFLG +  +  G+ LGL   W Y I+
Sbjct: 241 VRWTLFALLEAEELGITQKTV-AADLDSRKPDIRRFLGSEGDN--GQQLGLEPKWAYNIV 297

Query: 301 RHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
             +GNYGEMF+R +G  S LKI RG NALW+KGGLMYAPP++
Sbjct: 298 ASVGNYGEMFERTIGEGSLLKINRGINALWNKGGLMYAPPVK 339


>gi|86751771|ref|YP_488267.1| extracellular solute-binding protein [Rhodopseudomonas palustris
           HaA2]
 gi|86574799|gb|ABD09356.1| extracellular solute-binding protein, family 3 [Rhodopseudomonas
           palustris HaA2]
          Length = 341

 Score =  358 bits (920), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 163/311 (52%), Positives = 226/311 (72%), Gaps = 6/311 (1%)

Query: 32  KRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERFLA 91
           +R  + CG+N GL GF+     G+W GFDVDFCRA+++AIF+DP+K++++PL+A ERF  
Sbjct: 37  RRDAVLCGVNKGLPGFSTPDEKGNWTGFDVDFCRAVAAAIFNDPNKVKFVPLDANERFKE 96

Query: 92  LQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASICVQ 151
           LQS+++DILSRN+ W++ RE    L F  + Y+DG+GF++   + I +  +L G+ +CVQ
Sbjct: 97  LQSRKVDILSRNSTWSMSREAGYELYFPAVAYYDGEGFMVPSSRKIETALELDGSKVCVQ 156

Query: 152 AGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTNDRP 211
           AGTTT L LADYF+A+NMKY  + F +++E+ AAY + +CD ++ D S LYAL+ T  +P
Sbjct: 157 AGTTTLLNLADYFRANNMKYQEVKFPKLDEVVAAYNSGQCDTFSADASQLYALRQTLAKP 216

Query: 212 SEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTTNP 271
            +HVILPD+ISK PLAP + Q D EW  IV W+ YAM+ AEELG+T  NI++  K +  P
Sbjct: 217 GDHVILPDLISKEPLAPVVRQRDDEWMMIVKWSLYAMINAEELGVTSANIDEALK-SKKP 275

Query: 272 DVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNALWS 331
           DV R +G + +   GE LGL+KDW  RIIRH+GNYGE++DRN+G   +L IPRG N LWS
Sbjct: 276 DVMRLVGTEGA--YGEELGLSKDWAARIIRHVGNYGEVYDRNVG---KLGIPRGLNQLWS 330

Query: 332 KGGLMYAPPIR 342
            GG+ YAPPIR
Sbjct: 331 AGGIQYAPPIR 341


>gi|254712708|ref|ZP_05174519.1| amino-acid ABC transporter-binding protein yhdW precursor [Brucella
           ceti M644/93/1]
 gi|254715778|ref|ZP_05177589.1| amino-acid ABC transporter-binding protein yhdW precursor [Brucella
           ceti M13/05/1]
 gi|261217539|ref|ZP_05931820.1| extracellular solute-binding protein family 3 [Brucella ceti
           M13/05/1]
 gi|261320414|ref|ZP_05959611.1| extracellular solute-binding protein family 3 [Brucella ceti
           M644/93/1]
 gi|260922628|gb|EEX89196.1| extracellular solute-binding protein family 3 [Brucella ceti
           M13/05/1]
 gi|261293104|gb|EEX96600.1| extracellular solute-binding protein family 3 [Brucella ceti
           M644/93/1]
          Length = 339

 Score =  358 bits (920), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 165/342 (48%), Positives = 226/342 (66%), Gaps = 3/342 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           M K  + ++L             A  L  +K+RG + CG++ G+ GF+     G W GFD
Sbjct: 1   MKKTVWGALLAAGFALSAQGGAAADTLSTVKERGKVNCGVSQGVAGFSSPDDQGKWTGFD 60

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
           +DFCRA+S+A+F DP K+ ++PL+ KERF ALQS  +D+LSR T WTL R+  +G+ F  
Sbjct: 61  IDFCRAVSAAVFGDPDKVSFIPLSTKERFTALQSGTVDLLSRQTTWTLSRDAGMGIHFVG 120

Query: 121 ITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVE 180
             Y+DGQGF++ K  G+ S  +L GASIC + GTTTE  +ADYF AHN+KY P+V +  +
Sbjct: 121 TAYYDGQGFMIRKDLGVDSALKLDGASICTEQGTTTEQNVADYFGAHNIKYEPVVIDSAD 180

Query: 181 EIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNI 240
            I  A+   RCD YT D SA YA +L    P  +++LP++ISK PL PA+ QGD +W+NI
Sbjct: 181 GILKAFETGRCDVYTTDASAFYAQRLKLAEPDAYMVLPEVISKEPLGPAVRQGDDKWFNI 240

Query: 241 VSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRII 300
           V WT +A++ AEELGITQK +     D+  PD++RFLG +  +  G+ LGL   W Y I+
Sbjct: 241 VRWTLFALLEAEELGITQKTV-AADLDSRKPDIRRFLGSEGDN--GQQLGLEPKWAYNIV 297

Query: 301 RHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
             +GNYGEMF+R +G  S LKI RG NALW+KGGLMYAPP++
Sbjct: 298 ASVGNYGEMFERTIGEGSLLKINRGINALWNKGGLMYAPPVK 339


>gi|316936277|ref|YP_004111259.1| family 3 extracellular solute-binding protein [Rhodopseudomonas
           palustris DX-1]
 gi|315603991|gb|ADU46526.1| extracellular solute-binding protein family 3 [Rhodopseudomonas
           palustris DX-1]
          Length = 344

 Score =  358 bits (920), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 164/311 (52%), Positives = 223/311 (71%), Gaps = 6/311 (1%)

Query: 32  KRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERFLA 91
           +R  + CG+N GL GFA     G+W GFDVDFCRA+++AIFDDP+K+++LPL+A ERF  
Sbjct: 40  RRDAVLCGVNKGLPGFATPDDKGNWTGFDVDFCRAVAAAIFDDPTKVKFLPLDANERFKE 99

Query: 92  LQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASICVQ 151
           LQS+++DILSRN+ W++ RE +  L F  + Y+DGQGF++   + I S  +L G+ +CVQ
Sbjct: 100 LQSRKVDILSRNSTWSMSRETNYELYFPAVAYYDGQGFMVPASRKIDSAVELDGSKVCVQ 159

Query: 152 AGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTNDRP 211
            GTTT+L LADYF+ +NM Y  +  E+ +++  AY+  +CD +T D+S LYAL+ T    
Sbjct: 160 NGTTTQLNLADYFRTNNMTYQEVKSEKFDDVVKAYKDGQCDTFTADVSQLYALRKTFANA 219

Query: 212 SEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTTNP 271
            +HVILPD+ISK PLAP + Q D +W  IV WT YAM+ AEELGIT +NI++  K +  P
Sbjct: 220 GDHVILPDVISKEPLAPVVRQRDDDWMMIVKWTLYAMINAEELGITSQNIDEALK-SKKP 278

Query: 272 DVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNALWS 331
           DV R +G D +   GE LGL+KDW  RI+RH+GNYGE++DRN+G   +L IPRG N LWS
Sbjct: 279 DVMRLVGTDGA--FGEDLGLSKDWAARIVRHVGNYGEVYDRNVG---KLGIPRGLNQLWS 333

Query: 332 KGGLMYAPPIR 342
            GG+ YAPPIR
Sbjct: 334 NGGIQYAPPIR 344


>gi|312881587|ref|ZP_07741365.1| amino acid ABC transporter amino acid-binding protein [Vibrio
           caribbenthicus ATCC BAA-2122]
 gi|309370650|gb|EFP98124.1| amino acid ABC transporter amino acid-binding protein [Vibrio
           caribbenthicus ATCC BAA-2122]
          Length = 342

 Score =  358 bits (920), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 163/327 (49%), Positives = 228/327 (69%), Gaps = 7/327 (2%)

Query: 20  FSTNASILGD----IKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDP 75
            +T+A   GD    + K+GF+ CG++TGL GF+   + G+W+G DV++C+AL+SA+  D 
Sbjct: 19  IATHAFAAGDTLDKVTKQGFITCGVSTGLPGFSNPNSKGEWEGIDVEYCQALASAVLGDK 78

Query: 76  SKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKK 135
            K++Y+PL AKERF ALQS ++D+LSRNT WTL R+ +LGL F  + Y+DGQGF++ K  
Sbjct: 79  KKVKYVPLTAKERFTALQSGEVDVLSRNTTWTLHRDTALGLNFVGVNYYDGQGFMVKKDL 138

Query: 136 GISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYT 195
           G+ S  +L GAS+CVQ+GTTTEL LADYF+   MKY P+VF+   +    + A RCD  T
Sbjct: 139 GLKSAKELDGASVCVQSGTTTELNLADYFRNSGMKYRPVVFDTAAQTSKGFDAGRCDVLT 198

Query: 196 GDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELG 255
            D S LYAL+L    P+   +LP+IISK PL P + QGD +W+NI  WT  AMV AEE G
Sbjct: 199 TDQSGLYALRLNLQDPASAQVLPEIISKEPLGPVVRQGDDQWFNIAKWTLAAMVNAEEYG 258

Query: 256 ITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLG 315
           I+ KN +++ K + +P+++R LG++     G+ LG+  DW Y+I++ +GNYGE F+R +G
Sbjct: 259 ISSKNADEMLK-SKDPNIRRILGVEGPK--GKGLGIRDDWGYQIVKQVGNYGESFERTVG 315

Query: 316 NQSELKIPRGYNALWSKGGLMYAPPIR 342
             S L+I RG NALW+ GG MYAPPIR
Sbjct: 316 QGSPLQISRGVNALWNAGGFMYAPPIR 342


>gi|258544539|ref|ZP_05704773.1| general amino acid ABC superfamily ATP binding cassette
           transporter, periplasmic binding protein
           [Cardiobacterium hominis ATCC 15826]
 gi|258520221|gb|EEV89080.1| general amino acid ABC superfamily ATP binding cassette
           transporter, periplasmic binding protein
           [Cardiobacterium hominis ATCC 15826]
          Length = 350

 Score =  358 bits (919), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 163/353 (46%), Positives = 239/353 (67%), Gaps = 14/353 (3%)

Query: 1   MYKDFFVSILCLII----LFFTSF-------STNASILGDIKKRGFLKCGINTGLVGFAE 49
           M +  F+S  C  I    L FT+        +T A  L D+KKRG L+CG+   L GF+ 
Sbjct: 1   MAQSTFLSTYCENIMKKSLLFTALGLATLVQTTQADTLDDVKKRGELRCGVTQALAGFSV 60

Query: 50  VKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLL 109
              +G W G DVD+CRAL+SAIFDDP K+ + P ++KERF  LQS +ID+L+R T WT  
Sbjct: 61  ADDSGRWTGLDVDYCRALASAIFDDPEKVSFRPTSSKERFTVLQSGEIDVLARVTTWTTS 120

Query: 110 REISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNM 169
           R++ +   F  + Y+DGQGF++ K  GI SV +LSGASIC   GT+TE  +ADYFK++ M
Sbjct: 121 RDVDMPFDFIGVNYYDGQGFMVRKDLGIKSVKELSGASICTNTGTSTETNMADYFKSNGM 180

Query: 170 KYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPA 229
           +Y P++FE+ EE+ +AY A RCDAY+ D+S LY  +    +P +H+ILP++ISK PL P 
Sbjct: 181 EYKPVIFEKSEEVKSAYDAGRCDAYSSDVSGLYVQRKLLAKPDDHIILPEVISKEPLGPL 240

Query: 230 IIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEAL 289
           + Q D  + ++ +WTH+ MV AEE G+++ N+ ++ K + NP+++R LG++  +N  + L
Sbjct: 241 VRQEDPGFKDLAAWTHFCMVNAEEYGVSKANLEEMKK-SDNPNIRRLLGLE--ANGADKL 297

Query: 290 GLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           G+  D+  +II+H+GNYGE +DRN+G  S L I RG N LW++GG+M+APP+R
Sbjct: 298 GVGADFCAKIIKHVGNYGEAYDRNVGKDSPLNIERGLNRLWNQGGIMFAPPLR 350


>gi|256029203|ref|ZP_05442817.1| amino-acid ABC transporter-binding protein yhdW precursor [Brucella
           pinnipedialis M292/94/1]
 gi|265986189|ref|ZP_06098746.1| extracellular solute-binding protein family 3 [Brucella
           pinnipedialis M292/94/1]
 gi|264658386|gb|EEZ28647.1| extracellular solute-binding protein family 3 [Brucella
           pinnipedialis M292/94/1]
          Length = 339

 Score =  358 bits (919), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 165/342 (48%), Positives = 226/342 (66%), Gaps = 3/342 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           M K  + ++L             A  L  +K+RG + CG++ G+ GF+     G W GFD
Sbjct: 1   MKKTVWGALLAAGFALSAQGGAAADTLSTVKERGKVNCGVSQGVAGFSSPDDQGKWTGFD 60

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
           +DFCRA+S+A+F DP K+ ++PL+ KERF ALQS  +D+LSR T WTL R+  +G+ F  
Sbjct: 61  IDFCRAVSAAVFGDPDKVSFIPLSTKERFTALQSGTVDLLSRQTTWTLSRDAGMGIHFVG 120

Query: 121 ITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVE 180
             Y+DGQGF++ K  G+ S  +L GASIC + GTTTE  +ADYF AHN+KY P+V +  +
Sbjct: 121 TAYYDGQGFMIRKDLGVDSALKLDGASICTEQGTTTEQNVADYFGAHNIKYEPVVIDSAD 180

Query: 181 EIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNI 240
            I  A+   RCD YT D SALY  +L    P  +++LP++ISK PL PA+ QGD +W+NI
Sbjct: 181 GILKAFETGRCDVYTTDASALYVQRLKLAEPDAYMVLPEVISKEPLGPAVRQGDDKWFNI 240

Query: 241 VSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRII 300
           V WT +A++ AEELGITQK +     D+  PD++RFLG +  +  G+ LGL   W Y I+
Sbjct: 241 VRWTLFALLEAEELGITQKTV-AADLDSRKPDIRRFLGSEGDN--GQQLGLEPKWAYNIV 297

Query: 301 RHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
             +GNYGEMF+R +G  S LKI RG NALW+KGGLMYAPP++
Sbjct: 298 ASVGNYGEMFERTIGEGSLLKINRGINALWNKGGLMYAPPVK 339


>gi|261819589|ref|YP_003257695.1| extracellular solute-binding protein family 3 [Pectobacterium
           wasabiae WPP163]
 gi|261603602|gb|ACX86088.1| extracellular solute-binding protein family 3 [Pectobacterium
           wasabiae WPP163]
          Length = 341

 Score =  358 bits (918), Expect = 8e-97,   Method: Compositional matrix adjust.
 Identities = 157/319 (49%), Positives = 225/319 (70%), Gaps = 2/319 (0%)

Query: 24  ASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPL 83
            + L  I+K+GF++CGI+ GL GF+   ANG + G DVD CR +++A+F D +K++Y PL
Sbjct: 25  GTTLDAIQKKGFVQCGISDGLPGFSYADANGKYSGIDVDVCRGIAAAVFGDANKVKYSPL 84

Query: 84  NAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQL 143
            AKERF ALQS ++D+LSRNT WT  R+  +G+ F  +TY+DG GF+ H K G++S  +L
Sbjct: 85  TAKERFTALQSGEVDVLSRNTTWTSSRDGGMGMLFTGVTYYDGIGFLTHNKAGLTSAKEL 144

Query: 144 SGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYA 203
            GA++C+QAGT TEL +ADYFK H M+Y P+ F+R +E   A  + RCD    D S LYA
Sbjct: 145 DGATVCIQAGTDTELNVADYFKTHKMQYTPVTFDRSDESAKALESGRCDTLASDQSQLYA 204

Query: 204 LKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQ 263
           L++   +P+E ++LP++ISK PL P + +GD EW+ IV WT +AM+ AEE+ +T KN++Q
Sbjct: 205 LRIKLSKPAEFIVLPEVISKEPLGPVVRRGDEEWFAIVRWTLFAMLNAEEMDVTSKNVDQ 264

Query: 264 VSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIP 323
           ++   T PD+   LG + S   G+ L L  DW ++II+ +GNYGE+F+RN+G  SELKI 
Sbjct: 265 LAAKPTTPDMSHLLGHEGS--YGKDLKLPNDWAFKIIKQVGNYGEIFERNVGMGSELKIK 322

Query: 324 RGYNALWSKGGLMYAPPIR 342
           RG N LW+KGG+ YAP +R
Sbjct: 323 RGLNELWNKGGIQYAPAVR 341


>gi|283836183|ref|ZP_06355924.1| general amino acid ABC transporter, periplasmic binding protein
           [Citrobacter youngae ATCC 29220]
 gi|291067534|gb|EFE05643.1| general amino acid ABC transporter, periplasmic binding protein
           [Citrobacter youngae ATCC 29220]
          Length = 341

 Score =  357 bits (917), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 157/330 (47%), Positives = 229/330 (69%), Gaps = 2/330 (0%)

Query: 13  IILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIF 72
           ++L   + +   + L  +KK+GF++CGI+ GL GF+   A+G + G DVD CR ++SA+F
Sbjct: 14  VLLAIANQAHAGATLDAVKKKGFVQCGISDGLPGFSYADASGKFSGIDVDVCRGVASAVF 73

Query: 73  DDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMH 132
            D SK++Y PL AKERF ALQS ++D+LSRNT WT  R+  +G++F  +TY+DG GF+ H
Sbjct: 74  GDDSKVKYTPLTAKERFTALQSGEVDMLSRNTTWTSSRDAGMGMSFTGVTYYDGIGFLTH 133

Query: 133 KKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCD 192
            K G+ S  +L GA++C+QAGT TEL +ADYFKA+NMKY P+ F+R +E   A  + RCD
Sbjct: 134 NKAGLKSAKELDGATVCIQAGTDTELNVADYFKANNMKYTPVTFDRSDESAKALESGRCD 193

Query: 193 AYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAE 252
               D S LYAL++    P+E ++LP++ISK PL P + +GD EW++IV WT +AM+ AE
Sbjct: 194 TLASDQSQLYALRIKLSNPAEWIVLPEVISKEPLGPVVRRGDDEWFSIVRWTLFAMLNAE 253

Query: 253 ELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDR 312
           E+G+  KN+++ + +   PD+   LG  K  + G+ L L   W Y II+ +GNY E+F+R
Sbjct: 254 EMGVNSKNVDEKAANPATPDMAHLLG--KEGDYGKDLKLDNKWAYNIIKQVGNYSEIFER 311

Query: 313 NLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           N+G++S LKI RG N LW+ GG+ YAPP+R
Sbjct: 312 NVGSESPLKIKRGQNNLWNNGGIQYAPPVR 341


>gi|298292513|ref|YP_003694452.1| extracellular solute-binding protein family 3 [Starkeya novella DSM
           506]
 gi|296929024|gb|ADH89833.1| extracellular solute-binding protein family 3 [Starkeya novella DSM
           506]
          Length = 337

 Score =  357 bits (917), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 164/328 (50%), Positives = 225/328 (68%), Gaps = 3/328 (0%)

Query: 15  LFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDD 74
           +  T+   +A  L D+K RG LKCG++ GL GF+     G W GFDVD CRA++SAIFDD
Sbjct: 13  IVMTAGLGHADTLADVKARGTLKCGVSQGLAGFSAKDDKGQWSGFDVDLCRAVASAIFDD 72

Query: 75  PSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKK 134
            SK++Y+PL+A  RF ALQ  +ID+LSRN+ WT+ RE  L L F  ++Y+DGQGF++   
Sbjct: 73  ASKVEYVPLSADARFPALQKGEIDLLSRNSTWTMQREADLKLLFAAVSYYDGQGFLVPVA 132

Query: 135 KGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAY 194
           K + +  +L  + +C Q+GTT+     D+FK +NM    I    V+E+  AY   +CD  
Sbjct: 133 KKVDTALELDKSKVCTQSGTTSVGNAKDFFKQNNMALELIELPTVDEVVKAYDEGKCDVL 192

Query: 195 TGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEEL 254
           T D+S LYAL+L   +P+++++LPD+ISK PL P + QGD  W N V W+ YA++ AEEL
Sbjct: 193 TTDVSQLYALRLRLAKPADYIVLPDVISKEPLGPVVRQGDDAWLNAVKWSFYALLNAEEL 252

Query: 255 GITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNL 314
           GI+Q  ++Q  K +  PDVQRF+G D S   GE LGLTKDW  RI++++GNYGE+F+RN+
Sbjct: 253 GISQATLDQALK-SQKPDVQRFVGTDGS--YGEQLGLTKDWAVRIVKNVGNYGEVFERNI 309

Query: 315 GNQSELKIPRGYNALWSKGGLMYAPPIR 342
           G QS+L IPRG N LWS GG+ YAPPIR
Sbjct: 310 GAQSKLGIPRGINQLWSAGGIQYAPPIR 337


>gi|254690732|ref|ZP_05153986.1| Solute-binding protein/glutamate receptor [Brucella abortus bv. 6
           str. 870]
 gi|254695963|ref|ZP_05157791.1| Solute-binding protein/glutamate receptor [Brucella abortus bv. 3
           str. Tulya]
 gi|256255914|ref|ZP_05461450.1| Solute-binding protein/glutamate receptor [Brucella abortus bv. 9
           str. C68]
 gi|260756304|ref|ZP_05868652.1| extracellular solute-binding protein family 3 [Brucella abortus bv.
           6 str. 870]
 gi|260882128|ref|ZP_05893742.1| extracellular solute-binding protein [Brucella abortus bv. 9 str.
           C68]
 gi|261216393|ref|ZP_05930674.1| extracellular solute-binding protein family 3 [Brucella abortus bv.
           3 str. Tulya]
 gi|297249275|ref|ZP_06932976.1| general L-amino acid transport system substrate-binding protein
           [Brucella abortus bv. 5 str. B3196]
 gi|260676412|gb|EEX63233.1| extracellular solute-binding protein family 3 [Brucella abortus bv.
           6 str. 870]
 gi|260871656|gb|EEX78725.1| extracellular solute-binding protein [Brucella abortus bv. 9 str.
           C68]
 gi|260918000|gb|EEX84861.1| extracellular solute-binding protein family 3 [Brucella abortus bv.
           3 str. Tulya]
 gi|297173144|gb|EFH32508.1| general L-amino acid transport system substrate-binding protein
           [Brucella abortus bv. 5 str. B3196]
          Length = 339

 Score =  357 bits (916), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 165/342 (48%), Positives = 226/342 (66%), Gaps = 3/342 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           M K  + ++L             A  L  +K+RG + CG++ G+ GF+     G W GFD
Sbjct: 1   MKKTVWGALLAAGFALSAQGGAAADTLSTVKERGKVNCGVSQGVAGFSSPDDQGKWTGFD 60

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
           +DFCRA+S+A+F DP K+ ++PL+ KERF ALQS  +D+LSR T WTL R+  +G+ F  
Sbjct: 61  IDFCRAVSAAVFGDPDKVSFIPLSTKERFTALQSGTVDLLSRQTTWTLSRDAGMGIHFVG 120

Query: 121 ITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVE 180
             Y+DGQGF++ K  G+ S  +L GASIC + GTTTE  +ADY  AHN+KY P+V +  +
Sbjct: 121 TAYYDGQGFMIRKDLGVDSALKLDGASICTEQGTTTEQNVADYCGAHNIKYEPVVIDSAD 180

Query: 181 EIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNI 240
            I  A+   RCD YT D SALYA +L    P  +++LP++ISK PL PA+ QGD +W+NI
Sbjct: 181 GILKAFETGRCDVYTTDASALYAQRLKLAEPDAYMVLPEVISKEPLGPAVRQGDDKWFNI 240

Query: 241 VSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRII 300
           V WT +A++ AEELGITQK +     D+  PD++RFLG +  +  G+ LGL   W Y I+
Sbjct: 241 VRWTLFALLEAEELGITQKTV-AADLDSRKPDIRRFLGSEGDN--GQQLGLEPKWAYNIV 297

Query: 301 RHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
             +GNYGEMF+R +G  S LKI RG NALW+KGGLMYAPP++
Sbjct: 298 ASVGNYGEMFERTIGEGSLLKINRGINALWNKGGLMYAPPVK 339


>gi|146343600|ref|YP_001208648.1| general L-amino acid-binding periplasmic protein [Bradyrhizobium
           sp. ORS278]
 gi|146196406|emb|CAL80433.1| General L-amino acid-binding periplasmic protein [Bradyrhizobium
           sp. ORS278]
          Length = 345

 Score =  357 bits (915), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 159/311 (51%), Positives = 224/311 (72%), Gaps = 3/311 (0%)

Query: 32  KRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERFLA 91
           +RG + CG+N GL GF+     G+W GFDVDFCRA+++AIFDDP K +++PL+A ERF  
Sbjct: 38  RRGEVLCGVNAGLPGFSIPDDKGNWTGFDVDFCRAVAAAIFDDPKKARFVPLDASERFKE 97

Query: 92  LQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASICVQ 151
           LQS+++DILSRNT W++ RE +  L F  + Y+DGQGF++ + + + +   L+G+ +CVQ
Sbjct: 98  LQSRKVDILSRNTTWSMAREQNYDLYFPAVAYYDGQGFMVPRARKLETALDLNGSKVCVQ 157

Query: 152 AGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTNDRP 211
             TT  L L DYF+A+NMKY  +   +++++  AY + +CD +T D+S LYAL+L   +P
Sbjct: 158 DSTTNALNLGDYFRANNMKYEEVKLPKLDDVLKAYDSGKCDTFTADVSQLYALRLVLTKP 217

Query: 212 SEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTTNP 271
            +H ILPD+ISK PLAP + Q D +W  IV WT YAM+ AEELG+T KNI++  K +  P
Sbjct: 218 GDHDILPDLISKEPLAPVVRQRDDDWMMIVKWTLYAMINAEELGVTSKNIDEALK-SKKP 276

Query: 272 DVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNALWS 331
           DV R +G       G+ LGL+KDW  RIIRH+GNYGE+++RN+G++S+LKIPRG N LW+
Sbjct: 277 DVMRLVG--NEGTYGQDLGLSKDWAARIIRHVGNYGEVYERNVGSESKLKIPRGMNQLWN 334

Query: 332 KGGLMYAPPIR 342
            GG+ YAPPIR
Sbjct: 335 AGGIQYAPPIR 345


>gi|319957434|ref|YP_004168697.1| amino acid ABC transporter substrate-binding protein, paat family
           [Nitratifractor salsuginis DSM 16511]
 gi|319419838|gb|ADV46948.1| amino acid ABC transporter substrate-binding protein, PAAT family
           [Nitratifractor salsuginis DSM 16511]
          Length = 338

 Score =  357 bits (915), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 159/314 (50%), Positives = 225/314 (71%), Gaps = 2/314 (0%)

Query: 29  DIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKER 88
           D+KK G LKCG+NTGL GF+E  + G W+G DVD+CRAL++ +  D SK++Y+PLNAKER
Sbjct: 27  DVKKAGILKCGVNTGLPGFSEADSKGQWRGLDVDYCRALAAVVLGDASKVKYVPLNAKER 86

Query: 89  FLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASI 148
           F ALQS +ID+LSRNT  T  R+ SLG+ F  + Y+DGQGF++ K  G+ S  +L GA++
Sbjct: 87  FTALQSGEIDVLSRNTTNTETRDTSLGINFTGVMYYDGQGFMVPKSLGVKSAKELDGATV 146

Query: 149 CVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTN 208
           C+QAGTTTEL LADYF+A++MK+  I F+  +++  A+ A RCD  T D S LYA +   
Sbjct: 147 CIQAGTTTELNLADYFRANHMKFKAITFDTNDQVTKAFEAGRCDVLTTDASGLYATRTKL 206

Query: 209 DRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDT 268
             P ++V+LP+IISK PLAPA+  GD +W++I  WT  A++TAEE GIT  N+++    +
Sbjct: 207 ANPEKYVVLPEIISKEPLAPAVRHGDDQWFDIAKWTRNALLTAEEKGITMANVDEAKAKS 266

Query: 269 TNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNA 328
           T+P+V+R L ++    + + L L K   Y  I+ +GNYGE+F+RN+G ++ LKI RG NA
Sbjct: 267 TDPEVKRLLSVE--GKMCDNLKLEKGCFYNAIKQVGNYGEIFERNVGVKTPLKIQRGLNA 324

Query: 329 LWSKGGLMYAPPIR 342
           LW++GGL Y+PP R
Sbjct: 325 LWTQGGLQYSPPFR 338


>gi|70728430|ref|YP_258179.1| general amino acid ABC transporter periplasmic binding protein
           [Pseudomonas fluorescens Pf-5]
 gi|68342729|gb|AAY90335.1| general amino acid ABC transporter, periplasmic binding protein
           [Pseudomonas fluorescens Pf-5]
          Length = 342

 Score =  357 bits (915), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 159/342 (46%), Positives = 230/342 (67%), Gaps = 2/342 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           M K    ++    +L  + F+   + L  ++K+GF++CG++ GL GF+   A G   G D
Sbjct: 3   MLKSTLAAVTAATVLGMSGFAQAGATLDAVQKKGFVQCGVSDGLPGFSVPDATGKILGID 62

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
            D CRA+++A+F D +K+++  LNAKERF ALQS +ID+LSRNT WT  R+  +GL F  
Sbjct: 63  ADVCRAVAAAVFGDATKVKFSQLNAKERFTALQSGEIDVLSRNTTWTSSRDAGMGLVFAG 122

Query: 121 ITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVE 180
           +TY+DG GF+++KK G+ S  +L GA+IC+QAGTTTEL ++DYF+ + +KY PI F+  +
Sbjct: 123 VTYYDGIGFLVNKKLGVKSAKELDGATICIQAGTTTELNVSDYFRGNGLKYTPITFDTSD 182

Query: 181 EIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNI 240
           E   +  + RCD  T D S LYA +     P+++V+LP+ ISK PL P + +GD EW++I
Sbjct: 183 ESAKSLESGRCDVLTSDKSQLYAQRSKLATPTDYVVLPETISKEPLGPVVRKGDEEWFSI 242

Query: 241 VSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRII 300
           V WT +AM+ AEE G+T KN+   +K T NPDV R LG D     G+ L L KDW  +I+
Sbjct: 243 VKWTLFAMLNAEEAGVTSKNVEAEAKSTKNPDVARLLGAD--GEYGKDLKLPKDWVVQIV 300

Query: 301 RHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           + +GNYGE+F++NLG  + L I RG NALW+ GG+ YAPP+R
Sbjct: 301 KQVGNYGEVFEKNLGKSTPLAIDRGLNALWNNGGIQYAPPVR 342


>gi|332163168|ref|YP_004299745.1| ABC transporter periplasmic solute-binding protein [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|318603946|emb|CBY25444.1| glutamate Aspartate periplasmic binding protein precursor GltI
           [Yersinia enterocolitica subsp. palearctica Y11]
 gi|325667398|gb|ADZ44042.1| ABC transporter periplasmic solute-binding protein [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
          Length = 341

 Score =  357 bits (915), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 157/319 (49%), Positives = 221/319 (69%), Gaps = 2/319 (0%)

Query: 24  ASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPL 83
            + L  +KK+GF++CGI+ GL GF+   A+G + G DVD CR +++AIF D  K++Y PL
Sbjct: 25  GTTLDAVKKKGFVQCGISDGLPGFSYADASGKFSGLDVDICRGVAAAIFGDAEKVKYTPL 84

Query: 84  NAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQL 143
            AKERF ALQS ++DILSRNT WT  R+  +G+ F  + Y+DG GF+ H K G+ S  +L
Sbjct: 85  TAKERFTALQSGEVDILSRNTTWTSSRDAGMGMLFTGVNYYDGIGFLTHNKAGLKSAKEL 144

Query: 144 SGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYA 203
            GA++C+QAGT TEL +ADYFKA+ M+Y P+ F+R +E   A  + RCD    D S LYA
Sbjct: 145 DGATVCIQAGTDTELNVADYFKANKMQYTPVTFDRSDESAKALDSGRCDTLASDQSQLYA 204

Query: 204 LKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQ 263
           L++   +P E ++LP++ISK PL P + +GD +W+ IV WT +AM+ AEE+G+T KN+ +
Sbjct: 205 LRIKLGKPDEFIVLPEVISKEPLGPVVRRGDEDWFAIVRWTLFAMLNAEEMGVTSKNVEE 264

Query: 264 VSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIP 323
           ++   T PD+   LG  +  N G+ L +  DW  +I++ +GNYGE FDRN+G  SELKI 
Sbjct: 265 LAAKPTTPDMAHLLG--QEGNYGKDLKVPNDWVVKIVKQVGNYGESFDRNVGMGSELKIK 322

Query: 324 RGYNALWSKGGLMYAPPIR 342
           RG NALW+ GGL YAPP+R
Sbjct: 323 RGQNALWNNGGLQYAPPVR 341


>gi|209695504|ref|YP_002263433.1| general L-amino acid-binding periplasmic protein precursor
           [Aliivibrio salmonicida LFI1238]
 gi|208009456|emb|CAQ79742.1| general L-amino acid-binding periplasmic protein precursor
           [Aliivibrio salmonicida LFI1238]
          Length = 342

 Score =  357 bits (915), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 163/338 (48%), Positives = 230/338 (68%), Gaps = 3/338 (0%)

Query: 5   FFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFC 64
            F +I     L  T  +     L  + K G+L+CG++TGL GF+   + G+W+G DV++C
Sbjct: 8   LFAAIATSAALLSTQATAADGTLEKVVKNGYLQCGVSTGLPGFSNPNSKGEWEGIDVEYC 67

Query: 65  RALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYF 124
           +A+++A+  D +K++Y+PL AKERF ALQS +ID+LSRNT WTL R+ SLGL F  + Y+
Sbjct: 68  QAVAAAVLGDKTKVKYVPLTAKERFTALQSGEIDVLSRNTTWTLHRDTSLGLNFVGVNYY 127

Query: 125 DGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDA 184
           DGQGF++ K+ G++S  +L GAS+CVQ+GTTTEL LADYF+ ++M+Y P+VF+   +   
Sbjct: 128 DGQGFMVKKELGLTSAKELDGASVCVQSGTTTELNLADYFRNNSMEYKPVVFDTAAQTSK 187

Query: 185 AYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWT 244
            + A RCD  T D S LYAL+L    P    ILP+IISK PL P + QGD +W+NI  W 
Sbjct: 188 GFDAGRCDVLTTDQSGLYALRLNLKDPKTAQILPEIISKEPLGPVVRQGDDKWFNINKWV 247

Query: 245 HYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMG 304
             AM+ AEE GIT  N +Q+ K + +P+++R LG+D     G+ LG+  DW Y++I+ +G
Sbjct: 248 LSAMINAEEYGITSANADQMLK-SKDPNIKRILGVDGPK--GKGLGIRDDWGYQVIKQVG 304

Query: 305 NYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           NYGE F+R +G  S L+I RG NALW+ GG MYA PIR
Sbjct: 305 NYGESFERTVGTGSPLQISRGVNALWNAGGFMYAAPIR 342


>gi|123444011|ref|YP_001007981.1| ABC transporter periplasmic solute-binding protein [Yersinia
           enterocolitica subsp. enterocolitica 8081]
 gi|122090972|emb|CAL13855.1| Putative ABC transporter periplasmic solute binding protein
           [Yersinia enterocolitica subsp. enterocolitica 8081]
          Length = 341

 Score =  357 bits (915), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 157/319 (49%), Positives = 221/319 (69%), Gaps = 2/319 (0%)

Query: 24  ASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPL 83
            + L  +KK+GF++CGI+ GL GF+   A+G + G DVD CR +++AIF D  K++Y PL
Sbjct: 25  GTTLDAVKKKGFVQCGISDGLPGFSYADASGKFSGLDVDVCRGVAAAIFGDAEKVKYTPL 84

Query: 84  NAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQL 143
            AKERF ALQS ++DILSRNT WT  R+  +G+ F  + Y+DG GF+ H K G+ S  +L
Sbjct: 85  TAKERFTALQSGEVDILSRNTTWTSSRDAGMGMLFTGVNYYDGIGFLTHNKAGLKSAKEL 144

Query: 144 SGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYA 203
            GA++C+QAGT TEL +ADYFKA+ M+Y P+ F+R +E   A  + RCD    D S LYA
Sbjct: 145 DGATVCIQAGTDTELNVADYFKANKMQYTPVTFDRSDESAKALDSGRCDTLASDQSQLYA 204

Query: 204 LKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQ 263
           L++   +P E ++LP++ISK PL P + +GD +W+ IV WT +AM+ AEE+G+T KN+ +
Sbjct: 205 LRIKLGKPDEFIVLPEVISKEPLGPVVRRGDEDWFAIVRWTLFAMLNAEEMGVTSKNVEE 264

Query: 264 VSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIP 323
           ++   T PD+   LG  +  N G+ L +  DW  +I++ +GNYGE FDRN+G  SELKI 
Sbjct: 265 LAAKPTTPDMAHLLG--QEGNYGKDLKVPNDWVVKIVKQVGNYGESFDRNVGMGSELKIK 322

Query: 324 RGYNALWSKGGLMYAPPIR 342
           RG NALW+ GGL YAPP+R
Sbjct: 323 RGQNALWNNGGLQYAPPVR 341


>gi|238789893|ref|ZP_04633673.1| Extracellular solute-binding protein, family 3 [Yersinia
           frederiksenii ATCC 33641]
 gi|238721966|gb|EEQ13626.1| Extracellular solute-binding protein, family 3 [Yersinia
           frederiksenii ATCC 33641]
          Length = 341

 Score =  356 bits (914), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 157/319 (49%), Positives = 221/319 (69%), Gaps = 2/319 (0%)

Query: 24  ASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPL 83
            + L  +KK+GF++CGI+ GL GF+   A+G + G DVD CR +++AIF D  K++Y PL
Sbjct: 25  GTTLDAVKKKGFVQCGISDGLPGFSYADASGKFSGLDVDVCRGVAAAIFGDAEKVKYTPL 84

Query: 84  NAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQL 143
            AKERF ALQS ++DILSRNT WT  R+  +G+ F  + Y+DG GF+ H K G+ S  +L
Sbjct: 85  TAKERFTALQSGEVDILSRNTTWTSSRDAGMGMLFTGVNYYDGIGFLTHNKAGLKSAKEL 144

Query: 144 SGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYA 203
            GA++C+QAGT TEL +ADYFKA+ M+Y P+ F+R +E   A  + RCD    D S LYA
Sbjct: 145 DGATVCIQAGTDTELNVADYFKANKMQYTPVTFDRSDESAKALDSGRCDTLASDQSQLYA 204

Query: 204 LKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQ 263
           L++   +P E ++LP++ISK PL P + +GD +W+ IV WT +AM+ AEE+G+T KN+  
Sbjct: 205 LRIKLGKPDEFIVLPEVISKEPLGPVVRRGDEDWFAIVRWTLFAMLNAEEMGVTSKNVEA 264

Query: 264 VSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIP 323
           ++   + PD+   LG  +  N G+ L +  DW  +I++ +GNYGE FDRN+G  SELKI 
Sbjct: 265 LAAKPSTPDMAHLLG--QEGNYGKDLKVPNDWVVKIVKQVGNYGESFDRNVGMGSELKIK 322

Query: 324 RGYNALWSKGGLMYAPPIR 342
           RG NALW+KGGL YAPP+R
Sbjct: 323 RGQNALWNKGGLQYAPPVR 341


>gi|330862829|emb|CBX72970.1| putative amino-acid ABC transporter-binding protein yhdW [Yersinia
           enterocolitica W22703]
          Length = 341

 Score =  356 bits (914), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 157/319 (49%), Positives = 221/319 (69%), Gaps = 2/319 (0%)

Query: 24  ASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPL 83
            + L  +KK+GF++CGI+ GL GF+   A+G + G DVD CR +++AIF D  K++Y PL
Sbjct: 25  GTTLDAVKKKGFVQCGISDGLPGFSYADASGKFSGIDVDICRGVAAAIFGDAEKVKYTPL 84

Query: 84  NAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQL 143
            AKERF ALQS ++DILSRNT WT  R+  +G+ F  + Y+DG GF+ H K G+ S  +L
Sbjct: 85  TAKERFTALQSGEVDILSRNTTWTSSRDAGMGMLFTGVNYYDGIGFLTHNKAGLKSAKEL 144

Query: 144 SGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYA 203
            GA++C+QAGT TEL +ADYFKA+ M+Y P+ F+R +E   A  + RCD    D S LYA
Sbjct: 145 DGATVCIQAGTDTELNVADYFKANKMQYTPVTFDRSDESAKALDSGRCDTLASDQSQLYA 204

Query: 204 LKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQ 263
           L++   +P E ++LP++ISK PL P + +GD +W+ IV WT +AM+ AEE+G+T KN+ +
Sbjct: 205 LRIKLGKPDEFIVLPEVISKEPLGPVVRRGDEDWFAIVRWTLFAMLNAEEMGVTSKNVEE 264

Query: 264 VSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIP 323
           ++   T PD+   LG  +  N G+ L +  DW  +I++ +GNYGE FDRN+G  SELKI 
Sbjct: 265 LAAKPTTPDMAHLLG--QEGNYGKDLKVPNDWVVKIVKQVGNYGESFDRNVGMGSELKIK 322

Query: 324 RGYNALWSKGGLMYAPPIR 342
           RG NALW+ GGL YAPP+R
Sbjct: 323 RGQNALWNNGGLQYAPPVR 341


>gi|238782940|ref|ZP_04626968.1| Extracellular solute-binding protein, family 3 [Yersinia bercovieri
           ATCC 43970]
 gi|238716143|gb|EEQ08127.1| Extracellular solute-binding protein, family 3 [Yersinia bercovieri
           ATCC 43970]
          Length = 341

 Score =  356 bits (913), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 158/319 (49%), Positives = 220/319 (68%), Gaps = 2/319 (0%)

Query: 24  ASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPL 83
            + L  +KK+GF++CGI+ GL GF+   A+G + G DVD CR +++AIF D  K++Y PL
Sbjct: 25  GTTLDAVKKKGFVQCGISDGLPGFSYADASGKFSGLDVDVCRGVAAAIFGDAEKVKYTPL 84

Query: 84  NAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQL 143
            AKERF ALQS ++DILSRNT WT  R+  +G+ F  + Y+DG GF+ H K G+ S  +L
Sbjct: 85  TAKERFTALQSGEVDILSRNTTWTSSRDAGMGMLFTGVNYYDGIGFLTHNKAGLKSAKEL 144

Query: 144 SGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYA 203
            GA++C+QAGT TEL +ADYFKA+ M+Y P+ F+R +E   A  + RCD    D S LYA
Sbjct: 145 DGATVCIQAGTDTELNVADYFKANKMQYTPVTFDRSDESAKALDSGRCDTLASDQSQLYA 204

Query: 204 LKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQ 263
           L++   +P E ++LP++ISK PL P + +GD +W+ IV WT +AM+ AEE+G+T KN+  
Sbjct: 205 LRIKLGKPDEFIVLPEVISKEPLGPVVRRGDEDWFAIVRWTLFAMLNAEEMGVTSKNVEA 264

Query: 264 VSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIP 323
           ++   T PD+   LG  +  N G+ L +  DW  +I++ +GNYGE FDRN+G  SELKI 
Sbjct: 265 LAAKPTTPDMAHLLG--QEGNYGKDLKVPNDWVVKIVKQVGNYGESFDRNVGMGSELKIK 322

Query: 324 RGYNALWSKGGLMYAPPIR 342
           RG NALW+ GGL YAPPIR
Sbjct: 323 RGQNALWNSGGLQYAPPIR 341


>gi|311695087|gb|ADP97960.1| glutamate/glutamine/aspartate/asparagine ABC transporter,
           periplasmic substrate-binding protein [marine bacterium
           HP15]
          Length = 347

 Score =  355 bits (912), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 163/340 (47%), Positives = 232/340 (68%), Gaps = 3/340 (0%)

Query: 3   KDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVD 62
           K   + I   +  F  + +  A+ L ++K++G L+CG+ +GL GF++    G+W G DVD
Sbjct: 11  KSIALGIALAVGTFSATGAMAATTLENVKEKGHLQCGVTSGLPGFSQPDEKGNWTGIDVD 70

Query: 63  FCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPIT 122
            CRA+++AIF D + +++ PL AKERF ALQS +ID+LSRNT WTL R+ SLGL F  + 
Sbjct: 71  TCRAVAAAIFGDANAVEFTPLTAKERFTALQSGEIDMLSRNTTWTLTRDASLGLNFAGVN 130

Query: 123 YFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEI 182
           Y+DGQGF+++K  G+   +QL GA+IC+QAGTTTEL L+DYF+A  M++ PIVF+  E+ 
Sbjct: 131 YYDGQGFLINKGIGVDDATQLDGATICIQAGTTTELNLSDYFRAKGMEFKPIVFDTSEQT 190

Query: 183 DAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVS 242
              + A RCD  T D S L AL+     PS   ILP+ ISK PL P + QGD +W+NIV 
Sbjct: 191 VQGFAAGRCDVLTSDRSQLAALRSKLSDPSSAKILPNTISKEPLGPVVRQGDDQWFNIVK 250

Query: 243 WTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRH 302
           W  +A + AEELG+T  N + + K + NP++QR LG D   ++G  LGL  D+ Y+ ++ 
Sbjct: 251 WVLFAQINAEELGVTSANADDMLK-SDNPNIQRLLGTD--GDMGAKLGLPDDFGYQAVKL 307

Query: 303 MGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           +GNYGEM+DRN+G  + L + RG NALW++GG+MYAPP+R
Sbjct: 308 VGNYGEMYDRNVGPDTPLGLDRGINALWTEGGIMYAPPVR 347


>gi|330808961|ref|YP_004353423.1| putative amino acid ABC transporter, periplasmic component
           [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
 gi|327377069|gb|AEA68419.1| putative amino acid ABC transporter, periplasmic component
           [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
          Length = 346

 Score =  355 bits (912), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 161/336 (47%), Positives = 233/336 (69%), Gaps = 3/336 (0%)

Query: 8   SILCLIILFFTSFSTNA-SILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRA 66
           ++ CL +    + + +A + L ++KK+GF++CGI+ GL GF+   A G++ GFDVD CRA
Sbjct: 13  TVACLTLGSVFAITAHAGATLDNVKKKGFVQCGISDGLPGFSYADAKGEFHGFDVDVCRA 72

Query: 67  LSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDG 126
           +++A+F D  K++Y  L AKERF ALQS ++D+LSR+T WT  R+ ++G+ F  + Y+DG
Sbjct: 73  VAAAVFGDAKKVKYTQLTAKERFTALQSGEVDMLSRSTTWTSSRDGAMGIQFTNVAYYDG 132

Query: 127 QGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAY 186
           QGF+++KK G+ S  +L GA+ C+QAGT TEL L+DYF+++ MKY PI F+  +E   A 
Sbjct: 133 QGFLVNKKLGVKSARELDGATFCIQAGTVTELNLSDYFRSNGMKYTPITFDTSDESFKAL 192

Query: 187 RAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHY 246
            + RCD  T D S LY  +L    P +  +LPD+ISK PL PA+ +GD +W+ +V W+  
Sbjct: 193 ESGRCDVLTTDQSQLYGQRLKLATPDDFAVLPDVISKEPLTPAVRRGDEDWFTVVRWSLA 252

Query: 247 AMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNY 306
           AM+ AEELGIT KN+  + K + NPD+ R LG + +  +G+ L L  DW  +II  +GNY
Sbjct: 253 AMLNAEELGITSKNVADMVKSSKNPDIARLLGTEGA--LGKDLNLPNDWAAKIIAQVGNY 310

Query: 307 GEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           GE F+RNLG  S++KI RG NALWS+GGL YAPP+R
Sbjct: 311 GESFERNLGTGSDMKIKRGLNALWSQGGLQYAPPVR 346


>gi|229592512|ref|YP_002874631.1| putative ABC transporter periplasmic solute binding protein
           [Pseudomonas fluorescens SBW25]
 gi|229364378|emb|CAY52154.1| Putative ABC transport system, periplasmic solute binding protein
           [Pseudomonas fluorescens SBW25]
          Length = 342

 Score =  355 bits (911), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 161/341 (47%), Positives = 227/341 (66%), Gaps = 2/341 (0%)

Query: 2   YKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDV 61
           +K    +I     L   S +     L  I+K+GF++CG++ GL GF    +NG   G DV
Sbjct: 4   FKTTLAAIGATAALGLASTAQAGVTLDAIQKKGFIQCGVSDGLPGFGVPDSNGKMTGIDV 63

Query: 62  DFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPI 121
           D C A+++A+F D SK+++  L AKERF ALQS +ID++SRNT WT  R+  +GL F  +
Sbjct: 64  DVCHAVAAAVFGDASKVKFTQLTAKERFTALQSGEIDMISRNTTWTSSRDSGMGLVFTGV 123

Query: 122 TYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEE 181
           TY+DG GF+++ K G++   QL GA++C+QAGTTTEL ++DYF+ + MKY PI F+  +E
Sbjct: 124 TYYDGIGFLVNNKLGVTGAKQLDGATVCIQAGTTTELNVSDYFRTNGMKYTPITFDTADE 183

Query: 182 IDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIV 241
                 A RCD  T D S LYA ++    P E V+LP++ISK PL P + +GD EW++IV
Sbjct: 184 SAKGLEAGRCDVLTTDQSGLYAQRIKMAHPDEFVVLPEVISKEPLGPLVRKGDDEWFSIV 243

Query: 242 SWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIR 301
            WT +AM+ AEE+GIT +N+ + +K T NPD+ R LG D     G+ L L KDW  +I++
Sbjct: 244 KWTLFAMLNAEEMGITSQNVEEQAKTTKNPDIARLLGAD--GEYGKDLKLRKDWVVQIVK 301

Query: 302 HMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
            +GNYGE+F+RN+G  S LKI RG NALW+ GG+ YAPP+R
Sbjct: 302 QVGNYGEVFERNIGQGSVLKIKRGLNALWNNGGIQYAPPVR 342


>gi|238798512|ref|ZP_04641991.1| Extracellular solute-binding protein, family 3 [Yersinia mollaretii
           ATCC 43969]
 gi|238717674|gb|EEQ09511.1| Extracellular solute-binding protein, family 3 [Yersinia mollaretii
           ATCC 43969]
          Length = 341

 Score =  355 bits (911), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 156/319 (48%), Positives = 220/319 (68%), Gaps = 2/319 (0%)

Query: 24  ASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPL 83
            + L  +KK+GF++CGI+ GL GF+   A+G + G DVD CR +++AIF D  K++Y PL
Sbjct: 25  GTTLDAVKKKGFVQCGISDGLPGFSYADASGKFSGLDVDVCRGVAAAIFGDAEKVKYTPL 84

Query: 84  NAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQL 143
            AKERF ALQS ++DILSRNT WT  R+  +G+ F  + Y+DG GF+ H K G+ S  +L
Sbjct: 85  TAKERFTALQSGEVDILSRNTTWTSSRDAGMGMLFTGVNYYDGIGFLTHNKAGLKSAKEL 144

Query: 144 SGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYA 203
            GA++C+QAGT TEL +ADYFKA+ M+Y P+ F+R +E   A  + RCD    D S LYA
Sbjct: 145 DGATVCIQAGTDTELNVADYFKANKMQYTPVTFDRSDESAKALDSGRCDTLASDQSQLYA 204

Query: 204 LKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQ 263
           L++   +P E ++LP++ISK PL P + +GD +W+ +V WT +AM+ AEE+G+T KN+  
Sbjct: 205 LRIKLGKPDEFIVLPEVISKEPLGPVVRRGDEDWFAVVRWTLFAMLNAEEMGVTSKNVEA 264

Query: 264 VSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIP 323
           ++   T PD+   LG  +  N G+ L +  DW  +I++ +GNYGE FDRN+G  SELKI 
Sbjct: 265 LAAKPTTPDMAHLLG--QEGNYGKDLKVPNDWVVKIVKQVGNYGESFDRNVGMGSELKIK 322

Query: 324 RGYNALWSKGGLMYAPPIR 342
           RG NALW+ GGL YAPP+R
Sbjct: 323 RGQNALWNNGGLQYAPPVR 341


>gi|312962948|ref|ZP_07777434.1| extracellular solute-binding protein, family 3 [Pseudomonas
           fluorescens WH6]
 gi|311282717|gb|EFQ61312.1| extracellular solute-binding protein, family 3 [Pseudomonas
           fluorescens WH6]
          Length = 342

 Score =  355 bits (911), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 158/340 (46%), Positives = 229/340 (67%), Gaps = 2/340 (0%)

Query: 3   KDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVD 62
           K    ++   +IL     +   + L  I+K+GF++CG++ GL GF    + G   G DVD
Sbjct: 5   KTSLAAVSVAVILGLAGSAHAGTTLDAIQKKGFIQCGVSDGLPGFGVPDSQGKMTGIDVD 64

Query: 63  FCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPIT 122
            C A+++A+F D SK+++  L AKERF ALQS +ID++SRNT WT  R+  +GL F  +T
Sbjct: 65  VCHAVAAAVFGDASKVKFTQLTAKERFTALQSGEIDLISRNTTWTSSRDSGMGLVFTGVT 124

Query: 123 YFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEI 182
           Y+DG GF+++ K G+++  QL+GA++C+QAGTTTEL ++DYF+ H MKY PI F+  +E 
Sbjct: 125 YYDGIGFLVNNKLGVTAAKQLNGATVCIQAGTTTELNVSDYFRTHGMKYTPITFDTADES 184

Query: 183 DAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVS 242
                A RCD  T D S LYA ++    P E V+LP++ISK PL P + +GD EW++IV 
Sbjct: 185 AKGLEAGRCDVLTTDQSGLYAQRIKMAHPEEFVVLPEVISKEPLGPLVRKGDDEWFSIVK 244

Query: 243 WTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRH 302
           WT +AM+ AEE+GIT +N+ + ++ + NPDV R LG D     G+ L L +DW  +I++ 
Sbjct: 245 WTLFAMLNAEEMGITSQNVEEQARTSKNPDVARLLGAD--GEYGKDLKLRRDWVVQIVKQ 302

Query: 303 MGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           +GNYGE+F+RN+G  S LKI RG NALW+ GG+ YAPP+R
Sbjct: 303 VGNYGEVFERNIGQGSVLKIKRGLNALWNNGGIQYAPPVR 342


>gi|197336291|ref|YP_002156345.1| general L-amino acid-binding periplasmic protein AapJ [Vibrio
           fischeri MJ11]
 gi|197317781|gb|ACH67228.1| general L-amino acid-binding periplasmic protein AapJ [Vibrio
           fischeri MJ11]
          Length = 342

 Score =  355 bits (911), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 159/316 (50%), Positives = 225/316 (71%), Gaps = 3/316 (0%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           L  ++K G+L+CG++TGL GF+   + G+W+G DV+FC+A+++A+  D SK++Y+PL AK
Sbjct: 30  LEKVQKNGYLQCGVSTGLPGFSNPNSKGEWEGIDVEFCQAVAAAVLGDKSKVKYVPLTAK 89

Query: 87  ERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGA 146
           ERF ALQS +ID+LSRNT WTL R+ SLGL F  + Y+DGQGF++ K+ G++S  +L GA
Sbjct: 90  ERFTALQSGEIDVLSRNTTWTLHRDTSLGLNFVGVNYYDGQGFMVKKELGLTSAKELDGA 149

Query: 147 SICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKL 206
           S+CVQ+GTTTEL LADYF+ +NM+Y P+VF+   +    + A RCD  T D S LYAL+L
Sbjct: 150 SVCVQSGTTTELNLADYFRNNNMEYKPVVFDTAAQTSKGFDAGRCDVLTTDQSGLYALRL 209

Query: 207 TNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSK 266
               P    +LP+IISK PL P + QGD +W+NI  W   AM+ AEE  I+ KN +Q+ K
Sbjct: 210 NLKDPKTAQVLPEIISKEPLGPVVRQGDDQWFNINKWVLNAMINAEEYDISSKNADQMLK 269

Query: 267 DTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGY 326
            + +P+++R LG+D     G+ LG+  DW Y++++ +GNYGE F+R +G  S L+I RG 
Sbjct: 270 -SKDPNIKRILGVDGPK--GKGLGIRDDWGYQVVKQVGNYGESFERTVGEGSPLQISRGV 326

Query: 327 NALWSKGGLMYAPPIR 342
           NALW+ GG MYA PIR
Sbjct: 327 NALWNAGGFMYAAPIR 342


>gi|26988032|ref|NP_743457.1| general amino acid ABC transporter, periplasmic binding protein
           [Pseudomonas putida KT2440]
 gi|24982752|gb|AAN66921.1|AE016320_9 general amino acid ABC transporter, periplasmic binding protein
           [Pseudomonas putida KT2440]
          Length = 342

 Score =  355 bits (910), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 159/324 (49%), Positives = 227/324 (70%), Gaps = 2/324 (0%)

Query: 19  SFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKI 78
           S +   + L  +KK+GF++CG++ GL GF+   A G   G D D CRA+++A+F D +K+
Sbjct: 21  STAQAGATLDAVKKKGFVQCGVSDGLPGFSVPDAQGKIVGIDADVCRAVAAAVFGDATKV 80

Query: 79  QYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGIS 138
           ++  LNAKERF ALQS ++D+LSRNT WT  R+  +GL F  +TY+DG GF+++KK G+S
Sbjct: 81  KFSQLNAKERFTALQSGEVDVLSRNTTWTSSRDAGMGLVFAGVTYYDGVGFLVNKKLGVS 140

Query: 139 SVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDI 198
           S  +L GA+IC+QAGTTTEL ++D+F+A+ +KY PI F+  +E   +  + RCD  T D 
Sbjct: 141 SAKELDGATICIQAGTTTELNVSDFFRANGLKYTPITFDTSDESAKSLESGRCDVLTSDK 200

Query: 199 SALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQ 258
           S L+A +     P+E+V+LP+ ISK PL P + +GD EW++IV WT +AM+ AEE GIT 
Sbjct: 201 SQLFAQRSKLAAPTEYVVLPETISKEPLGPVVRKGDEEWFSIVKWTLFAMLNAEEAGITS 260

Query: 259 KNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQS 318
           KN+   +K T NPDV R LG D     G+ L L KDW  +I++ +GNYGE+F++NLG  +
Sbjct: 261 KNVEAEAKATKNPDVARLLGAD--GEYGKDLKLPKDWVVQIVKQVGNYGEVFEKNLGQST 318

Query: 319 ELKIPRGYNALWSKGGLMYAPPIR 342
           +LKI RG NALW+ GG+ YAPP+R
Sbjct: 319 DLKIDRGMNALWNNGGIQYAPPVR 342


>gi|296533466|ref|ZP_06896047.1| cationic amino acid ABC superfamily ATP binding cassette
           transporter, periplasmic binding protein [Roseomonas
           cervicalis ATCC 49957]
 gi|296266210|gb|EFH12254.1| cationic amino acid ABC superfamily ATP binding cassette
           transporter, periplasmic binding protein [Roseomonas
           cervicalis ATCC 49957]
          Length = 350

 Score =  355 bits (910), Expect = 8e-96,   Method: Compositional matrix adjust.
 Identities = 162/319 (50%), Positives = 221/319 (69%), Gaps = 5/319 (1%)

Query: 24  ASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPL 83
           ++ L  IK RG L CG+NTGL GFA+  + G W GFDV++CRAL+ A+F+D SK++Y+P 
Sbjct: 37  SATLDAIKARGTLSCGVNTGLAGFAQPDSQGRWTGFDVEYCRALAVALFNDASKVRYVPT 96

Query: 84  NAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQL 143
            A+ RF ALQS +ID+L RNT  TL R+ SLGL F  I ++DGQGF++    G+ S  +L
Sbjct: 97  TAQNRFTALQSGEIDVLPRNTTATLSRDTSLGLDFPAINFYDGQGFMVKASLGVKSAKEL 156

Query: 144 SGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYA 203
            GA++CVQ GTTTE  L D+F+A+N+++ P++ ER+EE+ +AY A RCDAYT D+S L A
Sbjct: 157 DGATVCVQPGTTTEQNLTDWFRANNIRFTPVIIERLEELVSAYVAGRCDAYTTDVSGLAA 216

Query: 204 LKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQ 263
            +     P EHVILP++ISK PL PA+  GD  W ++V WTHYA++ AEE GIT  N+++
Sbjct: 217 TRSAQPNPGEHVILPEVISKEPLGPAVRHGDQRWADLVRWTHYALLAAEEFGITAANVDK 276

Query: 264 VSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIP 323
              +   P+VQR LG  K+  +G+ LG+   W  RII+  GNYGEMF R+L   + L I 
Sbjct: 277 AVAEDQRPEVQRLLG--KTGGLGQMLGVDNAWAARIIKATGNYGEMFTRHL---TPLGIQ 331

Query: 324 RGYNALWSKGGLMYAPPIR 342
           RG NA W++GGL YA P R
Sbjct: 332 RGPNAQWTQGGLQYAQPFR 350


>gi|27376134|ref|NP_767663.1| amino acid binding protein [Bradyrhizobium japonicum USDA 110]
 gi|27349273|dbj|BAC46288.1| bll1023 [Bradyrhizobium japonicum USDA 110]
          Length = 345

 Score =  354 bits (909), Expect = 8e-96,   Method: Compositional matrix adjust.
 Identities = 155/311 (49%), Positives = 227/311 (72%), Gaps = 3/311 (0%)

Query: 32  KRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERFLA 91
           +RG + CG+N GL GF+     G+W GFDVDFCRA+++AIF+DP+K +++ L+A ERF  
Sbjct: 38  RRGEVLCGVNKGLPGFSIPDDKGNWTGFDVDFCRAVAAAIFNDPAKAKFVALDASERFKE 97

Query: 92  LQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASICVQ 151
           LQS+++DILSRN+ W++ RE+   L F  + Y+DG GF++ + +   +   L+G+ +CVQ
Sbjct: 98  LQSRKVDILSRNSTWSMARELDYDLYFPAVAYYDGAGFMLPRSRNKETSLDLTGSKVCVQ 157

Query: 152 AGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTNDRP 211
            GTTT L ++DYF+A+NMKY  + F++++++  AY   +CD  + D+S LYAL+L   +P
Sbjct: 158 TGTTTALNVSDYFRANNMKYEEVKFDKLDDVVKAYDTGKCDTLSADVSQLYALRLNLSKP 217

Query: 212 SEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTTNP 271
            +H+ILPD+ISK PLAP + Q D +W  IV WT YAM+ AEELG++ +NI++  K +  P
Sbjct: 218 GDHMILPDMISKEPLAPVVRQRDDDWMMIVKWTLYAMINAEELGVSSENIDEALK-SKKP 276

Query: 272 DVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNALWS 331
           +V R +G +   N GE LGLTKDW  RIIR++GNYGEM++RN+G +S+LKIPRG N LW+
Sbjct: 277 EVMRLVGTE--GNYGEQLGLTKDWVVRIIRNVGNYGEMYERNIGEKSKLKIPRGMNQLWN 334

Query: 332 KGGLMYAPPIR 342
            GG+ YAPP+R
Sbjct: 335 AGGVQYAPPMR 345


>gi|300817474|ref|ZP_07097690.1| lysine-arginine-ornithine-binding periplasmic protein [Escherichia
           coli MS 107-1]
 gi|300824982|ref|ZP_07105081.1| lysine-arginine-ornithine-binding periplasmic protein [Escherichia
           coli MS 119-7]
 gi|331670093|ref|ZP_08370938.1| putative amino-acid ABC transporter-binding protein YhdW
           [Escherichia coli TA271]
 gi|331679342|ref|ZP_08380014.1| putative amino-acid ABC transporter-binding protein YhdW
           [Escherichia coli H591]
 gi|300522548|gb|EFK43617.1| lysine-arginine-ornithine-binding periplasmic protein [Escherichia
           coli MS 119-7]
 gi|300529772|gb|EFK50834.1| lysine-arginine-ornithine-binding periplasmic protein [Escherichia
           coli MS 107-1]
 gi|331063006|gb|EGI34920.1| putative amino-acid ABC transporter-binding protein YhdW
           [Escherichia coli TA271]
 gi|331073407|gb|EGI44730.1| putative amino-acid ABC transporter-binding protein YhdW
           [Escherichia coli H591]
          Length = 341

 Score =  354 bits (909), Expect = 9e-96,   Method: Compositional matrix adjust.
 Identities = 155/319 (48%), Positives = 225/319 (70%), Gaps = 2/319 (0%)

Query: 24  ASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPL 83
            + L  ++K+GF++CGI+ GL GF+   A+G + G DVD CR +++A+F D +K++Y PL
Sbjct: 25  GATLDAVQKKGFVQCGISDGLPGFSYADADGKFSGIDVDVCRGVAAAVFGDDTKVKYTPL 84

Query: 84  NAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQL 143
            AKERF ALQS ++D+LSRNT WT  R+  +G+AF  +TY+DG GF+ H K G+ S  +L
Sbjct: 85  TAKERFTALQSGEVDLLSRNTTWTSSRDAGMGMAFTGVTYYDGIGFLTHDKAGLKSAKEL 144

Query: 144 SGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYA 203
            GA++C+QAGT TEL +ADYFKA+NMKY P+ F+R +E   A  + RCD    D S LYA
Sbjct: 145 DGATVCIQAGTDTELNVADYFKANNMKYTPVTFDRSDESAKALESGRCDTLASDQSQLYA 204

Query: 204 LKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQ 263
           L++    P+E ++LP++ISK PL PA+ +GD EW++IV WT +AM+ AEE+GI  +N+++
Sbjct: 205 LRIKLSNPAEWIVLPEVISKEPLGPAVRRGDDEWFSIVRWTLFAMLNAEEMGINSQNVDE 264

Query: 264 VSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIP 323
            + +   PD+   LG  K  + G+ L L   W Y II+ +GNY E+F+RN+G++S LKI 
Sbjct: 265 KAANPATPDMAHLLG--KEGDYGKDLKLDNKWAYNIIKQVGNYSEIFERNVGSESPLKIK 322

Query: 324 RGYNALWSKGGLMYAPPIR 342
           RG N LW+ GG+ YAPP+R
Sbjct: 323 RGQNNLWNNGGIQYAPPVR 341


>gi|238794642|ref|ZP_04638248.1| Extracellular solute-binding protein, family 3 [Yersinia intermedia
           ATCC 29909]
 gi|238726031|gb|EEQ17579.1| Extracellular solute-binding protein, family 3 [Yersinia intermedia
           ATCC 29909]
          Length = 341

 Score =  354 bits (909), Expect = 9e-96,   Method: Compositional matrix adjust.
 Identities = 156/319 (48%), Positives = 220/319 (68%), Gaps = 2/319 (0%)

Query: 24  ASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPL 83
            + L  +KK+GF++CGI+ GL GF+   A+G + G DVD CR +++A+F D  K++Y PL
Sbjct: 25  GTTLDAVKKKGFVQCGISDGLPGFSYADASGKFSGLDVDVCRGVAAAVFGDAEKVKYTPL 84

Query: 84  NAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQL 143
            AKERF ALQS ++DILSRNT WT  R+  +G+ F  + Y+DG GF+ H K G+ S  +L
Sbjct: 85  TAKERFTALQSGEVDILSRNTTWTSSRDAGMGMLFTGVNYYDGIGFLTHNKAGLKSAKEL 144

Query: 144 SGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYA 203
            GA++C+QAGT TEL +ADYFKA+ M+Y P+ F+R +E   A  + RCD    D S LYA
Sbjct: 145 DGATVCIQAGTDTELNVADYFKANKMQYTPVTFDRSDESAKALDSGRCDTLASDQSQLYA 204

Query: 204 LKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQ 263
           L++   +P E ++LP++ISK PL P + +GD +W+ IV WT +AM+ AEE+G+T KN+  
Sbjct: 205 LRIKLGKPDEFIVLPEVISKEPLGPVVRRGDEDWFAIVRWTLFAMLNAEEMGVTSKNVEA 264

Query: 264 VSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIP 323
           ++   T PD+   LG  +  N G+ L +  DW  +I++ +GNYGE FDRN+G  SELKI 
Sbjct: 265 LAAKPTTPDMAHLLG--QEGNYGKDLKVPNDWVVKIVKQVGNYGESFDRNVGLGSELKIK 322

Query: 324 RGYNALWSKGGLMYAPPIR 342
           RG NALW+ GGL YAPP+R
Sbjct: 323 RGQNALWNNGGLQYAPPVR 341


>gi|15599053|ref|NP_252547.1| amino acid-binding protein [Pseudomonas aeruginosa PAO1]
 gi|218889858|ref|YP_002438722.1| putative amino acid-binding protein [Pseudomonas aeruginosa LESB58]
 gi|254236763|ref|ZP_04930086.1| hypothetical protein PACG_02773 [Pseudomonas aeruginosa C3719]
 gi|254242550|ref|ZP_04935872.1| hypothetical protein PA2G_03302 [Pseudomonas aeruginosa 2192]
 gi|9950036|gb|AAG07245.1|AE004803_1 probable amino acid-binding protein [Pseudomonas aeruginosa PAO1]
 gi|126168694|gb|EAZ54205.1| hypothetical protein PACG_02773 [Pseudomonas aeruginosa C3719]
 gi|126195928|gb|EAZ59991.1| hypothetical protein PA2G_03302 [Pseudomonas aeruginosa 2192]
 gi|218770081|emb|CAW25843.1| probable amino acid-binding protein [Pseudomonas aeruginosa LESB58]
          Length = 341

 Score =  354 bits (909), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 156/334 (46%), Positives = 235/334 (70%), Gaps = 2/334 (0%)

Query: 9   ILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALS 68
           +L  + L  ++ +   + L  +K++G+++CG++ GL GF+   A G +KG DVD CRAL+
Sbjct: 10  LLAAVCLGASATAEAGATLDAVKRKGYVQCGVSDGLPGFSYADAKGRFKGLDVDICRALA 69

Query: 69  SAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQG 128
           +A+F D  K+++ PL+A ERF ALQS  +D+LSRNT WT  R+ +LG+ F  +TYFDGQG
Sbjct: 70  AALFGDAEKVRFTPLSATERFSALQSGTVDLLSRNTSWTSSRDTALGIHFTGVTYFDGQG 129

Query: 129 FIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRA 188
           F++++K G+SS  +L  A++C+Q+GTT EL +ADYF+AH ++Y  ++ +  E+   A  A
Sbjct: 130 FLVNRKLGVSSARELKDATVCIQSGTTNELNVADYFRAHGIRYKAVLDDSYEKSARALEA 189

Query: 189 HRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAM 248
            +CD  + D S LYA +L   +P ++V+LP++ISK PL PA+ QGD  W+NIV WT Y +
Sbjct: 190 GQCDVLSSDQSQLYAQRLKLAKPEQYVVLPEVISKEPLGPAVRQGDEAWFNIVRWTLYGL 249

Query: 249 VTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGE 308
           + AEELG+T  N+ + ++D+ NPDV R LG +   + G+ L L +DW  +++R +GNYGE
Sbjct: 250 LNAEELGVTSSNVERQARDSRNPDVARLLGSE--GDAGKDLQLPRDWVVQMVRQVGNYGE 307

Query: 309 MFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           +F RN+G+ S LK+PRG NA W+ GGL YAPPIR
Sbjct: 308 IFARNVGDGSPLKMPRGLNAQWNLGGLHYAPPIR 341


>gi|59712139|ref|YP_204915.1| general L-amino acid-binding protein [Vibrio fischeri ES114]
 gi|59480240|gb|AAW86027.1| general L-amino acid-binding protein [Vibrio fischeri ES114]
          Length = 342

 Score =  354 bits (909), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 158/316 (50%), Positives = 225/316 (71%), Gaps = 3/316 (0%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           L  ++K G+L+CG++TGL GF+   + G+W+G DV+FC+A+++A+  D SK++Y+PL AK
Sbjct: 30  LEKVQKNGYLQCGVSTGLPGFSNPNSKGEWEGIDVEFCQAVAAAVLGDKSKVKYVPLTAK 89

Query: 87  ERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGA 146
           ERF ALQS +ID+LSRNT WTL R+ SLGL F  + Y+DGQGF++ K+ G++S  +L GA
Sbjct: 90  ERFTALQSGEIDVLSRNTTWTLHRDTSLGLNFVGVNYYDGQGFMVKKELGLTSAKELDGA 149

Query: 147 SICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKL 206
           S+CVQ+GTTTEL LADYF+ +NM+Y P+VF+   +    + A RCD  T D S LYAL+L
Sbjct: 150 SVCVQSGTTTELNLADYFRNNNMEYKPVVFDTAAQTSKGFDAGRCDVLTTDQSGLYALRL 209

Query: 207 TNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSK 266
               P    +LP+IISK PL P + QGD +W+NI  W    M+ AEE GI+ KN +Q+ K
Sbjct: 210 NLKDPKTAQVLPEIISKEPLGPVVRQGDDQWFNINKWVLNTMINAEEYGISSKNADQMLK 269

Query: 267 DTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGY 326
            + +P+++R LG+D     G+ LG+  DW Y++++ +GNYGE F+R +G  S L+I RG 
Sbjct: 270 -SKDPNIKRILGVDGPK--GKGLGIRDDWGYQVVKQVGNYGESFERTVGEGSPLQISRGV 326

Query: 327 NALWSKGGLMYAPPIR 342
           NALW+ GG +YA PIR
Sbjct: 327 NALWNAGGFVYAAPIR 342


>gi|300718662|ref|YP_003743465.1| L-amino acid ABC transporter, solute-binding protein [Erwinia
           billingiae Eb661]
 gi|299064498|emb|CAX61618.1| L-amino acid ABC transporter, solute-binding protein [Erwinia
           billingiae Eb661]
          Length = 341

 Score =  354 bits (908), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 159/319 (49%), Positives = 223/319 (69%), Gaps = 2/319 (0%)

Query: 24  ASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPL 83
            + L  IKK+GF++CGI+ GL GF+   A+G + G DVD CRA ++A+F D +K++Y PL
Sbjct: 25  GTTLDAIKKKGFIQCGISDGLPGFSFADASGKFSGIDVDVCRAAAAAVFGDATKVKYTPL 84

Query: 84  NAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQL 143
            AKERF ALQS ++DILSRNT WT  R+  +G  F  + Y+DG GF+ H+K G+ S  +L
Sbjct: 85  TAKERFTALQSGEVDILSRNTTWTSARDGGMGFIFAGVNYYDGIGFLTHQKAGLKSAKEL 144

Query: 144 SGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYA 203
            GA++C+QAGT TEL +ADYFKA+NM+Y P+ F+R +E   A    RCD    D S LYA
Sbjct: 145 DGATVCIQAGTDTELNVADYFKANNMQYTPVTFDRSDESAKALDTGRCDTLASDQSQLYA 204

Query: 204 LKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQ 263
           L++   +P+E ++LP++ISK PL P + +GD +W+ IV W+ YAM+ AEE+GIT  N++Q
Sbjct: 205 LRIKLGKPNEFIVLPEVISKEPLGPVVRRGDDDWFTIVKWSLYAMLNAEEMGITSANVDQ 264

Query: 264 VSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIP 323
           ++   TNPD+   LG     + G+ L L   W Y I++ +GNY E+FDRN+G  S+LKI 
Sbjct: 265 LAAKPTNPDMAHLLG--SEGDFGKDLKLDNKWAYNIVKQVGNYQEVFDRNVGKDSQLKIA 322

Query: 324 RGYNALWSKGGLMYAPPIR 342
           RG NALW+KGG+ YAPP+R
Sbjct: 323 RGQNALWNKGGIQYAPPVR 341


>gi|167035543|ref|YP_001670774.1| extracellular solute-binding protein [Pseudomonas putida GB-1]
 gi|166862031|gb|ABZ00439.1| extracellular solute-binding protein family 3 [Pseudomonas putida
           GB-1]
          Length = 342

 Score =  354 bits (908), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 158/319 (49%), Positives = 226/319 (70%), Gaps = 2/319 (0%)

Query: 24  ASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPL 83
            + L  +KK+GF++CG++ GL GF+   A G   G D D CRA+++A+F D +K+++  L
Sbjct: 26  GATLDAVKKKGFVQCGVSDGLPGFSVPDAQGKIVGIDADVCRAVAAAVFGDATKVKFSQL 85

Query: 84  NAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQL 143
           NAKERF ALQS ++D+LSRNT WT  R+  +GL F  +TY+DG GF+++KK G+SS  +L
Sbjct: 86  NAKERFTALQSGEVDVLSRNTTWTSSRDAGMGLVFAGVTYYDGVGFLVNKKLGVSSAKEL 145

Query: 144 SGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYA 203
            GA+IC+QAGTTTEL ++D+F+A+N+KY PI F+  +E   +  + RCD  T D S L+A
Sbjct: 146 DGATICIQAGTTTELNVSDFFRANNLKYTPITFDTSDESAKSLESGRCDVLTSDKSQLFA 205

Query: 204 LKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQ 263
            +     P+++V+LP+ ISK PL P + +GD EW++IV WT +AM+ AEE GIT KN+  
Sbjct: 206 QRSKLAAPTDYVVLPETISKEPLGPVVRKGDEEWFSIVKWTLFAMLNAEEAGITSKNVEA 265

Query: 264 VSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIP 323
            +K T NPDV R LG D     G+ L L KDW  +I++ +GNYGE+F++NLG  ++LKI 
Sbjct: 266 EAKATKNPDVARLLGGD--GEYGKDLKLPKDWVVQIVKQVGNYGEVFEKNLGQSTDLKID 323

Query: 324 RGYNALWSKGGLMYAPPIR 342
           RG NALW+ GG+ YAPP+R
Sbjct: 324 RGMNALWNNGGIQYAPPVR 342


>gi|152989661|ref|YP_001346638.1| putative amino acid-binding protein [Pseudomonas aeruginosa PA7]
 gi|150964819|gb|ABR86844.1| probable amino acid-binding protein [Pseudomonas aeruginosa PA7]
          Length = 341

 Score =  354 bits (908), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 153/319 (47%), Positives = 229/319 (71%), Gaps = 2/319 (0%)

Query: 24  ASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPL 83
            + L  +K++G+L+CG++ GL GF+   A G ++G DVDFCRAL++A+F D  K+++ PL
Sbjct: 25  GATLDAVKRKGYLQCGVSDGLAGFSYADAKGRYQGLDVDFCRALAAALFGDAGKVRFTPL 84

Query: 84  NAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQL 143
           +  ERF ALQS  +D+LSRNT WT  R+ +LG+ F  +TYFDGQGF+++++ G+SS  +L
Sbjct: 85  STTERFSALQSGTVDLLSRNTSWTSARDTALGIHFTGVTYFDGQGFLVNRRLGVSSAREL 144

Query: 144 SGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYA 203
             A++C+Q+GTT EL +ADYF+AH ++Y  ++ +  E+   A  A +CD  + D S LYA
Sbjct: 145 KDATVCIQSGTTNELNVADYFRAHGIRYKAVLDDSYEKSARALEAGQCDVLSSDQSQLYA 204

Query: 204 LKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQ 263
            +L   +P ++V+LP++ISK PL PA+ QGD  W+NIV WT Y ++ AEELG+T  N+ +
Sbjct: 205 QRLKLAKPEQYVVLPEVISKEPLGPAVRQGDEAWFNIVRWTLYGLLNAEELGVTSSNVER 264

Query: 264 VSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIP 323
            ++D+ NPDV R LG +   ++G+ L L +DW  +++R +GNYGE+F RN+G+ S LK+P
Sbjct: 265 QARDSRNPDVARLLGSE--GDVGKDLQLPRDWVVQMVRQVGNYGEIFARNVGDGSPLKMP 322

Query: 324 RGYNALWSKGGLMYAPPIR 342
           RG NA W+ GGL YAPPIR
Sbjct: 323 RGLNAQWNLGGLHYAPPIR 341


>gi|84394265|ref|ZP_00992991.1| ABC-type amino acid transport, signal transduction system,
           periplasmic component/domain [Vibrio splendidus 12B01]
 gi|86148624|ref|ZP_01066906.1| ABC-type amino acid transport, signal transduction
           systems,periplasmic component/domain [Vibrio sp. MED222]
 gi|218709394|ref|YP_002417015.1| amino acid ABC transporter [Vibrio splendidus LGP32]
 gi|84375104|gb|EAP92025.1| ABC-type amino acid transport, signal transduction system,
           periplasmic component/domain [Vibrio splendidus 12B01]
 gi|85833580|gb|EAQ51756.1| ABC-type amino acid transport, signal transduction
           systems,periplasmic component/domain [Vibrio sp. MED222]
 gi|218322413|emb|CAV18566.1| Amino acid ABC transporter [Vibrio splendidus LGP32]
          Length = 342

 Score =  354 bits (908), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 158/318 (49%), Positives = 223/318 (70%), Gaps = 3/318 (0%)

Query: 25  SILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLN 84
           S L  +  +GFL CG++TGL GF+   + G+W+G DV++C+AL++A+  D +K++Y+PL 
Sbjct: 28  STLDKVTSQGFLTCGVSTGLPGFSNPNSKGEWEGIDVEYCQALAAAVLGDKTKVKYVPLT 87

Query: 85  AKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLS 144
           AKERF ALQS +ID+LSRNT WTL R+ +LGL F  + Y+DGQGF++ K+ G++S  +L 
Sbjct: 88  AKERFTALQSGEIDVLSRNTTWTLHRDTALGLNFVGVNYYDGQGFMVKKELGLTSAQELD 147

Query: 145 GASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYAL 204
           GAS+CVQ+GTTTEL LADYF+   M Y P+VF+   +    + A RCD  T D S LYAL
Sbjct: 148 GASVCVQSGTTTELNLADYFRNSGMSYKPVVFDTAAQTSKGFDAGRCDVLTTDQSGLYAL 207

Query: 205 KLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQV 264
           +L    P    +LP+IISK PL P + Q D +W+N+  WT  AM+ AEE GI+ KN +++
Sbjct: 208 RLNLADPKSAQVLPEIISKEPLGPVVRQDDDKWFNVAKWTLSAMINAEEYGISSKNADEM 267

Query: 265 SKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPR 324
            K + +P+++R LG+D     G+ LG+  DW Y++I+ +GNYGE F+R +G  S L+I R
Sbjct: 268 LK-SKDPNIKRILGVDGPK--GKGLGIRDDWGYQVIKQVGNYGESFERTVGTGSPLQISR 324

Query: 325 GYNALWSKGGLMYAPPIR 342
           G NALW+ GG MYAPPIR
Sbjct: 325 GVNALWNAGGFMYAPPIR 342


>gi|238752136|ref|ZP_04613618.1| Extracellular solute-binding protein, family 3 [Yersinia rohdei
           ATCC 43380]
 gi|238709609|gb|EEQ01845.1| Extracellular solute-binding protein, family 3 [Yersinia rohdei
           ATCC 43380]
          Length = 341

 Score =  354 bits (908), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 155/319 (48%), Positives = 222/319 (69%), Gaps = 2/319 (0%)

Query: 24  ASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPL 83
            + L  +KK+GF++CGI+ GL GF+   A+G + G DVD CRA+++AIF D  K++Y PL
Sbjct: 25  GTTLDAVKKKGFVQCGISDGLPGFSYADASGKFSGLDVDICRAVAAAIFGDAEKVKYTPL 84

Query: 84  NAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQL 143
            AKERF ALQS ++DILSRNT WT  R+  +G+ F  + Y+DG GF+ H K G+ S  +L
Sbjct: 85  TAKERFTALQSGEVDILSRNTTWTSSRDAGMGMLFTGVNYYDGIGFLTHNKAGLKSAKEL 144

Query: 144 SGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYA 203
            GA++C+QAGT TEL +ADYFKA+ M+Y P+ F+R +E   A  + RCD    D S LYA
Sbjct: 145 DGATVCIQAGTDTELNVADYFKANKMQYTPVTFDRSDESAKALDSGRCDTLASDQSQLYA 204

Query: 204 LKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQ 263
           L++   +P+E ++LP++ISK PL P + +GD +W+ +V WT +AM+ AEE+G+T +N+  
Sbjct: 205 LRIKLGKPTEFIVLPEVISKEPLGPVVRRGDEDWFALVRWTLFAMLNAEEMGVTSQNVEA 264

Query: 264 VSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIP 323
           ++   T PD+   LG  +  N G+ L +  DW  +I++ +GNYGE F+RN+G  SELKI 
Sbjct: 265 LAAKPTTPDMAHLLG--QEGNYGKDLKVPNDWVVKIVKQVGNYGESFERNVGMGSELKIK 322

Query: 324 RGYNALWSKGGLMYAPPIR 342
           RG NALW+ GGL YAPP+R
Sbjct: 323 RGQNALWNNGGLQYAPPVR 341


>gi|313109278|ref|ZP_07795246.1| Putative amino-acid ABC transporter binding protein [Pseudomonas
           aeruginosa 39016]
 gi|310881748|gb|EFQ40342.1| Putative amino-acid ABC transporter binding protein [Pseudomonas
           aeruginosa 39016]
          Length = 341

 Score =  354 bits (908), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 156/334 (46%), Positives = 234/334 (70%), Gaps = 2/334 (0%)

Query: 9   ILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALS 68
           +L  + L  ++ +   + L  +K++G+++CG++ GL GF+   A G +KG DVD CRAL+
Sbjct: 10  LLAAVCLGASATAEAGATLDAVKRKGYVQCGVSDGLPGFSYADAKGRFKGLDVDICRALA 69

Query: 69  SAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQG 128
           +A+F D  K+++ PL+A ERF ALQS  +D+LSRNT WT  R+ +LG+ F  +TYFDGQG
Sbjct: 70  AALFGDAEKVRFTPLSATERFSALQSGTVDLLSRNTSWTSSRDTALGIHFTGVTYFDGQG 129

Query: 129 FIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRA 188
           F++++K G+SS  +L  A++C+Q+GTT EL +ADYF+AH ++Y  ++ +  E+   A  A
Sbjct: 130 FLVNRKLGVSSARELKDATVCIQSGTTNELNVADYFRAHGIRYKAVLDDSYEKSARALEA 189

Query: 189 HRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAM 248
            +CD  + D S LYA +L   +P ++V+LP++ISK PL PA+ QGD  W+NIV WT Y +
Sbjct: 190 GQCDVLSSDQSQLYAQRLKLAKPDQYVVLPEVISKEPLGPAVRQGDEAWFNIVRWTLYGL 249

Query: 249 VTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGE 308
           + AEELG+T  N+ + ++D+ NPDV R LG     + G+ L L +DW  +++R +GNYGE
Sbjct: 250 LNAEELGVTSSNVERQARDSRNPDVARLLG--SEGDAGKDLQLPRDWVVQMVRQVGNYGE 307

Query: 309 MFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           +F RN+G+ S LK+PRG NA W+ GGL YAPPIR
Sbjct: 308 IFARNVGDGSPLKMPRGLNAQWNLGGLHYAPPIR 341


>gi|209883786|ref|YP_002287643.1| general L-amino acid-binding periplasmic protein AapJ [Oligotropha
           carboxidovorans OM5]
 gi|209871982|gb|ACI91778.1| general L-amino acid-binding periplasmic protein AapJ [Oligotropha
           carboxidovorans OM5]
          Length = 349

 Score =  354 bits (908), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 158/311 (50%), Positives = 222/311 (71%), Gaps = 3/311 (0%)

Query: 32  KRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERFLA 91
           +RG ++CG+N GL GF+   A+G+W GFDVD CRA+++AIFDDP+K+ ++PL+  +RF  
Sbjct: 42  RRGAVQCGVNAGLPGFSNKDASGNWSGFDVDICRAVAAAIFDDPTKVNFVPLDTNQRFKE 101

Query: 92  LQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASICVQ 151
           LQ++ +DILSRN+ W++ RE+   L F  ++Y+DG+GF++ + + + S  +L G  ICVQ
Sbjct: 102 LQNRTVDILSRNSTWSMSREVDYELTFAAVSYYDGEGFMLRRSRNVDSALELGGTRICVQ 161

Query: 152 AGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTNDRP 211
           + TTT+L LADYF+A+NM Y  + F  V ++  AY + +CD  T D S LYA +LT  +P
Sbjct: 162 SDTTTQLNLADYFRANNMTYDEMKFGNVGDLLKAYESGQCDVLTTDTSQLYAYRLTLAKP 221

Query: 212 SEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTTNP 271
            +HVIL DIISK PLAP + Q D +W  IV W  YAM+ AEELG++ KNI++  K +  P
Sbjct: 222 DDHVILADIISKEPLAPVVRQRDDQWMLIVKWAVYAMLNAEELGVSSKNIDEALK-SKKP 280

Query: 272 DVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNALWS 331
           DV R +G + S   GEALGLT DW  R+IRH+GNY E+++RN+G  S+L IPRG N LW+
Sbjct: 281 DVMRLVGTEGS--YGEALGLTNDWAARVIRHVGNYSEVYERNVGVSSKLGIPRGLNQLWN 338

Query: 332 KGGLMYAPPIR 342
            GG+ YAPPIR
Sbjct: 339 AGGIQYAPPIR 349


>gi|107103377|ref|ZP_01367295.1| hypothetical protein PaerPA_01004447 [Pseudomonas aeruginosa PACS2]
          Length = 338

 Score =  354 bits (908), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 156/334 (46%), Positives = 235/334 (70%), Gaps = 2/334 (0%)

Query: 9   ILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALS 68
           +L  + L  ++ +   + L  +K++G+++CG++ GL GF+   A G +KG DVD CRAL+
Sbjct: 7   LLAAVCLGASATAEAGATLDAVKRKGYVQCGVSDGLPGFSYADAKGRFKGLDVDICRALA 66

Query: 69  SAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQG 128
           +A+F D  K+++ PL+A ERF ALQS  +D+LSRNT WT  R+ +LG+ F  +TYFDGQG
Sbjct: 67  AALFGDAEKVRFTPLSATERFSALQSGTVDLLSRNTSWTSSRDTALGIHFTGVTYFDGQG 126

Query: 129 FIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRA 188
           F++++K G+SS  +L  A++C+Q+GTT EL +ADYF+AH ++Y  ++ +  E+   A  A
Sbjct: 127 FLVNRKLGVSSARELKDATVCIQSGTTNELNVADYFRAHGIRYKAVLDDSYEKSARALEA 186

Query: 189 HRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAM 248
            +CD  + D S LYA +L   +P ++V+LP++ISK PL PA+ QGD  W+NIV WT Y +
Sbjct: 187 GQCDVLSSDQSQLYAQRLKLAKPEQYVVLPEVISKEPLGPAVRQGDEAWFNIVRWTLYGL 246

Query: 249 VTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGE 308
           + AEELG+T  N+ + ++D+ NPDV R LG +   + G+ L L +DW  +++R +GNYGE
Sbjct: 247 LNAEELGVTSSNVERQARDSRNPDVARLLGSE--GDAGKDLQLPRDWVVQMVRQVGNYGE 304

Query: 309 MFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           +F RN+G+ S LK+PRG NA W+ GGL YAPPIR
Sbjct: 305 IFARNVGDGSPLKMPRGLNAQWNLGGLHYAPPIR 338


>gi|283788089|ref|YP_003367954.1| Putative ABC transporter, substrate-binding protein [Citrobacter
           rodentium ICC168]
 gi|282951543|emb|CBG91242.1| Putative ABC transporter, substrate-binding protein [Citrobacter
           rodentium ICC168]
          Length = 337

 Score =  353 bits (907), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 154/330 (46%), Positives = 227/330 (68%), Gaps = 2/330 (0%)

Query: 13  IILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIF 72
           +++   + +   + L  +KK+GF++CGI+ GL GF+   A+G + G DVD CR +++A+ 
Sbjct: 10  VLIAVVNQTHAGATLDAVKKKGFVQCGISDGLPGFSYADADGKFSGIDVDVCRGVAAAVL 69

Query: 73  DDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMH 132
            D SK++Y PL AKERF ALQS ++D+LSRNT WT  R+  +G++F  +TY+DG GF+ H
Sbjct: 70  GDDSKVKYTPLTAKERFTALQSGEVDLLSRNTTWTSSRDAGMGMSFTGVTYYDGIGFLTH 129

Query: 133 KKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCD 192
            K G+ S  +L GA++C+QAGT TEL +ADYFKA+NMKY P+ F+R +E   A  + RCD
Sbjct: 130 NKAGLKSAKELDGATVCIQAGTDTELNVADYFKANNMKYTPVTFDRSDESAKALESGRCD 189

Query: 193 AYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAE 252
               D S LYAL++    P E ++LP++ISK PL P + +GD EW+ IV WT +AM+ AE
Sbjct: 190 TLASDQSQLYALRIKLSNPGEWIVLPEVISKEPLGPVVRRGDDEWFAIVRWTLFAMLNAE 249

Query: 253 ELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDR 312
           E+G+T KN+++ + +   PD+   LG  K  + G+ L L   W Y +I+ +GNY E+F+R
Sbjct: 250 EMGVTSKNVDEKAANPATPDMAHLLG--KEGDYGKDLKLDNTWAYNVIKQVGNYAEIFER 307

Query: 313 NLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           N+G++S LKI RG N LW+ GG+ YAPP+R
Sbjct: 308 NVGSESPLKIERGQNNLWNNGGIQYAPPVR 337


>gi|237730186|ref|ZP_04560667.1| amino acid ABC transporter [Citrobacter sp. 30_2]
 gi|226908792|gb|EEH94710.1| amino acid ABC transporter [Citrobacter sp. 30_2]
          Length = 341

 Score =  353 bits (907), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 155/319 (48%), Positives = 223/319 (69%), Gaps = 2/319 (0%)

Query: 24  ASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPL 83
            + L  +KK+GF++CGI+ GL GF+   A+G + G DVD CR ++SA+F D SK++Y PL
Sbjct: 25  GATLDAVKKKGFVQCGISDGLPGFSYADASGKFSGIDVDVCRGVASAVFGDDSKVKYTPL 84

Query: 84  NAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQL 143
            AKERF ALQS ++D+LSRNT WT  R+  +G++F  +TY+DG GF+ H K G+ S  +L
Sbjct: 85  TAKERFTALQSGEVDMLSRNTTWTSSRDAGMGMSFTGVTYYDGIGFLTHNKAGLKSAKEL 144

Query: 144 SGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYA 203
            GA++C+QAGT TEL +ADYFKA+ MKY P+ F+R +E   A  + RCD    D S LYA
Sbjct: 145 DGATVCIQAGTDTELNVADYFKANKMKYTPVTFDRSDESAKALESGRCDTLASDQSQLYA 204

Query: 204 LKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQ 263
           L++    P+E ++LP++ISK PL P + +GD EW++IV WT +AM+ AEE+G+  KN+++
Sbjct: 205 LRIKLSNPAEWIVLPEVISKEPLGPVVRRGDDEWFSIVRWTLFAMLNAEEMGVNSKNVDE 264

Query: 264 VSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIP 323
            + +   PD+   LG  K  + G+ L L   W Y II+ +GNY E+F+RN+G++S LKI 
Sbjct: 265 KAANPATPDMAHLLG--KEGDYGKDLKLDNKWAYNIIKQVGNYSEIFERNVGSESPLKIK 322

Query: 324 RGYNALWSKGGLMYAPPIR 342
           RG N LW+ GG+ YAPP+R
Sbjct: 323 RGQNNLWNNGGIQYAPPVR 341


>gi|62317227|ref|YP_223080.1| amino acid ABC transporter periplasmic amino acid-binding protein
           [Brucella abortus bv. 1 str. 9-941]
 gi|83269208|ref|YP_418499.1| glutamate-binding protein [Brucella melitensis biovar Abortus 2308]
 gi|189022489|ref|YP_001932230.1| Solute-binding protein/glutamate receptor [Brucella abortus S19]
 gi|237816787|ref|ZP_04595779.1| amino-acid ABC transporter-binding protein yhdW precursor [Brucella
           abortus str. 2308 A]
 gi|254698509|ref|ZP_05160337.1| Solute-binding protein/glutamate receptor [Brucella abortus bv. 2
           str. 86/8/59]
 gi|254731957|ref|ZP_05190535.1| Solute-binding protein/glutamate receptor [Brucella abortus bv. 4
           str. 292]
 gi|260544464|ref|ZP_05820285.1| solute-binding protein/glutamate receptor [Brucella abortus NCTC
           8038]
 gi|260759731|ref|ZP_05872079.1| extracellular solute-binding protein family 3 [Brucella abortus bv.
           4 str. 292]
 gi|260762971|ref|ZP_05875303.1| extracellular solute-binding protein family 3 [Brucella abortus bv.
           2 str. 86/8/59]
 gi|62197420|gb|AAX75719.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Brucella abortus bv. 1 str. 9-941]
 gi|82939482|emb|CAJ12452.1| Solute-binding protein/glutamate receptor:Bacterial extracellular
           solute-binding protein, family 3 [Brucella melitensis
           biovar Abortus 2308]
 gi|189021063|gb|ACD73784.1| Solute-binding protein/glutamate receptor [Brucella abortus S19]
 gi|237787600|gb|EEP61816.1| amino-acid ABC transporter-binding protein yhdW precursor [Brucella
           abortus str. 2308 A]
 gi|260097735|gb|EEW81609.1| solute-binding protein/glutamate receptor [Brucella abortus NCTC
           8038]
 gi|260670049|gb|EEX56989.1| extracellular solute-binding protein family 3 [Brucella abortus bv.
           4 str. 292]
 gi|260673392|gb|EEX60213.1| extracellular solute-binding protein family 3 [Brucella abortus bv.
           2 str. 86/8/59]
          Length = 339

 Score =  353 bits (907), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 164/342 (47%), Positives = 225/342 (65%), Gaps = 3/342 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           M K  + ++L             A  L  +K+RG + CG++ G+ GF+     G W GFD
Sbjct: 1   MKKTVWGALLAAGFALSAQGGAAADTLSTVKERGKVNCGVSQGVAGFSSPDDQGKWTGFD 60

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
           +DFCRA+S+A+F DP K+ ++PL+ KERF ALQS  +D+LS  T WTL R+  +G+ F  
Sbjct: 61  IDFCRAVSAAVFGDPDKVSFIPLSTKERFTALQSGTVDLLSCQTTWTLSRDAGMGIHFVG 120

Query: 121 ITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVE 180
             Y+DGQGF++ K  G+ S  +L GASIC + GTTTE  +ADY  AHN+KY P+V +  +
Sbjct: 121 TAYYDGQGFMIRKDLGVDSALKLDGASICTEQGTTTEQNVADYCGAHNIKYEPVVIDSAD 180

Query: 181 EIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNI 240
            I  A+   RCD YT D SALYA +L    P  +++LP++ISK PL PA+ QGD +W+NI
Sbjct: 181 GILKAFETGRCDVYTTDASALYAQRLKLAEPDAYMVLPEVISKEPLGPAVRQGDDKWFNI 240

Query: 241 VSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRII 300
           V WT +A++ AEELGITQK +     D+  PD++RFLG +  +  G+ LGL   W Y I+
Sbjct: 241 VRWTLFALLEAEELGITQKTV-AADLDSRKPDIRRFLGSEGDN--GQQLGLEPKWAYNIV 297

Query: 301 RHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
             +GNYGEMF+R +G  S LKI RG NALW+KGGLMYAPP++
Sbjct: 298 ASVGNYGEMFERTIGEGSLLKINRGINALWNKGGLMYAPPVK 339


>gi|187730695|ref|YP_001881960.1| amino acid ABC transporter periplasmic amino acid-binding protein
           [Shigella boydii CDC 3083-94]
 gi|187427687|gb|ACD06961.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Shigella boydii CDC 3083-94]
 gi|320177109|gb|EFW52125.1| Glutamate Aspartate periplasmic binding protein precursor GltI
           [Shigella dysenteriae CDC 74-1112]
          Length = 341

 Score =  353 bits (907), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 154/319 (48%), Positives = 225/319 (70%), Gaps = 2/319 (0%)

Query: 24  ASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPL 83
            + L  ++K+GF++CGI+ GL GF+   A+G + G DVD CR++++A+F D +K++Y PL
Sbjct: 25  GATLDAVQKKGFVQCGISDGLPGFSYADADGKFSGIDVDVCRSVAAAVFGDDTKVKYTPL 84

Query: 84  NAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQL 143
            AKERF ALQS ++D+LSRNT WT  R+  +G+AF  +TY+DG GF+ H K G+ S  +L
Sbjct: 85  TAKERFTALQSGEVDLLSRNTTWTSSRDAGMGMAFTGVTYYDGIGFLTHDKAGLKSAKEL 144

Query: 144 SGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYA 203
            GA++C+QAGT TEL +ADYFKA+NMKY P+ F+R +E   A  + RCD    D S LYA
Sbjct: 145 DGATVCIQAGTDTELNVADYFKANNMKYTPVTFDRSDESAKALESGRCDTLASDQSQLYA 204

Query: 204 LKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQ 263
           L++    P+E ++LP++ISK PL P + +GD EW++IV WT +AM+ AEE+GI  +N+++
Sbjct: 205 LRIKLSNPAEWIVLPEVISKEPLGPVVRRGDDEWFSIVRWTLFAMLNAEEMGINSQNVDE 264

Query: 264 VSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIP 323
            + +   PD+   LG  K  + G+ L L   W Y II+ +GNY E+F+RN+G++S LKI 
Sbjct: 265 KAANPATPDMAHLLG--KEGDYGKDLKLDNKWAYNIIKQVGNYSEIFERNVGSESPLKIK 322

Query: 324 RGYNALWSKGGLMYAPPIR 342
           RG N LW+ GG+ YAPP+R
Sbjct: 323 RGQNNLWNNGGIQYAPPVR 341


>gi|317049795|ref|YP_004117443.1| family 3 extracellular solute-binding protein [Pantoea sp. At-9b]
 gi|316951412|gb|ADU70887.1| extracellular solute-binding protein family 3 [Pantoea sp. At-9b]
          Length = 341

 Score =  353 bits (907), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 164/343 (47%), Positives = 232/343 (67%), Gaps = 3/343 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNA-SILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGF 59
           M K    +++    LF  +   +A + L  IKK+GF++CGI+ GL GF+   A+G + G 
Sbjct: 1   MKKMMLSTLVAAASLFAVAQQAHAGTTLDAIKKKGFVQCGISDGLPGFSYADASGKFTGI 60

Query: 60  DVDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFR 119
           DVD CRA ++A+F D SK++Y PL AKERF ALQS ++DILSRNT WT  R+  +G  F 
Sbjct: 61  DVDVCRAAAAAVFGDASKVKYTPLTAKERFTALQSGEVDILSRNTTWTSSRDGGMGFLFA 120

Query: 120 PITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERV 179
            + Y+DG GF+ HKK G+ S  +L GA++C+QAGT TEL +ADYFKA+NM+Y P+ F+R 
Sbjct: 121 GVNYYDGIGFLTHKKAGLKSAKELDGATVCIQAGTDTELNVADYFKANNMQYTPVTFDRS 180

Query: 180 EEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYN 239
           +E   A  + RCD    D S LYAL++   +P E ++LP++ISK PL P + +GD +W+ 
Sbjct: 181 DESAKALDSGRCDTLASDQSQLYALRIKLGKPDEFIVLPEVISKEPLGPVVRRGDDDWFT 240

Query: 240 IVSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRI 299
           IV W+ YAM+ AEE+GI  KN++Q++   +NPD+   LG +   + G+ L L   W + I
Sbjct: 241 IVKWSLYAMLNAEEMGINSKNVDQLAAKPSNPDMAHLLGAE--GDFGKDLKLDNKWAFNI 298

Query: 300 IRHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           I+ +GNY E FDRN+G  S LKI RG NALW++GG+ YAPP+R
Sbjct: 299 IKQVGNYQESFDRNVGKDSALKIARGQNALWNQGGIQYAPPVR 341


>gi|149376724|ref|ZP_01894482.1| ABC-type amino acid transport/signal transduction system,
           periplasmic component/domain [Marinobacter algicola
           DG893]
 gi|149358963|gb|EDM47429.1| ABC-type amino acid transport/signal transduction system,
           periplasmic component/domain [Marinobacter algicola
           DG893]
          Length = 343

 Score =  353 bits (906), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 162/340 (47%), Positives = 228/340 (67%), Gaps = 3/340 (0%)

Query: 3   KDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVD 62
           K   V    L  +F  S ++ A+ L  +K++G L+CG+ +GL GF++    G+W G DVD
Sbjct: 7   KSIAVGAAMLCGVFTASVASAATTLESVKEKGHLQCGVTSGLPGFSQPDDKGNWTGIDVD 66

Query: 63  FCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPIT 122
            CRA+++AIF D   +++ PL AKERF ALQS +ID+LSRNT WTL R+ SLGL F  + 
Sbjct: 67  TCRAVAAAIFGDAKAVEFTPLTAKERFTALQSGEIDMLSRNTTWTLTRDASLGLNFAGVN 126

Query: 123 YFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEI 182
           Y+DGQGF+++K  G+   +QL GA++C+QAGTTTEL L+DYF+A  M+Y PIVF+  E+ 
Sbjct: 127 YYDGQGFLVNKGIGVDDATQLDGATVCIQAGTTTELNLSDYFRAKGMEYKPIVFDTSEQT 186

Query: 183 DAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVS 242
              + + RCD  T D S L AL+     P    ILP+ ISK PL P + QGD +W+NIV 
Sbjct: 187 VQGFASGRCDVLTSDRSQLAALRSKLSDPDSAKILPNTISKEPLGPVVRQGDDQWFNIVK 246

Query: 243 WTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRH 302
           W     + AEELG+T  N++ + K + NP++QR LG D   ++G  LGL  D+  + I+ 
Sbjct: 247 WVLSVQINAEELGVTSANVDDMLK-SDNPNIQRLLGTD--GDMGAKLGLPADFGAKAIKQ 303

Query: 303 MGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           +GNYGEM+DRN+G  + L + RG NALW++GG+MYAPP+R
Sbjct: 304 VGNYGEMYDRNVGPDTPLGLERGINALWTEGGVMYAPPVR 343


>gi|293416693|ref|ZP_06659332.1| general L-amino acid transport system substrate-binding protein
           [Escherichia coli B185]
 gi|291432049|gb|EFF05032.1| general L-amino acid transport system substrate-binding protein
           [Escherichia coli B185]
          Length = 341

 Score =  353 bits (906), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 154/319 (48%), Positives = 224/319 (70%), Gaps = 2/319 (0%)

Query: 24  ASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPL 83
            + L  ++K+GF++CGI+ GL GF+   A+G + G DVD CR +++A+F D +K++Y PL
Sbjct: 25  GATLDAVQKKGFVQCGISDGLPGFSYADADGKFSGIDVDICRGVAAAVFGDDTKVKYTPL 84

Query: 84  NAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQL 143
            AKERF ALQS ++D+LSRNT WT  R+  +G+AF  +TY+DG GF+ H K G+ S  +L
Sbjct: 85  TAKERFTALQSGEVDLLSRNTTWTSSRDAGMGMAFTGVTYYDGIGFLTHDKAGLKSAKEL 144

Query: 144 SGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYA 203
            GA++C+QAGT TEL +ADYFKA+NMKY P+ F+R +E   A  + RCD    D S LYA
Sbjct: 145 DGATVCIQAGTDTELNVADYFKANNMKYTPVTFDRSDESAKALESGRCDTLASDQSQLYA 204

Query: 204 LKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQ 263
           L++    P+E ++LP++ISK PL P + +GD EW++IV WT +AM+ AEE+GI  +N+++
Sbjct: 205 LRIKLSNPAEWIVLPEVISKEPLGPVVRRGDDEWFSIVRWTLFAMLNAEEMGINSQNVDE 264

Query: 264 VSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIP 323
            + +   PD+   LG  K  + G+ L L   W Y II+ +GNY E+F+RN+G++S LKI 
Sbjct: 265 KAANPATPDMAHLLG--KEGDYGKDLKLDNKWAYNIIKQVGNYSEIFERNVGSESPLKIK 322

Query: 324 RGYNALWSKGGLMYAPPIR 342
           RG N LW+ GG+ YAPP+R
Sbjct: 323 RGQNNLWNNGGIQYAPPVR 341


>gi|157162750|ref|YP_001460068.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Escherichia coli HS]
 gi|170018489|ref|YP_001723443.1| extracellular solute-binding protein [Escherichia coli ATCC 8739]
 gi|170682914|ref|YP_001745538.1| amino acid ABC transporter periplasmic amino acid-binding protein
           [Escherichia coli SMS-3-5]
 gi|188493987|ref|ZP_03001257.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Escherichia coli 53638]
 gi|194440030|ref|ZP_03072087.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Escherichia coli 101-1]
 gi|253771901|ref|YP_003034732.1| extracellular solute-binding protein family 3 [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254038434|ref|ZP_04872492.1| amino acid ABC transporter [Escherichia sp. 1_1_43]
 gi|256024158|ref|ZP_05438023.1| extracellular solute-binding protein family 3 [Escherichia sp.
           4_1_40B]
 gi|297518104|ref|ZP_06936490.1| extracellular solute-binding protein family 3 [Escherichia coli
           OP50]
 gi|300916765|ref|ZP_07133475.1| lysine-arginine-ornithine-binding periplasmic protein [Escherichia
           coli MS 115-1]
 gi|300928696|ref|ZP_07144214.1| lysine-arginine-ornithine-binding periplasmic protein [Escherichia
           coli MS 187-1]
 gi|300946948|ref|ZP_07161179.1| lysine-arginine-ornithine-binding periplasmic protein [Escherichia
           coli MS 116-1]
 gi|300958250|ref|ZP_07170397.1| lysine-arginine-ornithine-binding periplasmic protein [Escherichia
           coli MS 175-1]
 gi|301028300|ref|ZP_07191560.1| lysine-arginine-ornithine-binding periplasmic protein [Escherichia
           coli MS 196-1]
 gi|301647044|ref|ZP_07246876.1| lysine-arginine-ornithine-binding periplasmic protein [Escherichia
           coli MS 146-1]
 gi|307139956|ref|ZP_07499312.1| extracellular solute-binding protein family 3 [Escherichia coli
           H736]
 gi|312972463|ref|ZP_07786637.1| general L-amino acid-binding periplasmic protein aapJ [Escherichia
           coli 1827-70]
 gi|331643968|ref|ZP_08345099.1| putative amino-acid ABC transporter-binding protein YhdW
           [Escherichia coli H736]
 gi|331654867|ref|ZP_08355867.1| putative amino-acid ABC transporter-binding protein YhdW
           [Escherichia coli M718]
 gi|157068430|gb|ABV07685.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Escherichia coli HS]
 gi|169753417|gb|ACA76116.1| extracellular solute-binding protein family 3 [Escherichia coli
           ATCC 8739]
 gi|170520632|gb|ACB18810.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Escherichia coli SMS-3-5]
 gi|188489186|gb|EDU64289.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Escherichia coli 53638]
 gi|194421034|gb|EDX37064.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Escherichia coli 101-1]
 gi|226840058|gb|EEH72079.1| amino acid ABC transporter [Escherichia sp. 1_1_43]
 gi|253322945|gb|ACT27547.1| extracellular solute-binding protein family 3 [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|299878643|gb|EFI86854.1| lysine-arginine-ornithine-binding periplasmic protein [Escherichia
           coli MS 196-1]
 gi|300315068|gb|EFJ64852.1| lysine-arginine-ornithine-binding periplasmic protein [Escherichia
           coli MS 175-1]
 gi|300415951|gb|EFJ99261.1| lysine-arginine-ornithine-binding periplasmic protein [Escherichia
           coli MS 115-1]
 gi|300453408|gb|EFK17028.1| lysine-arginine-ornithine-binding periplasmic protein [Escherichia
           coli MS 116-1]
 gi|300463285|gb|EFK26778.1| lysine-arginine-ornithine-binding periplasmic protein [Escherichia
           coli MS 187-1]
 gi|301074794|gb|EFK89600.1| lysine-arginine-ornithine-binding periplasmic protein [Escherichia
           coli MS 146-1]
 gi|310334840|gb|EFQ01045.1| general L-amino acid-binding periplasmic protein aapJ [Escherichia
           coli 1827-70]
 gi|315617078|gb|EFU97688.1| general L-amino acid-binding periplasmic protein aapJ [Escherichia
           coli 3431]
 gi|323936248|gb|EGB32540.1| lysine-arginine-ornithine-binding periplasmic protein [Escherichia
           coli E1520]
 gi|323970317|gb|EGB65587.1| lysine-arginine-ornithine-binding periplasmic protein [Escherichia
           coli TA007]
 gi|331037439|gb|EGI09663.1| putative amino-acid ABC transporter-binding protein YhdW
           [Escherichia coli H736]
 gi|331048249|gb|EGI20326.1| putative amino-acid ABC transporter-binding protein YhdW
           [Escherichia coli M718]
          Length = 341

 Score =  353 bits (906), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 154/319 (48%), Positives = 224/319 (70%), Gaps = 2/319 (0%)

Query: 24  ASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPL 83
            + L  ++K+GF++CGI+ GL GF+   A+G + G DVD CR +++A+F D +K++Y PL
Sbjct: 25  GATLDAVQKKGFVQCGISDGLPGFSYADADGKFSGIDVDICRGVAAAVFGDDTKVKYTPL 84

Query: 84  NAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQL 143
            AKERF ALQS ++D+LSRNT WT  R+  +G+AF  +TY+DG GF+ H K G+ S  +L
Sbjct: 85  TAKERFTALQSGEVDLLSRNTTWTSSRDAGMGMAFTGVTYYDGIGFLTHDKAGLKSAKEL 144

Query: 144 SGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYA 203
            GA++C+QAGT TEL +ADYFKA+NMKY P+ F+R +E   A  + RCD    D S LYA
Sbjct: 145 DGATVCIQAGTDTELNVADYFKANNMKYTPVTFDRSDESAKALESGRCDTLASDQSQLYA 204

Query: 204 LKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQ 263
           L++    P+E ++LP++ISK PL P + +GD EW++IV WT +AM+ AEE+GI  +N+++
Sbjct: 205 LRIKLSNPAEWIVLPEVISKEPLGPVVRRGDDEWFSIVRWTLFAMLNAEEMGINSQNVDE 264

Query: 264 VSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIP 323
            + +   PD+   LG  K  + G+ L L   W Y II+ +GNY E+F+RN+G++S LKI 
Sbjct: 265 KAANPATPDMAHLLG--KEGDYGKDLKLDNKWAYNIIKQVGNYSEIFERNVGSESPLKIK 322

Query: 324 RGYNALWSKGGLMYAPPIR 342
           RG N LW+ GG+ YAPP+R
Sbjct: 323 RGQNNLWNNGGIQYAPPVR 341


>gi|313500474|gb|ADR61840.1| AapJ [Pseudomonas putida BIRD-1]
          Length = 342

 Score =  353 bits (906), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 158/324 (48%), Positives = 227/324 (70%), Gaps = 2/324 (0%)

Query: 19  SFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKI 78
           S +   + L  +KK+GF++CG++ GL GF+   A G   G D D CRA+++A+F D +K+
Sbjct: 21  STAQAGATLDAVKKKGFVQCGVSDGLPGFSVPDAQGKIVGIDADVCRAVAAAVFGDATKV 80

Query: 79  QYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGIS 138
           ++  LNAKERF ALQS ++D+LSRNT WT  R+  +GL F  +TY+DG GF+++KK G+S
Sbjct: 81  KFSQLNAKERFTALQSGEVDVLSRNTTWTSSRDAGMGLVFAGVTYYDGVGFLVNKKLGVS 140

Query: 139 SVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDI 198
           S  +L GA+IC+QAGTTTEL ++D+F+A+ +KY PI F+  +E   +  + RCD  T D 
Sbjct: 141 SAKELDGATICIQAGTTTELNVSDFFRANGLKYTPITFDTSDESAKSLESGRCDVLTSDK 200

Query: 199 SALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQ 258
           S L+A +     P+++V+LP+ ISK PL P + +GD EW++IV WT +AM+ AEE GIT 
Sbjct: 201 SQLFAQRSKLAAPTDYVVLPETISKEPLGPVVRKGDEEWFSIVKWTLFAMLNAEEAGITS 260

Query: 259 KNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQS 318
           KN+   +K T NPDV R LG D     G+ L L KDW  +I++ +GNYGE+F++NLG  +
Sbjct: 261 KNVEAEAKATKNPDVARLLGAD--GEYGKDLKLPKDWVVQIVKQVGNYGEVFEKNLGQST 318

Query: 319 ELKIPRGYNALWSKGGLMYAPPIR 342
           +LKI RG NALW+ GG+ YAPP+R
Sbjct: 319 DLKIDRGMNALWNNGGIQYAPPVR 342


>gi|300937395|ref|ZP_07152230.1| lysine-arginine-ornithine-binding periplasmic protein [Escherichia
           coli MS 21-1]
 gi|300457569|gb|EFK21062.1| lysine-arginine-ornithine-binding periplasmic protein [Escherichia
           coli MS 21-1]
          Length = 354

 Score =  353 bits (906), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 154/319 (48%), Positives = 224/319 (70%), Gaps = 2/319 (0%)

Query: 24  ASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPL 83
            + L  ++K+GF++CGI+ GL GF+   A+G + G DVD CR +++A+F D +K++Y PL
Sbjct: 38  GATLDAVQKKGFVQCGISDGLPGFSYADADGKFSGIDVDICRGVAAAVFGDDTKVKYTPL 97

Query: 84  NAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQL 143
            AKERF ALQS ++D+LSRNT WT  R+  +G+AF  +TY+DG GF+ H K G+ S  +L
Sbjct: 98  TAKERFTALQSGEVDLLSRNTTWTSSRDAGMGMAFTGVTYYDGIGFLTHDKAGLKSAKEL 157

Query: 144 SGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYA 203
            GA++C+QAGT TEL +ADYFKA+NMKY P+ F+R +E   A  + RCD    D S LYA
Sbjct: 158 DGATVCIQAGTDTELNVADYFKANNMKYTPVTFDRSDESAKALESGRCDTLASDQSQLYA 217

Query: 204 LKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQ 263
           L++    P+E ++LP++ISK PL P + +GD EW++IV WT +AM+ AEE+GI  +N+++
Sbjct: 218 LRIKLSNPTEWIVLPEVISKEPLGPVVRRGDDEWFSIVRWTLFAMLNAEEMGINSQNVDE 277

Query: 264 VSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIP 323
            + +   PD+   LG  K  + G+ L L   W Y II+ +GNY E+F+RN+G++S LKI 
Sbjct: 278 KAANPATPDMAHLLG--KEGDYGKDLKLDNKWAYNIIKQVGNYSEIFERNVGSESPLKIK 335

Query: 324 RGYNALWSKGGLMYAPPIR 342
           RG N LW+ GG+ YAPP+R
Sbjct: 336 RGQNNLWNNGGIQYAPPVR 354


>gi|320202178|gb|EFW76753.1| Glutamate Aspartate periplasmic binding protein precursor GltI
           [Escherichia coli EC4100B]
          Length = 341

 Score =  353 bits (906), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 154/319 (48%), Positives = 224/319 (70%), Gaps = 2/319 (0%)

Query: 24  ASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPL 83
            + L  ++K+GF++CGI+ GL GF+   A+G + G DVD CR +++A+F D +K++Y PL
Sbjct: 25  GATLDAVQKKGFVQCGISDGLPGFSYADADGKFSGIDVDVCRGVAAAVFGDDTKVKYTPL 84

Query: 84  NAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQL 143
            AKERF ALQS ++D+LSRNT WT  R+  +G+AF  +TY+DG GF+ H K G+ S  +L
Sbjct: 85  TAKERFTALQSGEVDLLSRNTTWTSSRDAGMGMAFTGVTYYDGIGFLTHDKAGLKSAKEL 144

Query: 144 SGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYA 203
            GA++C+QAGT TEL +ADYFKA+NMKY P+ F+R +E   A  + RCD    D S LYA
Sbjct: 145 DGATVCIQAGTDTELNVADYFKANNMKYTPVTFDRSDESAKALESGRCDTLASDQSQLYA 204

Query: 204 LKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQ 263
           L++    P+E ++LP++ISK PL P + +GD EW++IV WT +AM+ AEE+GI  +N+++
Sbjct: 205 LRIKLSNPAEWIVLPEVISKEPLGPVVRRGDDEWFSIVRWTLFAMLNAEEMGINSQNVDE 264

Query: 264 VSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIP 323
            + +   PD+   LG  K  + G+ L L   W Y II+ +GNY E+F+RN+G++S LKI 
Sbjct: 265 KAANPATPDMTHLLG--KEGDYGKDLKLDNKWAYNIIKQVGNYSEIFERNVGSESPLKIK 322

Query: 324 RGYNALWSKGGLMYAPPIR 342
           RG N LW+ GG+ YAPP+R
Sbjct: 323 RGQNNLWNNGGIQYAPPVR 341


>gi|13959721|sp|P45766|YHDW_ECOLI RecName: Full=Putative amino-acid ABC transporter-binding protein
           yhdW; Flags: Precursor
          Length = 341

 Score =  353 bits (906), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 154/319 (48%), Positives = 224/319 (70%), Gaps = 2/319 (0%)

Query: 24  ASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPL 83
            + L  ++K+GF++CGI+ GL GF+   A+G + G DVD CR +++A+F D +K++Y PL
Sbjct: 25  GATLDAVQKKGFVQCGISDGLPGFSYADADGKFSGIDVDICRGVAAAVFGDDTKVKYTPL 84

Query: 84  NAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQL 143
            AKERF ALQS ++D+LSRNT WT  R+  +G+AF  +TY+DG GF+ H K G+ S  +L
Sbjct: 85  TAKERFTALQSGEVDLLSRNTTWTSSRDAGMGMAFTGVTYYDGIGFLTHDKAGLKSAKEL 144

Query: 144 SGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYA 203
            GA++C+QAGT TEL +ADYFKA+NMKY P+ F+R +E   A  + RCD    D S LYA
Sbjct: 145 DGATVCIQAGTDTELNVADYFKANNMKYTPVTFDRSDESAKALESGRCDTLASDQSQLYA 204

Query: 204 LKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQ 263
           L++    P+E ++LP++ISK PL P + +GD EW++IV WT +AM+ AEE+GI  +N+++
Sbjct: 205 LRIKLSNPAEWIVLPEVISKEPLGPVVRRGDDEWFSIVRWTLFAMLNAEEMGINSQNVDE 264

Query: 264 VSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIP 323
            + +   PD+   LG  K  + G+ L L   W Y II+ +GNY E+F+RN+G++S LKI 
Sbjct: 265 KAANPATPDMAHLLG--KEGDYGKDLKLDNKWAYNIIKQVGNYSEIFERNVGSESPLKIK 322

Query: 324 RGYNALWSKGGLMYAPPIR 342
           RG N LW+ GG+ YAPP+R
Sbjct: 323 RGQNNLWNNGGIQYAPPVR 341


>gi|38704156|ref|NP_312168.2| periplasmic binding transport protein [Escherichia coli O157:H7
           str. Sakai]
 gi|157159268|ref|YP_001464743.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Escherichia coli E24377A]
 gi|168752394|ref|ZP_02777416.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Escherichia coli O157:H7 str. EC4113]
 gi|168758500|ref|ZP_02783507.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Escherichia coli O157:H7 str. EC4401]
 gi|168764869|ref|ZP_02789876.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Escherichia coli O157:H7 str. EC4501]
 gi|168769134|ref|ZP_02794141.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Escherichia coli O157:H7 str. EC4486]
 gi|168777686|ref|ZP_02802693.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Escherichia coli O157:H7 str. EC4196]
 gi|168783839|ref|ZP_02808846.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Escherichia coli O157:H7 str. EC4076]
 gi|168786163|ref|ZP_02811170.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Escherichia coli O157:H7 str. EC869]
 gi|168802616|ref|ZP_02827623.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Escherichia coli O157:H7 str. EC508]
 gi|191169153|ref|ZP_03030911.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Escherichia coli B7A]
 gi|193066465|ref|ZP_03047510.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Escherichia coli E22]
 gi|194430248|ref|ZP_03062745.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Escherichia coli B171]
 gi|195940012|ref|ZP_03085394.1| putative periplasmic binding transport protein [Escherichia coli
           O157:H7 str. EC4024]
 gi|208807576|ref|ZP_03249913.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Escherichia coli O157:H7 str. EC4206]
 gi|208813206|ref|ZP_03254535.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Escherichia coli O157:H7 str. EC4045]
 gi|208820750|ref|ZP_03261070.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Escherichia coli O157:H7 str. EC4042]
 gi|209397538|ref|YP_002272730.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Escherichia coli O157:H7 str. EC4115]
 gi|217326793|ref|ZP_03442876.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Escherichia coli O157:H7 str. TW14588]
 gi|254795210|ref|YP_003080047.1| periplasmic-binding component of an ABC superfamily putative amino
           acid transporter [Escherichia coli O157:H7 str. TW14359]
 gi|256018818|ref|ZP_05432683.1| periplasmic-binding component of an ABC superfamily predicted amino
           acid transporter [Shigella sp. D9]
 gi|260846073|ref|YP_003223851.1| putative periplasmic binding transport protein [Escherichia coli
           O103:H2 str. 12009]
 gi|260857395|ref|YP_003231286.1| putative periplasmic binding transport protein [Escherichia coli
           O26:H11 str. 11368]
 gi|260870019|ref|YP_003236421.1| putative periplasmic binding transport protein [Escherichia coli
           O111:H- str. 11128]
 gi|261228273|ref|ZP_05942554.1| periplasmic-binding component of an ABC superfamily predicted amino
           acid transporter [Escherichia coli O157:H7 str.
           FRIK2000]
 gi|261255131|ref|ZP_05947664.1| putative periplasmic binding transport protein [Escherichia coli
           O157:H7 str. FRIK966]
 gi|291284635|ref|YP_003501453.1| putative amino-acid ABC transporter-binding protein yhdW precursor
           [Escherichia coli O55:H7 str. CB9615]
 gi|293406870|ref|ZP_06650796.1| amino acid ABC transporter [Escherichia coli FVEC1412]
 gi|293412637|ref|ZP_06655360.1| conserved hypothetical protein [Escherichia coli B354]
 gi|293449591|ref|ZP_06664012.1| amino-acid ABC transporter-binding protein yhdW [Escherichia coli
           B088]
 gi|298382611|ref|ZP_06992208.1| amino-acid ABC transporter-binding protein yhdW [Escherichia coli
           FVEC1302]
 gi|300898040|ref|ZP_07116411.1| lysine-arginine-ornithine-binding periplasmic protein [Escherichia
           coli MS 198-1]
 gi|300904464|ref|ZP_07122310.1| lysine-arginine-ornithine-binding periplasmic protein [Escherichia
           coli MS 84-1]
 gi|300925986|ref|ZP_07141809.1| lysine-arginine-ornithine-binding periplasmic protein [Escherichia
           coli MS 182-1]
 gi|301304263|ref|ZP_07210377.1| lysine-arginine-ornithine-binding periplasmic protein [Escherichia
           coli MS 124-1]
 gi|301326288|ref|ZP_07219661.1| lysine-arginine-ornithine-binding periplasmic protein [Escherichia
           coli MS 78-1]
 gi|307314974|ref|ZP_07594562.1| extracellular solute-binding protein family 3 [Escherichia coli W]
 gi|309793849|ref|ZP_07688275.1| lysine-arginine-ornithine-binding periplasmic protein [Escherichia
           coli MS 145-7]
 gi|13959662|sp|P58068|YHDW_ECO57 RecName: Full=Putative amino-acid ABC transporter-binding protein
           yhdW; Flags: Precursor
 gi|157081298|gb|ABV21006.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Escherichia coli E24377A]
 gi|187767128|gb|EDU30972.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Escherichia coli O157:H7 str. EC4196]
 gi|188013752|gb|EDU51874.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Escherichia coli O157:H7 str. EC4113]
 gi|188998861|gb|EDU67847.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Escherichia coli O157:H7 str. EC4076]
 gi|189354670|gb|EDU73089.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Escherichia coli O157:H7 str. EC4401]
 gi|189361744|gb|EDU80163.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Escherichia coli O157:H7 str. EC4486]
 gi|189365193|gb|EDU83609.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Escherichia coli O157:H7 str. EC4501]
 gi|189373879|gb|EDU92295.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Escherichia coli O157:H7 str. EC869]
 gi|189375432|gb|EDU93848.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Escherichia coli O157:H7 str. EC508]
 gi|190900795|gb|EDV60586.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Escherichia coli B7A]
 gi|192925894|gb|EDV80543.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Escherichia coli E22]
 gi|194411719|gb|EDX28044.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Escherichia coli B171]
 gi|208727377|gb|EDZ76978.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Escherichia coli O157:H7 str. EC4206]
 gi|208734483|gb|EDZ83170.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Escherichia coli O157:H7 str. EC4045]
 gi|208740873|gb|EDZ88555.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Escherichia coli O157:H7 str. EC4042]
 gi|209158938|gb|ACI36371.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Escherichia coli O157:H7 str. EC4115]
 gi|217319160|gb|EEC27585.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Escherichia coli O157:H7 str. TW14588]
 gi|254594610|gb|ACT73971.1| periplasmic-binding component of an ABC superfamily predicted amino
           acid transporter [Escherichia coli O157:H7 str. TW14359]
 gi|257756044|dbj|BAI27546.1| putative periplasmic binding transport protein [Escherichia coli
           O26:H11 str. 11368]
 gi|257761220|dbj|BAI32717.1| putative periplasmic binding transport protein [Escherichia coli
           O103:H2 str. 12009]
 gi|257766375|dbj|BAI37870.1| putative periplasmic binding transport protein [Escherichia coli
           O111:H- str. 11128]
 gi|290764508|gb|ADD58469.1| Putative amino-acid ABC transporter-binding protein yhdW precursor
           [Escherichia coli O55:H7 str. CB9615]
 gi|291322681|gb|EFE62110.1| amino-acid ABC transporter-binding protein yhdW [Escherichia coli
           B088]
 gi|291426876|gb|EFE99908.1| amino acid ABC transporter [Escherichia coli FVEC1412]
 gi|291469408|gb|EFF11899.1| conserved hypothetical protein [Escherichia coli B354]
 gi|298277751|gb|EFI19267.1| amino-acid ABC transporter-binding protein yhdW [Escherichia coli
           FVEC1302]
 gi|300358259|gb|EFJ74129.1| lysine-arginine-ornithine-binding periplasmic protein [Escherichia
           coli MS 198-1]
 gi|300403626|gb|EFJ87164.1| lysine-arginine-ornithine-binding periplasmic protein [Escherichia
           coli MS 84-1]
 gi|300417930|gb|EFK01241.1| lysine-arginine-ornithine-binding periplasmic protein [Escherichia
           coli MS 182-1]
 gi|300840389|gb|EFK68149.1| lysine-arginine-ornithine-binding periplasmic protein [Escherichia
           coli MS 124-1]
 gi|300846989|gb|EFK74749.1| lysine-arginine-ornithine-binding periplasmic protein [Escherichia
           coli MS 78-1]
 gi|306905557|gb|EFN36089.1| extracellular solute-binding protein family 3 [Escherichia coli W]
 gi|308122806|gb|EFO60068.1| lysine-arginine-ornithine-binding periplasmic protein [Escherichia
           coli MS 145-7]
 gi|315257196|gb|EFU37164.1| lysine-arginine-ornithine-binding periplasmic protein [Escherichia
           coli MS 85-1]
 gi|320181542|gb|EFW56460.1| Glutamate Aspartate periplasmic binding protein precursor GltI
           [Shigella boydii ATCC 9905]
 gi|320189617|gb|EFW64276.1| Glutamate Aspartate periplasmic binding protein precursor GltI
           [Escherichia coli O157:H7 str. EC1212]
 gi|320639914|gb|EFX09505.1| putative amino-acid ABC transporter-binding protein yhdW precursor
           [Escherichia coli O157:H7 str. G5101]
 gi|320645630|gb|EFX14639.1| putative amino-acid ABC transporter-binding protein yhdW precursor
           [Escherichia coli O157:H- str. 493-89]
 gi|320650940|gb|EFX19397.1| putative amino-acid ABC transporter-binding protein yhdW precursor
           [Escherichia coli O157:H- str. H 2687]
 gi|320656321|gb|EFX24233.1| putative amino-acid ABC transporter-binding protein yhdW precursor
           [Escherichia coli O55:H7 str. 3256-97 TW 07815]
 gi|320662011|gb|EFX29419.1| putative amino-acid ABC transporter-binding protein yhdW precursor
           [Escherichia coli O55:H7 str. USDA 5905]
 gi|320666847|gb|EFX33826.1| putative amino-acid ABC transporter-binding protein yhdW precursor
           [Escherichia coli O157:H7 str. LSU-61]
 gi|323154488|gb|EFZ40689.1| general L-amino acid-binding periplasmic protein aapJ [Escherichia
           coli EPECa14]
 gi|323162953|gb|EFZ48788.1| general L-amino acid-binding periplasmic protein aapJ [Escherichia
           coli E128010]
 gi|323173472|gb|EFZ59101.1| general L-amino acid-binding periplasmic protein aapJ [Escherichia
           coli LT-68]
 gi|323178551|gb|EFZ64127.1| general L-amino acid-binding periplasmic protein aapJ [Escherichia
           coli 1180]
 gi|323183028|gb|EFZ68427.1| general L-amino acid-binding periplasmic protein aapJ [Escherichia
           coli 1357]
 gi|323376846|gb|ADX49114.1| extracellular solute-binding protein family 3 [Escherichia coli
           KO11]
 gi|323946885|gb|EGB42901.1| lysine-arginine-ornithine-binding periplasmic protein [Escherichia
           coli H120]
 gi|324009098|gb|EGB78317.1| lysine-arginine-ornithine-binding periplasmic protein [Escherichia
           coli MS 57-2]
 gi|324020751|gb|EGB89970.1| lysine-arginine-ornithine-binding periplasmic protein [Escherichia
           coli MS 117-3]
 gi|324119448|gb|EGC13331.1| lysine-arginine-ornithine-binding periplasmic protein [Escherichia
           coli E1167]
 gi|326337965|gb|EGD61799.1| Glutamate Aspartate periplasmic binding protein precursor GltI
           [Escherichia coli O157:H7 str. 1125]
 gi|326347534|gb|EGD71259.1| Glutamate Aspartate periplasmic binding protein precursor GltI
           [Escherichia coli O157:H7 str. 1044]
 gi|332086450|gb|EGI91597.1| general L-amino acid-binding periplasmic protein aapJ [Shigella
           dysenteriae 155-74]
 gi|332087261|gb|EGI92394.1| general L-amino acid-binding periplasmic protein aapJ [Shigella
           boydii 5216-82]
 gi|332102250|gb|EGJ05596.1| amino acid ABC transporter [Shigella sp. D9]
          Length = 341

 Score =  353 bits (906), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 154/319 (48%), Positives = 224/319 (70%), Gaps = 2/319 (0%)

Query: 24  ASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPL 83
            + L  ++K+GF++CGI+ GL GF+   A+G + G DVD CR +++A+F D +K++Y PL
Sbjct: 25  GATLDAVQKKGFVQCGISDGLPGFSYADADGKFSGIDVDVCRGVAAAVFGDDTKVKYTPL 84

Query: 84  NAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQL 143
            AKERF ALQS ++D+LSRNT WT  R+  +G+AF  +TY+DG GF+ H K G+ S  +L
Sbjct: 85  TAKERFTALQSGEVDLLSRNTTWTSSRDAGMGMAFTGVTYYDGIGFLTHDKAGLKSAKEL 144

Query: 144 SGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYA 203
            GA++C+QAGT TEL +ADYFKA+NMKY P+ F+R +E   A  + RCD    D S LYA
Sbjct: 145 DGATVCIQAGTDTELNVADYFKANNMKYTPVTFDRSDESAKALESGRCDTLASDQSQLYA 204

Query: 204 LKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQ 263
           L++    P+E ++LP++ISK PL P + +GD EW++IV WT +AM+ AEE+GI  +N+++
Sbjct: 205 LRIKLSNPAEWIVLPEVISKEPLGPVVRRGDDEWFSIVRWTLFAMLNAEEMGINSQNVDE 264

Query: 264 VSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIP 323
            + +   PD+   LG  K  + G+ L L   W Y II+ +GNY E+F+RN+G++S LKI 
Sbjct: 265 KAANPATPDMAHLLG--KEGDYGKDLKLDNKWAYNIIKQVGNYSEIFERNVGSESPLKIK 322

Query: 324 RGYNALWSKGGLMYAPPIR 342
           RG N LW+ GG+ YAPP+R
Sbjct: 323 RGQNNLWNNGGIQYAPPVR 341


>gi|91978841|ref|YP_571500.1| extracellular solute-binding protein [Rhodopseudomonas palustris
           BisB5]
 gi|91685297|gb|ABE41599.1| extracellular solute-binding protein, family 3 [Rhodopseudomonas
           palustris BisB5]
          Length = 341

 Score =  353 bits (905), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 161/311 (51%), Positives = 223/311 (71%), Gaps = 6/311 (1%)

Query: 32  KRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERFLA 91
           +R  + CG+N GL GF+     G+W GFDVDFCRA+++AIF+DP+K++++PL+A ERF  
Sbjct: 37  RRDAVLCGVNKGLPGFSTPDDKGNWSGFDVDFCRAVAAAIFNDPNKVKFVPLDANERFKE 96

Query: 92  LQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASICVQ 151
           LQS+++DILSRN+ W++ RE    L F  + Y+DGQGF+    + + +  +L G+ +CVQ
Sbjct: 97  LQSRKVDILSRNSTWSMSRETGYELYFPAVAYYDGQGFMAPAARKVETALELDGSKVCVQ 156

Query: 152 AGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTNDRP 211
            GTTT L LAD+F+ +NMKY  + F +++E+ +AY+  +CD +T D S LYAL+ T D+P
Sbjct: 157 EGTTTLLNLADFFRTNNMKYQEVKFGKLDEVVSAYKNGQCDTFTADASQLYALRQTLDKP 216

Query: 212 SEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTTNP 271
            +HVILPD+ISK PLAP + Q D +W  IV WT YAM+ AEELGIT  NI++  K +  P
Sbjct: 217 GDHVILPDLISKEPLAPVVRQRDDDWMMIVKWTLYAMINAEELGITSINIDEALK-SKKP 275

Query: 272 DVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNALWS 331
           DV R +G + +   GE LGL KDW  RIIRH+GNYGE++DRN+G   +L IPRG N LW+
Sbjct: 276 DVMRLVGTEGT--YGEELGLPKDWAARIIRHVGNYGEIYDRNVG---KLGIPRGLNQLWN 330

Query: 332 KGGLMYAPPIR 342
            GG+ YAPPIR
Sbjct: 331 AGGIQYAPPIR 341


>gi|157148848|ref|YP_001456167.1| hypothetical protein CKO_04681 [Citrobacter koseri ATCC BAA-895]
 gi|157086053|gb|ABV15731.1| hypothetical protein CKO_04681 [Citrobacter koseri ATCC BAA-895]
          Length = 341

 Score =  353 bits (905), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 157/343 (45%), Positives = 233/343 (67%), Gaps = 3/343 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNA-SILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGF 59
           M K    S+  + +L   +   +A + L  +KK+GF++CGI+ GL GF+   A+G + G 
Sbjct: 1   MKKMMIASLAAVGVLLAVANQAHAGATLDAVKKKGFVQCGISDGLPGFSYADASGKFTGI 60

Query: 60  DVDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFR 119
           DVD CR +++A+F D +K++Y PL AKERF ALQS ++D+LSRNT WT  R+  +G++F 
Sbjct: 61  DVDVCRGVAAAVFGDDTKVKYTPLTAKERFTALQSGEVDLLSRNTTWTSSRDAGMGMSFT 120

Query: 120 PITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERV 179
            +TY+DG GF+ H K G+ S  +L GA++C+QAGT TEL +ADYFKA+ MKY P+ F+R 
Sbjct: 121 GVTYYDGIGFLTHNKAGLKSAKELDGATVCIQAGTDTELNVADYFKANKMKYTPVTFDRS 180

Query: 180 EEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYN 239
           +E   A  + RCD    D S LYAL++    P+E ++LP++ISK PL P + +GD EW++
Sbjct: 181 DESAKALESGRCDTLASDQSQLYALRIKLSDPAEWIVLPEVISKEPLGPVVRRGDDEWFS 240

Query: 240 IVSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRI 299
           +V WT +AM+ AEE+GI  +N+++ + +   PD+   LG  K  + G+ L L   W Y I
Sbjct: 241 VVRWTLFAMLNAEEMGINSQNVDEKAANPATPDMAHLLG--KEGDYGKDLKLDNKWAYNI 298

Query: 300 IRHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           I+ +GNY E+F+RN+G++S LKI RG N LW+ GG+ YAPP+R
Sbjct: 299 IKQVGNYAEIFERNVGSESPLKIKRGQNNLWNNGGIQYAPPVR 341


>gi|148549630|ref|YP_001269732.1| extracellular solute-binding protein [Pseudomonas putida F1]
 gi|148513688|gb|ABQ80548.1| extracellular solute-binding protein, family 3 [Pseudomonas putida
           F1]
          Length = 342

 Score =  353 bits (905), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 158/324 (48%), Positives = 227/324 (70%), Gaps = 2/324 (0%)

Query: 19  SFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKI 78
           S +   + L  +KK+GF++CG++ GL GF+   A G   G D D CRA+++A+F D +K+
Sbjct: 21  STAQAGATLDAVKKKGFVQCGVSDGLPGFSVPDAQGKIVGIDADVCRAVAAAVFRDATKV 80

Query: 79  QYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGIS 138
           ++  LNAKERF ALQS ++D+LSRNT WT  R+  +GL F  +TY+DG GF+++KK G+S
Sbjct: 81  KFSQLNAKERFTALQSGEVDVLSRNTTWTSSRDAGMGLVFAGVTYYDGVGFLVNKKLGVS 140

Query: 139 SVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDI 198
           S  +L GA+IC+QAGTTTEL ++D+F+A+ +KY PI F+  +E   +  + RCD  T D 
Sbjct: 141 SAKELDGATICIQAGTTTELNVSDFFRANGLKYTPITFDTSDESAKSLESGRCDVLTSDK 200

Query: 199 SALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQ 258
           S L+A +     P+++V+LP+ ISK PL P + +GD EW++IV WT +AM+ AEE GIT 
Sbjct: 201 SQLFAQRSKLAAPTDYVVLPETISKEPLGPVVRKGDEEWFSIVKWTLFAMLNAEEAGITS 260

Query: 259 KNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQS 318
           KN+   +K T NPDV R LG D     G+ L L KDW  +I++ +GNYGE+F++NLG  +
Sbjct: 261 KNVEAEAKATKNPDVARLLGAD--GEYGKDLKLPKDWVVQIVKQVGNYGEVFEKNLGQST 318

Query: 319 ELKIPRGYNALWSKGGLMYAPPIR 342
           +LKI RG NALW+ GG+ YAPP+R
Sbjct: 319 DLKIDRGMNALWNNGGIQYAPPVR 342


>gi|148980390|ref|ZP_01816033.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Vibrionales bacterium SWAT-3]
 gi|145961262|gb|EDK26574.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Vibrionales bacterium SWAT-3]
          Length = 342

 Score =  353 bits (905), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 159/318 (50%), Positives = 223/318 (70%), Gaps = 3/318 (0%)

Query: 25  SILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLN 84
           S L  +  +GFL CG++TGL GF+   + G+W+G DV++C+AL++A+  D +K++Y+PL 
Sbjct: 28  STLDKVTSQGFLTCGVSTGLPGFSNPNSKGEWEGIDVEYCQALAAAVLGDKTKVKYVPLT 87

Query: 85  AKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLS 144
           AKERF ALQS +ID+LSRNT WTL R+ +LGL F  + Y+DGQGF++ K  G++S  +L 
Sbjct: 88  AKERFTALQSGEIDVLSRNTTWTLHRDTALGLNFVGVNYYDGQGFMVKKDLGLTSALELD 147

Query: 145 GASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYAL 204
           GAS+CVQ+GTTTEL LADYF+ + M Y P+VF+   +    + A RCD  T D S LYAL
Sbjct: 148 GASVCVQSGTTTELNLADYFRNNGMSYKPVVFDTAAQTSKGFDAGRCDVLTTDQSGLYAL 207

Query: 205 KLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQV 264
           +L    P    +LP+IISK PL P + Q D +W+N+  WT  AMV AEE GI+ KN +++
Sbjct: 208 RLNLADPKSAQVLPEIISKEPLGPVVRQDDDKWFNVAKWTLSAMVNAEEYGISSKNADEM 267

Query: 265 SKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPR 324
            K + +P+++R LG+D     G+ LG+  DW Y++I+ +GNYGE F+R +G  S L+I R
Sbjct: 268 LK-SKDPNIKRILGVDGPK--GKGLGIRDDWGYQVIKQVGNYGESFERTVGTGSPLQIDR 324

Query: 325 GYNALWSKGGLMYAPPIR 342
           G NALW+ GG MYAPPIR
Sbjct: 325 GVNALWNAGGFMYAPPIR 342


>gi|153008737|ref|YP_001369952.1| extracellular solute-binding protein [Ochrobactrum anthropi ATCC
           49188]
 gi|151560625|gb|ABS14123.1| extracellular solute-binding protein family 3 [Ochrobactrum
           anthropi ATCC 49188]
          Length = 339

 Score =  353 bits (905), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 164/342 (47%), Positives = 223/342 (65%), Gaps = 3/342 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           M K    S+L             A  L  +K+RG + CG++ G+ GF+     G W GFD
Sbjct: 1   MKKIVLGSLLAAGFAMSAQSGAQADTLSTVKERGKINCGVSQGVAGFSSPDDQGKWTGFD 60

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
           +DFCRA+S+A+F DP K+ ++PL+ KERF ALQS  +D+LSR T WTL R+  +G+ F  
Sbjct: 61  IDFCRAVSAAVFGDPDKVSFIPLSTKERFTALQSGTVDLLSRQTTWTLSRDAGMGIHFVG 120

Query: 121 ITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVE 180
             Y+DGQGF++ K  GI S  +L GAS+C + GTTTE   AD+F A+++KY P+V +  +
Sbjct: 121 TAYYDGQGFMIRKDLGIDSALKLDGASVCTEQGTTTEQNAADFFSANSIKYEPVVIDSAD 180

Query: 181 EIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNI 240
            I  A+   RCD YT D SALYA +L    P    +LP++ISK PL PA+ QGD +W+NI
Sbjct: 181 GILKAFETGRCDVYTTDASALYAQRLKLAEPDAFTVLPEVISKEPLGPAVRQGDDKWFNI 240

Query: 241 VSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRII 300
           V WT +AM+ AEELGITQ + +    ++  PDV+RFLG +  S  G+ LGL   W Y ++
Sbjct: 241 VRWTLFAMLEAEELGITQASAD-ADLNSKKPDVRRFLGSEGDS--GQQLGLEPKWAYNVV 297

Query: 301 RHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
             +GNYGEMF+R +G  S LKI RG NALW+KGGLMYAPP++
Sbjct: 298 SKIGNYGEMFERTIGKGSLLKIDRGINALWNKGGLMYAPPVK 339


>gi|307300514|ref|ZP_07580294.1| extracellular solute-binding protein family 3 [Sinorhizobium
           meliloti BL225C]
 gi|307318379|ref|ZP_07597814.1| extracellular solute-binding protein family 3 [Sinorhizobium
           meliloti AK83]
 gi|306896061|gb|EFN26812.1| extracellular solute-binding protein family 3 [Sinorhizobium
           meliloti AK83]
 gi|306904680|gb|EFN35264.1| extracellular solute-binding protein family 3 [Sinorhizobium
           meliloti BL225C]
          Length = 336

 Score =  353 bits (905), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 158/335 (47%), Positives = 234/335 (69%), Gaps = 7/335 (2%)

Query: 12  LIILFFTSF----STNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRAL 67
           ++ LF T+F    +  A+ L  +K+RG L+CG++ G++GF+     G+W GFD+DFCRA+
Sbjct: 5   ILALFATAFLAGTTAQAATLDVVKQRGELRCGVSQGVLGFSAPDDKGEWSGFDIDFCRAV 64

Query: 68  SSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQ 127
           ++A    P K++Y+PL+ KERF ALQS ++D+LSR T WTL R+  LG++F  + Y+DGQ
Sbjct: 65  AAATLGSPDKVKYVPLSTKERFTALQSGEVDLLSRQTTWTLSRDTDLGMSFVGVNYYDGQ 124

Query: 128 GFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYR 187
            F++    G+ SV +LSGAS+C + GTTTE  +ADYF A+ ++Y  I FE+ ++   A+ 
Sbjct: 125 AFMVRGDIGVKSVKELSGASVCTETGTTTEQNMADYFSANKIEYQVIAFEKADQTIQAFN 184

Query: 188 AHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYA 247
           + RCD Y+ D SALY+ +LT + P   V+LP++ISK PL PA+ QGD +W+ +V WT +A
Sbjct: 185 SGRCDVYSTDASALYSQRLTLNDPDRFVVLPEVISKEPLGPAVRQGDDQWFKVVRWTLFA 244

Query: 248 MVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYG 307
           M+ AEELGIT++N   + +  T    +RFLGID  +  G+ALGL   W Y+ +  +GNYG
Sbjct: 245 MIEAEELGITRENAASLLESGTAAQ-KRFLGIDNEA--GKALGLDPKWAYQTVAAVGNYG 301

Query: 308 EMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           E+F+R+LG +S L+I RG N LW+ GGL+YAPP+R
Sbjct: 302 EIFERHLGKESALRIDRGLNKLWNNGGLIYAPPVR 336


>gi|170720090|ref|YP_001747778.1| extracellular solute-binding protein [Pseudomonas putida W619]
 gi|169758093|gb|ACA71409.1| extracellular solute-binding protein family 3 [Pseudomonas putida
           W619]
          Length = 342

 Score =  353 bits (905), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 157/324 (48%), Positives = 226/324 (69%), Gaps = 2/324 (0%)

Query: 19  SFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKI 78
           S +   + L  +KK+GF++CG++ GL GF+   A G   G D D CRA+++A+F D +K+
Sbjct: 21  STAQAGATLDAVKKKGFVQCGVSDGLPGFSVPDAQGKIVGIDADVCRAVAAAVFGDATKV 80

Query: 79  QYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGIS 138
           ++  LNAKERF ALQS ++D+LSRNT WT  R+  +GL F  +TY+DG GF+++KK G+S
Sbjct: 81  KFSQLNAKERFTALQSGEVDVLSRNTTWTSSRDAGMGLVFAGVTYYDGVGFLVNKKLGVS 140

Query: 139 SVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDI 198
           S  +L GA+IC+QAGTTTEL ++DYF+A+ +KY PI F+  +E   +  + RCD  T D 
Sbjct: 141 SAKELDGATICIQAGTTTELNVSDYFRANGLKYTPITFDTSDESAKSLESGRCDVLTSDK 200

Query: 199 SALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQ 258
           S L+A +     P+++V+LP+ ISK PL P + +GD EW++IV WT +AM+ AEE G+T 
Sbjct: 201 SQLFAQRSKLAGPTDYVVLPETISKEPLGPVVRKGDEEWFSIVKWTLFAMLNAEEAGVTS 260

Query: 259 KNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQS 318
           KN+   +K T NPD  R LG D     G+ L L KDW  +I++ +GNYGE+F++NLG  +
Sbjct: 261 KNVEAEAKSTKNPDTARLLGAD--GEYGKDLKLPKDWVVQIVKQVGNYGEVFEKNLGQST 318

Query: 319 ELKIPRGYNALWSKGGLMYAPPIR 342
           +LKI RG NALW+ GG+ YAPP+R
Sbjct: 319 DLKIDRGMNALWNNGGIQYAPPVR 342


>gi|331664877|ref|ZP_08365782.1| putative amino-acid ABC transporter-binding protein YhdW
           [Escherichia coli TA143]
 gi|331058125|gb|EGI30107.1| putative amino-acid ABC transporter-binding protein YhdW
           [Escherichia coli TA143]
          Length = 341

 Score =  353 bits (905), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 154/319 (48%), Positives = 223/319 (69%), Gaps = 2/319 (0%)

Query: 24  ASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPL 83
            + L  ++K+GF++CGI+ GL GF+   A+G + G DVD CR +++A+F D +K++Y PL
Sbjct: 25  GATLDAVQKKGFVQCGISDGLPGFSYADADGKFSGIDVDVCRGVAAAVFGDDTKVKYTPL 84

Query: 84  NAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQL 143
            AKERF ALQS ++D+LSRNT WT  R+  +G+AF  +TY+DG GF+ H K G+ S  +L
Sbjct: 85  TAKERFTALQSGEVDLLSRNTTWTSSRDAGMGMAFTGVTYYDGIGFLTHDKAGLKSAKEL 144

Query: 144 SGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYA 203
            GA++C+QAGT TEL +ADYFKA+NMKY P+ F+R +E   A  + RCD    D S LYA
Sbjct: 145 DGATVCIQAGTDTELNVADYFKANNMKYTPVTFDRSDESAKALESGRCDTLASDQSQLYA 204

Query: 204 LKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQ 263
           L++    P+E ++LP++ISK PL P + +GD EW++IV WT +AM+ AEE+GI  +N+++
Sbjct: 205 LRIKLSNPAEWIVLPEVISKEPLGPVVRRGDDEWFSIVRWTLFAMLNAEEMGINSQNVDE 264

Query: 264 VSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIP 323
              +   PD+   LG  K  + G+ L L   W Y II+ +GNY E+F+RN+G++S LKI 
Sbjct: 265 KEANPATPDMAHLLG--KEGDYGKDLKLDNKWAYNIIKQVGNYSEIFERNVGSESPLKIK 322

Query: 324 RGYNALWSKGGLMYAPPIR 342
           RG N LW+ GG+ YAPP+R
Sbjct: 323 RGQNNLWNNGGIQYAPPVR 341


>gi|116051889|ref|YP_789268.1| putative amino acid-binding protein [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|115587110|gb|ABJ13125.1| Putative amino-acid ABC transporter binding protei [Pseudomonas
           aeruginosa UCBPP-PA14]
          Length = 341

 Score =  353 bits (905), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 156/334 (46%), Positives = 233/334 (69%), Gaps = 2/334 (0%)

Query: 9   ILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALS 68
           +L  + L  ++ +   + L  +K++G+++CG++ GL GF+   A G +KG DVD CRAL+
Sbjct: 10  LLAAVCLGASATAEAGATLDAVKRKGYVQCGVSDGLPGFSYADAKGRFKGLDVDICRALA 69

Query: 69  SAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQG 128
           +A+F D  K+++ PL A ERF ALQS  +D+LSRNT WT  R+ +LG+ F  +TYFDGQG
Sbjct: 70  AALFGDAEKVRFTPLPATERFSALQSGTVDLLSRNTSWTSSRDTALGIHFTGVTYFDGQG 129

Query: 129 FIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRA 188
           F++++K G+SS  +L  A++C+Q+GTT EL +ADYF+AH ++Y  ++ +  E+   A  A
Sbjct: 130 FLVNRKLGVSSARELKDATVCIQSGTTNELNVADYFRAHGIRYKAVLDDSYEKSARALEA 189

Query: 189 HRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAM 248
            +CD  + D S LYA +L   +P ++V+LP++ISK PL PA+ QGD  W+NIV WT Y +
Sbjct: 190 GQCDVLSSDQSQLYAQRLKLAKPDQYVVLPEVISKEPLGPAVRQGDEAWFNIVRWTLYGL 249

Query: 249 VTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGE 308
           + AEELG+T  N+ + ++D+ NPDV R LG     + G+ L L +DW  +++R +GNYGE
Sbjct: 250 LNAEELGVTSSNVERQARDSRNPDVARLLG--SEGDAGKDLQLPRDWVVQMVRQVGNYGE 307

Query: 309 MFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           +F RN+G+ S LK+PRG NA W+ GGL YAPPIR
Sbjct: 308 IFARNVGDGSPLKMPRGLNAQWNLGGLHYAPPIR 341


>gi|325498846|gb|EGC96705.1| putative amino-acid ABC transporter binding protein yhdW precursor
           [Escherichia fergusonii ECD227]
          Length = 341

 Score =  353 bits (905), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 153/319 (47%), Positives = 224/319 (70%), Gaps = 2/319 (0%)

Query: 24  ASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPL 83
            + L  ++K+GF++CGI+ GL GF+   A+G + G DVD CR +++A+F D +K++Y PL
Sbjct: 25  GATLDAVQKKGFVQCGISDGLPGFSYADADGKFSGIDVDVCRGVAAAVFGDDTKVKYTPL 84

Query: 84  NAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQL 143
            AKERF ALQS ++D+LSRNT WT  R+  +G+AF  +TY+DG GF+ H K G+ S  +L
Sbjct: 85  TAKERFTALQSGEVDLLSRNTTWTSSRDAGMGMAFTGVTYYDGIGFLTHDKAGLKSAKEL 144

Query: 144 SGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYA 203
            GA++C+QAGT TEL +ADYFKA+NMKY P+ F+R +E   A  + RCD    D S LYA
Sbjct: 145 DGATVCIQAGTDTELNVADYFKANNMKYTPVTFDRSDESAKALESGRCDTLASDQSQLYA 204

Query: 204 LKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQ 263
           L++    P+E ++LP++ISK PL P + +GD EW++IV WT +AM+ AEE+G+  +N+++
Sbjct: 205 LRIKLSNPTEWIVLPEVISKEPLGPVVRRGDDEWFSIVRWTLFAMLNAEEMGVNSQNVDE 264

Query: 264 VSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIP 323
            + +   PD+   LG  K  + G+ L L   W Y II+ +GNY E+F+RN+G++S LKI 
Sbjct: 265 KAANPATPDMAHLLG--KEGDYGKDLKLDNKWAYNIIKQVGNYSEIFERNVGSESPLKIK 322

Query: 324 RGYNALWSKGGLMYAPPIR 342
           RG N LW+ GG+ YAPP+R
Sbjct: 323 RGQNNLWNNGGIQYAPPVR 341


>gi|194435095|ref|ZP_03067332.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Shigella dysenteriae 1012]
 gi|194416657|gb|EDX32789.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Shigella dysenteriae 1012]
          Length = 341

 Score =  352 bits (904), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 154/319 (48%), Positives = 224/319 (70%), Gaps = 2/319 (0%)

Query: 24  ASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPL 83
            + L  ++K+GF++CGI+ GL GF+   A+G + G DVD CR +++A+F D +K++Y PL
Sbjct: 25  GATLDAVQKKGFVQCGISDGLPGFSYADADGKFSGIDVDVCRGVAAAVFGDDTKVKYTPL 84

Query: 84  NAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQL 143
            AKERF ALQS ++D+LSRNT WT  R+  +G+AF  +TY+DG GF+ H K G+ S  +L
Sbjct: 85  TAKERFTALQSGEVDLLSRNTTWTSSRDAGMGMAFTGVTYYDGIGFLTHDKAGLKSAKEL 144

Query: 144 SGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYA 203
            GA++C+QAGT TEL +ADYFKA+NMKY P+ F+R +E   A  + RCD    D S LYA
Sbjct: 145 DGATVCIQAGTDTELNVADYFKANNMKYTPVTFDRSDESAKALESGRCDTLASDQSQLYA 204

Query: 204 LKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQ 263
           L++    P+E ++LP++ISK PL P + +GD EW++IV WT +AM+ AEE+GI  +N+++
Sbjct: 205 LRIKLSNPAEWIVLPEVISKEPLGPVVRRGDDEWFSIVRWTLFAMLNAEEMGIDSQNVDE 264

Query: 264 VSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIP 323
            + +   PD+   LG  K  + G+ L L   W Y II+ +GNY E+F+RN+G++S LKI 
Sbjct: 265 KAANPATPDMAHLLG--KEGDYGKDLKLDNKWAYNIIKQVGNYSEIFERNVGSESPLKIK 322

Query: 324 RGYNALWSKGGLMYAPPIR 342
           RG N LW+ GG+ YAPP+R
Sbjct: 323 RGQNNLWNNGGIQYAPPVR 341


>gi|239832600|ref|ZP_04680929.1| amino-acid ABC transporter-binding protein yhdW precursor
           [Ochrobactrum intermedium LMG 3301]
 gi|239824867|gb|EEQ96435.1| amino-acid ABC transporter-binding protein yhdW precursor
           [Ochrobactrum intermedium LMG 3301]
          Length = 339

 Score =  352 bits (904), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 160/335 (47%), Positives = 220/335 (65%), Gaps = 3/335 (0%)

Query: 8   SILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRAL 67
           S+L             A  L  +K+RG L CG++ G+ GF+     G W GFD+DFCRA+
Sbjct: 8   SLLAAGFALSAQGGAQADTLSTVKERGKLNCGVSQGVAGFSSPDDQGKWTGFDIDFCRAV 67

Query: 68  SSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQ 127
           S+A+F DP K+ ++PL+ KERF ALQS  +D+LSR T WTL R+  +G+ F    Y+DGQ
Sbjct: 68  SAAVFGDPDKVSFIPLSTKERFTALQSGTVDLLSRQTTWTLSRDAGMGILFVGTAYYDGQ 127

Query: 128 GFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYR 187
           GF++ K  G+ S  +L GAS+C + GTTTE   ADYF A+N+KY P+V +  + I  A+ 
Sbjct: 128 GFLIRKDLGVDSALKLDGASVCTEQGTTTEQNAADYFSANNIKYEPVVIDSADGILKAFE 187

Query: 188 AHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYA 247
             RCD YT D SALYA +L    P    +LP++ISK PL PA+ QGD +W+N+V WT +A
Sbjct: 188 TGRCDVYTTDASALYAQRLKLAEPDAFTVLPEVISKEPLGPAVRQGDDKWFNVVRWTLFA 247

Query: 248 MVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYG 307
           ++ AEELG+TQ +  +   ++  PDV+RFLG     + G+ LGL   W Y ++  +GNYG
Sbjct: 248 LLEAEELGVTQASA-EADLNSKKPDVRRFLG--SEGDGGQQLGLEPKWAYNVVSTIGNYG 304

Query: 308 EMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           EMF+R +G  S LKI RG NALW+KGGLMYAPP++
Sbjct: 305 EMFERTIGKGSLLKIDRGLNALWNKGGLMYAPPVK 339


>gi|301022227|ref|ZP_07186142.1| lysine-arginine-ornithine-binding periplasmic protein [Escherichia
           coli MS 69-1]
 gi|331674783|ref|ZP_08375542.1| putative amino-acid ABC transporter-binding protein YhdW
           [Escherichia coli TA280]
 gi|284923282|emb|CBG36376.1| Putative ABC transporter, substrate-binding protein [Escherichia
           coli 042]
 gi|300397640|gb|EFJ81178.1| lysine-arginine-ornithine-binding periplasmic protein [Escherichia
           coli MS 69-1]
 gi|323966446|gb|EGB61880.1| lysine-arginine-ornithine-binding periplasmic protein [Escherichia
           coli M863]
 gi|323979012|gb|EGB74090.1| lysine-arginine-ornithine-binding periplasmic protein [Escherichia
           coli TW10509]
 gi|324115128|gb|EGC09092.1| lysine-arginine-ornithine-binding periplasmic protein [Escherichia
           fergusonii B253]
 gi|327251362|gb|EGE63051.1| general L-amino acid-binding periplasmic protein aapJ [Escherichia
           coli STEC_7v]
 gi|331068222|gb|EGI39618.1| putative amino-acid ABC transporter-binding protein YhdW
           [Escherichia coli TA280]
          Length = 341

 Score =  352 bits (904), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 153/319 (47%), Positives = 224/319 (70%), Gaps = 2/319 (0%)

Query: 24  ASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPL 83
            + L  ++K+GF++CGI+ GL GF+   A+G + G DVD CR +++A+F D +K++Y PL
Sbjct: 25  GATLDAVQKKGFVQCGISDGLPGFSYADADGKFSGIDVDVCRGVAAAVFGDDTKVKYTPL 84

Query: 84  NAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQL 143
            AKERF ALQS ++D+LSRNT WT  R+  +G+AF  +TY+DG GF+ H K G+ S  +L
Sbjct: 85  TAKERFTALQSGEVDLLSRNTTWTSSRDAGMGMAFTGVTYYDGIGFLTHDKAGLKSAKEL 144

Query: 144 SGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYA 203
            GA++C+QAGT TEL +ADYFKA+NMKY P+ F+R +E   A  + RCD    D S LYA
Sbjct: 145 DGATVCIQAGTDTELNVADYFKANNMKYTPVTFDRSDESAKALESGRCDTLASDQSQLYA 204

Query: 204 LKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQ 263
           L++    P+E ++LP++ISK PL P + +GD EW++IV WT +AM+ AEE+G+  +N+++
Sbjct: 205 LRIKLSNPAEWIVLPEVISKEPLGPVVRRGDDEWFSIVRWTLFAMLNAEEMGVNSQNVDE 264

Query: 264 VSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIP 323
            + +   PD+   LG  K  + G+ L L   W Y II+ +GNY E+F+RN+G++S LKI 
Sbjct: 265 KAANPATPDMAHLLG--KEGDYGKDLKLDNKWAYNIIKQVGNYSEIFERNVGSESPLKIK 322

Query: 324 RGYNALWSKGGLMYAPPIR 342
           RG N LW+ GG+ YAPP+R
Sbjct: 323 RGQNNLWNNGGIQYAPPVR 341


>gi|304396995|ref|ZP_07378875.1| extracellular solute-binding protein family 3 [Pantoea sp. aB]
 gi|304355791|gb|EFM20158.1| extracellular solute-binding protein family 3 [Pantoea sp. aB]
          Length = 341

 Score =  352 bits (904), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 155/319 (48%), Positives = 220/319 (68%), Gaps = 2/319 (0%)

Query: 24  ASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPL 83
            + L  IKK+GF++CGI+ GL GF+   A G + G DVD CRA ++A+F D +K++Y PL
Sbjct: 25  GTTLDAIKKKGFVQCGISDGLPGFSYADAGGKFTGIDVDVCRATAAAVFGDATKVKYTPL 84

Query: 84  NAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQL 143
            AKERF ALQS ++D+LSRNT WT  R+  +G  F  + Y+DG GF+ HKK G+ S  +L
Sbjct: 85  TAKERFTALQSGEVDVLSRNTTWTSSRDGGMGFLFAGVNYYDGIGFLTHKKAGLKSAKEL 144

Query: 144 SGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYA 203
            GA++C+Q+GT TEL +ADYFKA+ M+Y P+ F+R +E   A  + RCD    D S LYA
Sbjct: 145 DGATVCIQSGTDTELNVADYFKANKMQYTPVTFDRSDESAKALDSGRCDTLASDQSQLYA 204

Query: 204 LKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQ 263
           L++   +P + ++LP++ISK PL P + +GD +W+ IV W+ YAM+ AEE+GI  KN++Q
Sbjct: 205 LRIKLGKPDDFIVLPEVISKEPLGPLVRRGDDDWFTIVKWSLYAMLNAEEMGINSKNVDQ 264

Query: 264 VSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIP 323
           ++   T PD+  FLG +   + G+ L L   W Y I++ +GNY E FDRN+G  S LKI 
Sbjct: 265 MTAKPTTPDMAHFLGAE--GDFGKDLKLDNKWAYNIVKQVGNYQESFDRNVGKDSALKIA 322

Query: 324 RGYNALWSKGGLMYAPPIR 342
           RG NALW++GG+ YAPP+R
Sbjct: 323 RGQNALWNQGGIQYAPPVR 341


>gi|330963203|gb|EGH63463.1| amino acid ABC transporter periplasmic amino acid-binding protein
           [Pseudomonas syringae pv. actinidiae str. M302091]
          Length = 342

 Score =  352 bits (904), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 163/342 (47%), Positives = 229/342 (66%), Gaps = 2/342 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           M K     +  L     T  +   + L  I K+GF++CG++ GL GF+   + G   G D
Sbjct: 3   MLKSTLAIVTALTAFGVTGAANAGTTLDAIVKKGFVQCGVSDGLPGFSVPDSTGKITGID 62

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
            D CRA+++A+F D +K+++  LNAKERF ALQS +IDILSRNT WT  R+ ++GL F  
Sbjct: 63  ADVCRAVAAAVFGDATKVKFSQLNAKERFTALQSGEIDILSRNTTWTSSRDSAMGLMFAG 122

Query: 121 ITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVE 180
           +TY+DG GF+++KK G++S  +L GA+IC+QAGTTTEL ++DYF+++N+KY PI F+  +
Sbjct: 123 VTYYDGIGFLVNKKLGVNSAKELDGATICIQAGTTTELNVSDYFRSNNLKYTPITFDTSD 182

Query: 181 EIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNI 240
           E   +    RCD  T D S LYA +    +P ++V+LP++ISK PL P + + D EW+ I
Sbjct: 183 ESAKSLEGGRCDVLTSDQSQLYAQRSKLAKPDDYVVLPEVISKEPLGPVVRKNDPEWFAI 242

Query: 241 VSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRII 300
           V WT +AM+ AEE  IT KN+   +K T NPDV R LG D +   G+ L L KDW  +I+
Sbjct: 243 VKWTLFAMLNAEEAKITSKNVEAEAKATKNPDVARMLGADGT--YGKDLNLPKDWVVQIV 300

Query: 301 RHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           + +GNYGE+F+RNLG  + LKI RG NALW+ GG+ YAPPIR
Sbjct: 301 KQVGNYGEVFERNLGEGTPLKIKRGQNALWNAGGIQYAPPIR 342


>gi|322834718|ref|YP_004214745.1| extracellular solute-binding protein family 3 [Rahnella sp. Y9602]
 gi|321169919|gb|ADW75618.1| extracellular solute-binding protein family 3 [Rahnella sp. Y9602]
          Length = 341

 Score =  352 bits (904), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 159/340 (46%), Positives = 230/340 (67%), Gaps = 8/340 (2%)

Query: 9   ILCLIILFFTSFSTNA------SILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVD 62
           IL   ++   SF T A      + L  +KK+GF++CGI+ GL GF+   + G + G DVD
Sbjct: 4   ILLSTLIAAASFVTLAGQAHAGTTLDAVKKKGFVQCGISDGLPGFSYADSKGKFTGIDVD 63

Query: 63  FCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPIT 122
            CRA+++A+F D  K++Y PL AKERF ALQS ++DILSRNT WT  R+  +G+ F  + 
Sbjct: 64  VCRAVAAAVFGDAEKVKYTPLTAKERFTALQSGEVDILSRNTTWTSSRDAGMGMIFAGVN 123

Query: 123 YFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEI 182
           Y+DG GF+ H+K G+ S  +L GA++C+QAGT TEL +ADYFKA+ M Y P+ F+R +E 
Sbjct: 124 YYDGIGFLTHQKAGLKSAKELDGATVCLQAGTDTELNVADYFKANKMTYTPVTFDRSDES 183

Query: 183 DAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVS 242
             A  + RCD    D S LYAL++   +P E ++LP++ISK PL P + +GD +W  IV 
Sbjct: 184 AKALDSGRCDTLASDQSQLYALRIKLGKPDEFIVLPEVISKEPLGPVVRRGDEDWLAIVR 243

Query: 243 WTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRH 302
           W+ +AM+ AEE+G+T +N+++++ + T PD+   LG  K+   G  L +  DW  +I++ 
Sbjct: 244 WSLFAMLNAEEMGVTSQNVDKLAANPTTPDMSNLLG--KTGTYGADLKVPNDWVVKIVKQ 301

Query: 303 MGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           +GNYGE F+RN+G  SELKI RG NALW+KGG+ YAPP+R
Sbjct: 302 VGNYGESFERNVGQGSELKIKRGQNALWNKGGIQYAPPVR 341


>gi|330873115|gb|EGH07264.1| amino acid ABC transporter periplasmic amino acid-binding protein
           [Pseudomonas syringae pv. morsprunorum str. M302280PT]
          Length = 342

 Score =  352 bits (903), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 163/342 (47%), Positives = 229/342 (66%), Gaps = 2/342 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           M K     +  L     T  +   + L  I K+GF++CG++ GL GF+   + G   G D
Sbjct: 3   MLKSTLAIVTALTAFGVTGAANAGATLDAIVKKGFVQCGVSDGLPGFSVPDSTGKITGID 62

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
            D CRA+++A+F D +K+++  LNAKERF ALQS +IDILSRNT WT  R+ ++GL F  
Sbjct: 63  ADVCRAVAAAVFGDATKVKFSQLNAKERFTALQSGEIDILSRNTTWTSSRDSAMGLMFAG 122

Query: 121 ITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVE 180
           +TY+DG GF+++KK G++S  +L GA+IC+QAGTTTEL ++DYF+++N+KY PI F+  +
Sbjct: 123 VTYYDGIGFLVNKKLGVNSAKELDGATICIQAGTTTELNVSDYFRSNNLKYTPITFDTSD 182

Query: 181 EIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNI 240
           E   +    RCD  T D S LYA +    +P ++V+LP++ISK PL P + + D EW+ I
Sbjct: 183 ESAKSLEGGRCDVLTSDQSQLYAQRSKLAKPDDYVVLPEVISKEPLGPVVRKNDPEWFAI 242

Query: 241 VSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRII 300
           V WT +AM+ AEE  IT KN+   +K T NPDV R LG D +   G+ L L KDW  +I+
Sbjct: 243 VKWTLFAMLNAEEAKITSKNVEAEAKATKNPDVARMLGADGT--YGKDLNLPKDWVVQIV 300

Query: 301 RHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           + +GNYGE+F+RNLG  + LKI RG NALW+ GG+ YAPPIR
Sbjct: 301 KQVGNYGEVFERNLGEGTPLKIKRGQNALWNAGGIQYAPPIR 342


>gi|289678218|ref|ZP_06499108.1| extracellular solute-binding protein [Pseudomonas syringae pv.
           syringae FF5]
 gi|330975706|gb|EGH75772.1| extracellular solute-binding protein [Pseudomonas syringae pv.
           aptata str. DSM 50252]
          Length = 342

 Score =  352 bits (903), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 161/342 (47%), Positives = 228/342 (66%), Gaps = 2/342 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           M K     +  L        +   + L  IKK+GF++CG++ GL GF+   + G   G D
Sbjct: 3   MLKSTLAVVTALAAFGVIGAANAGTTLDAIKKKGFIQCGVSDGLPGFSVPDSTGKITGID 62

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
            D CRA+++A+F D +K+++  LNAKERF ALQS +IDILSRNT WT  R+  +GL F  
Sbjct: 63  ADVCRAVAAAVFGDATKVKFSQLNAKERFTALQSGEIDILSRNTTWTSSRDAGMGLVFTG 122

Query: 121 ITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVE 180
           +TY+DG GF+++ K G++S  +L GA+IC+QAGTTTEL ++DYF+++ +KY PI F+  +
Sbjct: 123 VTYYDGIGFLVNNKLGVNSAKELDGATICIQAGTTTELNVSDYFRSNGLKYTPITFDTSD 182

Query: 181 EIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNI 240
           E   +    RCD  T D S LYA +    +P ++++LP++ISK PL P + +GD EW++I
Sbjct: 183 ESAKSLEGGRCDVLTSDQSQLYAQRSKLAKPDDYIVLPEVISKEPLGPVVRKGDEEWFSI 242

Query: 241 VSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRII 300
           V WT +AM+ AEE  IT KN+   +K T NPDV R LG D +   G+ L L KDW  +I+
Sbjct: 243 VRWTLFAMLNAEEAKITSKNVEAEAKSTKNPDVARMLGADGT--YGQDLKLPKDWVVQIV 300

Query: 301 RHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           + +GNYGE+F+RNLG  + LKI RG NALW+ GG+ YAPPIR
Sbjct: 301 KQVGNYGEVFERNLGEGTPLKIKRGQNALWNAGGIQYAPPIR 342


>gi|330962155|gb|EGH62415.1| amino acid ABC transporter periplasmic amino acid-binding protein
           [Pseudomonas syringae pv. maculicola str. ES4326]
          Length = 342

 Score =  352 bits (903), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 161/342 (47%), Positives = 227/342 (66%), Gaps = 2/342 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           M K     +  L     T  +   + L  I+K+GF++CG++ GL GF+   + G   G D
Sbjct: 3   MLKSTLAVVTALAAFGVTGAANAGATLDAIQKKGFVQCGVSDGLPGFSVPDSTGKITGID 62

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
            D CRA+++A+F D +K+++  LNAKERF ALQS +IDILSRNT WT  R+  +GL F  
Sbjct: 63  ADVCRAVAAAVFGDATKVKFSQLNAKERFTALQSGEIDILSRNTTWTSSRDAGMGLVFTG 122

Query: 121 ITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVE 180
           +TY+DG GF+++ K G+ S  +L GA+IC+QAGTTTEL ++DYF+++ +KY PI F+  +
Sbjct: 123 VTYYDGIGFLVNNKLGVKSAKELDGATICIQAGTTTELNVSDYFRSNGLKYTPITFDTSD 182

Query: 181 EIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNI 240
           E   +    RCD  T D S LYA +    +P ++++LP++ISK PL P + +GD EW++I
Sbjct: 183 ESAKSLEGGRCDVLTSDQSQLYAQRSKLAKPDDYIVLPEVISKEPLGPVVRKGDEEWFSI 242

Query: 241 VSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRII 300
           V WT +AM+ AEE  IT KN+   +K T NPDV R LG D     G+ L L KDW  +I+
Sbjct: 243 VRWTLFAMLNAEEAKITSKNVEAEAKATKNPDVARMLGAD--GTYGKDLKLPKDWVVKIV 300

Query: 301 RHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           + +GNYGE+F+RNLG  + LKI RG NALW+ GG+ YAPPIR
Sbjct: 301 KQVGNYGEVFERNLGEGTPLKIKRGQNALWNAGGIQYAPPIR 342


>gi|15966449|ref|NP_386802.1| putative amino acid-binding periplasmic signal peptide protein
           [Sinorhizobium meliloti 1021]
 gi|15075720|emb|CAC47275.1| Putative amino acid-binding periplasmic signal peptide protein
           [Sinorhizobium meliloti 1021]
          Length = 331

 Score =  352 bits (903), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 158/334 (47%), Positives = 233/334 (69%), Gaps = 7/334 (2%)

Query: 13  IILFFTSF----STNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALS 68
           + LF T+F    +  A+ L  +K+RG L+CG++ G++GF+     G+W GFD+DFCRA++
Sbjct: 1   MALFATAFLAGTTAQAATLDVVKQRGELRCGVSQGVLGFSAPDDKGEWSGFDIDFCRAVA 60

Query: 69  SAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQG 128
           +A    P K++Y+PL+ KERF ALQS ++D+LSR T WTL R+  LG++F  + Y+DGQ 
Sbjct: 61  AATLGSPDKVKYVPLSTKERFTALQSGEVDLLSRQTTWTLSRDTDLGMSFVGVNYYDGQA 120

Query: 129 FIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRA 188
           F++    G+ SV +LSGAS+C + GTTTE  +ADYF A+ ++Y  I FE+ ++   A+ +
Sbjct: 121 FMVRGDIGVKSVKELSGASVCTETGTTTEQNMADYFSANKIEYQVIAFEKADQTIQAFNS 180

Query: 189 HRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAM 248
            RCD Y+ D SALY+ +LT + P   V+LP++ISK PL PA+ QGD +W+ +V WT +AM
Sbjct: 181 GRCDVYSTDASALYSQRLTLNDPDRFVVLPEVISKEPLGPAVRQGDDQWFKVVRWTLFAM 240

Query: 249 VTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGE 308
           + AEELGIT++N   + +  T    +RFLGID  +  G+ALGL   W Y+ +  +GNYGE
Sbjct: 241 IEAEELGITRENAASLLESGTAAQ-KRFLGIDNEA--GKALGLDPKWAYQTVAAVGNYGE 297

Query: 309 MFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           +F+R+LG +S L+I RG N LW+ GGL+YAPP+R
Sbjct: 298 IFERHLGKESALRIDRGLNKLWNNGGLIYAPPVR 331


>gi|152998388|ref|YP_001343223.1| extracellular solute-binding protein [Marinomonas sp. MWYL1]
 gi|150839312|gb|ABR73288.1| extracellular solute-binding protein family 3 [Marinomonas sp.
           MWYL1]
          Length = 341

 Score =  352 bits (903), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 156/317 (49%), Positives = 221/317 (69%), Gaps = 3/317 (0%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           L D+K +GF++CG++TG+ GF+     G+W G DVD CRA++SAIF D  K ++ PL+AK
Sbjct: 27  LEDVKAKGFVQCGVSTGVPGFSNADDKGNWTGLDVDACRAVASAIFGDAQKAKFTPLSAK 86

Query: 87  ERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGA 146
           ER  ALQS +ID+L+RNT WT  R+ SLGL F  + ++DGQGF++ K  G+ S   L GA
Sbjct: 87  ERLTALQSGEIDVLTRNTTWTYTRDASLGLDFTAVNFYDGQGFMVRKDLGVKSAMDLDGA 146

Query: 147 SICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKL 206
           ++C + GTTTEL +AD+F+ + + Y P+V ++ +E  AAY + RCD YT D S L A + 
Sbjct: 147 TVCTEQGTTTELNMADFFRKNKLSYVPVVVQKADEALAAYDSGRCDVYTTDKSGLAAHRT 206

Query: 207 TNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSK 266
               PS HVILP+ ISK PLAP +  GD +W +IV+W  +  V AEE+GIT KN+ ++  
Sbjct: 207 KLADPSAHVILPETISKEPLAPVVRHGDNQWKDIVTWALFVQVNAEEMGITSKNVAKIKA 266

Query: 267 DTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGY 326
           +T +P ++R LG++   ++G  LGL  DW Y II  +GNYGE+F+RN+G  + L IPRG 
Sbjct: 267 ETNDPSIKRLLGVE--GDMGSQLGLPADWAYNIIAKVGNYGEVFERNIGPSTPLDIPRGL 324

Query: 327 NALWSK-GGLMYAPPIR 342
           NALW++ GG+MYAPP+R
Sbjct: 325 NALWTEAGGIMYAPPVR 341


>gi|66044325|ref|YP_234166.1| extracellular solute-binding protein [Pseudomonas syringae pv.
           syringae B728a]
 gi|63255032|gb|AAY36128.1| extracellular solute-binding protein, family 3 [Pseudomonas
           syringae pv. syringae B728a]
          Length = 342

 Score =  352 bits (903), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 161/342 (47%), Positives = 226/342 (66%), Gaps = 2/342 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           M K     +  L        +   + L  IKK+GF++CG++ GL GF+   + G   G D
Sbjct: 3   MLKSTLAVVTALAAFGVIGAANAGTTLDAIKKKGFIQCGVSDGLPGFSVPDSTGKITGID 62

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
            D CRA+++A+F D +K+++  LNAKERF ALQS +IDILSRNT WT  R+  +GL F  
Sbjct: 63  ADVCRAVAAAVFGDATKVKFSQLNAKERFTALQSGEIDILSRNTTWTSSRDAGMGLVFTG 122

Query: 121 ITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVE 180
           +TY+DG GF+++ K G+ S  +L GA+IC+QAGTTTEL ++DYF+++ +KY PI F+  +
Sbjct: 123 VTYYDGIGFLVNNKLGVKSAKELDGATICIQAGTTTELNVSDYFRSNGLKYTPITFDTSD 182

Query: 181 EIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNI 240
           E   +    RCD  T D S LYA +    +P ++++LP++ISK PL P + +GD EW++I
Sbjct: 183 ESAKSLEGGRCDVLTSDQSQLYAQRSKLAKPDDYIVLPEVISKEPLGPVVRKGDEEWFSI 242

Query: 241 VSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRII 300
           V WT +AM+ AEE  IT KN+   +K T NPDV R LG D     G+ L L KDW  +I+
Sbjct: 243 VRWTLFAMLNAEEAKITSKNVEAEAKSTKNPDVARMLGAD--GTYGKDLKLEKDWVVQIV 300

Query: 301 RHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           + +GNYGE+F+RNLG  + LKI RG NALW+ GG+ YAPPIR
Sbjct: 301 KQVGNYGEVFERNLGEGTPLKIKRGQNALWNAGGIQYAPPIR 342


>gi|28868466|ref|NP_791085.1| amino acid ABC transporter periplasmic amino acid-binding protein
           [Pseudomonas syringae pv. tomato str. DC3000]
 gi|213967086|ref|ZP_03395235.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Pseudomonas syringae pv. tomato T1]
 gi|301386368|ref|ZP_07234786.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Pseudomonas syringae pv. tomato Max13]
 gi|302060650|ref|ZP_07252191.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Pseudomonas syringae pv. tomato K40]
 gi|302133060|ref|ZP_07259050.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Pseudomonas syringae pv. tomato NCPPB 1108]
 gi|28851704|gb|AAO54780.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Pseudomonas syringae pv. tomato str. DC3000]
 gi|213927928|gb|EEB61474.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Pseudomonas syringae pv. tomato T1]
 gi|331015252|gb|EGH95308.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Pseudomonas syringae pv. lachrymans str. M302278PT]
          Length = 342

 Score =  352 bits (902), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 163/342 (47%), Positives = 229/342 (66%), Gaps = 2/342 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           M K     +  L     T  +   + L  I K+GF++CG++ GL GF+   + G   G D
Sbjct: 3   MLKSTLAIVTALAAFGVTGAANAGATLDAIVKKGFVQCGVSDGLPGFSVPDSTGKITGID 62

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
            D CRA+++A+F D +K+++  LNAKERF ALQS +IDILSRNT WT  R+ ++GL F  
Sbjct: 63  ADVCRAVAAAVFGDATKVKFSQLNAKERFTALQSGEIDILSRNTTWTSSRDSAMGLMFAG 122

Query: 121 ITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVE 180
           +TY+DG GF+++KK G++S  +L GA+IC+QAGTTTEL ++DYF+++N+KY PI F+  +
Sbjct: 123 VTYYDGIGFLVNKKLGVNSAKELDGATICIQAGTTTELNVSDYFRSNNLKYTPITFDTSD 182

Query: 181 EIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNI 240
           E   +    RCD  T D S LYA +    +P ++V+LP++ISK PL P + + D EW+ I
Sbjct: 183 ESAKSLEGGRCDVLTSDQSQLYAQRSKLAKPDDYVVLPEVISKEPLGPVVRKNDPEWFAI 242

Query: 241 VSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRII 300
           V WT +AM+ AEE  IT KN+   +K T NPDV R LG D +   G+ L L KDW  +I+
Sbjct: 243 VKWTLFAMLNAEEAKITSKNVEAEAKATKNPDVARMLGADGT--YGKDLNLPKDWVVQIV 300

Query: 301 RHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           + +GNYGE+F+RNLG  + LKI RG NALW+ GG+ YAPPIR
Sbjct: 301 KQVGNYGEVFERNLGEGTPLKIKRGQNALWNAGGIQYAPPIR 342


>gi|71735932|ref|YP_273398.1| amino acid ABC transporter periplasmic amino acid-binding protein
           [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|71556485|gb|AAZ35696.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Pseudomonas syringae pv. phaseolicola 1448A]
          Length = 342

 Score =  352 bits (902), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 160/342 (46%), Positives = 228/342 (66%), Gaps = 2/342 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           M K     +  L     T  +   + L  I+K+GF++CG++ GL GF+   + G   G D
Sbjct: 3   MLKSTLAVVTALAAFGVTGVANAGATLDAIQKKGFVQCGVSDGLPGFSVPDSTGKITGID 62

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
            D CRA+++A+F D +K+++  LNAKERF ALQS +IDILSRNT WT  R+  +GL F  
Sbjct: 63  ADVCRAVAAAVFGDATKVKFSQLNAKERFTALQSGEIDILSRNTTWTSSRDAGMGLVFTG 122

Query: 121 ITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVE 180
           +TY+DG GF+++ K G+ S  +L GA+IC+QAGTTTEL ++DYF+++ +KY PI F+  +
Sbjct: 123 VTYYDGIGFLVNNKLGVKSAKELDGATICIQAGTTTELNVSDYFRSNGLKYTPITFDTSD 182

Query: 181 EIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNI 240
           E   +    RCD  T D S LYA +    +P ++++LP++ISK PL P + +GD +W++I
Sbjct: 183 ESAKSLEGGRCDVLTSDQSQLYAQRSKLAKPDDYIVLPEVISKEPLGPVVRKGDEDWFSI 242

Query: 241 VSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRII 300
           V WT +AM+ AEE  IT KN+   +K T NPDV R LG D     G+ L L KDW  +I+
Sbjct: 243 VRWTLFAMLNAEEAKITSKNVEAEAKSTKNPDVARMLGAD--GTYGKDLKLPKDWVVQIV 300

Query: 301 RHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           + +GNYGE+F+RNLG+ + LKI RG NALW+ GG+ YAPPIR
Sbjct: 301 KQVGNYGEVFERNLGDGTPLKIKRGQNALWNAGGIQYAPPIR 342


>gi|330969254|gb|EGH69320.1| extracellular solute-binding protein [Pseudomonas syringae pv.
           aceris str. M302273PT]
          Length = 342

 Score =  352 bits (902), Expect = 6e-95,   Method: Compositional matrix adjust.
 Identities = 161/342 (47%), Positives = 226/342 (66%), Gaps = 2/342 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           M K     +  L        +   + L  IKK+GF++CG++ GL GF+   + G   G D
Sbjct: 3   MLKSTLAVVTALAAFGVIGAANAGTTLDAIKKKGFIQCGVSDGLPGFSVPDSTGKITGID 62

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
            D CRA+++A+F D +K+++  LNAKERF ALQS +IDILSRNT WT  R+  +GL F  
Sbjct: 63  ADVCRAVAAAVFGDATKVKFSQLNAKERFTALQSGEIDILSRNTTWTSSRDAGMGLVFTG 122

Query: 121 ITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVE 180
           +TY+DG GF+++ K G+ S  +L GA+IC+QAGTTTEL ++DYF+++ +KY PI F+  +
Sbjct: 123 VTYYDGIGFLVNNKLGVKSAKELDGATICIQAGTTTELNVSDYFRSNGLKYTPITFDTSD 182

Query: 181 EIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNI 240
           E   +    RCD  T D S LYA +    +P ++++LP++ISK PL P + +GD EW++I
Sbjct: 183 ESAKSLEGGRCDVLTSDQSQLYAQRSKLAKPDDYIVLPEVISKEPLGPVVRKGDEEWFSI 242

Query: 241 VSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRII 300
           V WT +AM+ AEE  IT KN+   +K T NPDV R LG D     G+ L L KDW  +I+
Sbjct: 243 VRWTLFAMLNAEEAKITSKNVEAEAKSTKNPDVARMLGAD--GTYGQDLKLPKDWVVQIV 300

Query: 301 RHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           + +GNYGE+F+RNLG  + LKI RG NALW+ GG+ YAPPIR
Sbjct: 301 KQVGNYGEVFERNLGEGTPLKIKRGQNALWNAGGIQYAPPIR 342


>gi|26249860|ref|NP_755900.1| putative amino-acid ABC transporter binding protein yhdW
           [Escherichia coli CFT073]
 gi|110643514|ref|YP_671244.1| putative amino-acid ABC transporter binding protein YhdW precursor
           [Escherichia coli 536]
 gi|191173851|ref|ZP_03035372.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Escherichia coli F11]
 gi|227887996|ref|ZP_04005801.1| amino-acid ABC superfamily ATP binding cassette transporter binding
           protein yhdW precursor [Escherichia coli 83972]
 gi|300979705|ref|ZP_07174655.1| lysine-arginine-ornithine-binding periplasmic protein [Escherichia
           coli MS 200-1]
 gi|300991067|ref|ZP_07179488.1| lysine-arginine-ornithine-binding periplasmic protein [Escherichia
           coli MS 45-1]
 gi|301047875|ref|ZP_07194922.1| lysine-arginine-ornithine-binding periplasmic protein [Escherichia
           coli MS 185-1]
 gi|26110288|gb|AAN82474.1|AE016767_234 Putative amino-acid ABC transporter binding protein yhdW precursor
           [Escherichia coli CFT073]
 gi|110345106|gb|ABG71343.1| putative amino-acid ABC transporter binding protein YhdW precursor
           [Escherichia coli 536]
 gi|190905901|gb|EDV65519.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Escherichia coli F11]
 gi|227835392|gb|EEJ45858.1| amino-acid ABC superfamily ATP binding cassette transporter binding
           protein yhdW precursor [Escherichia coli 83972]
 gi|300300218|gb|EFJ56603.1| lysine-arginine-ornithine-binding periplasmic protein [Escherichia
           coli MS 185-1]
 gi|300307923|gb|EFJ62443.1| lysine-arginine-ornithine-binding periplasmic protein [Escherichia
           coli MS 200-1]
 gi|300406988|gb|EFJ90526.1| lysine-arginine-ornithine-binding periplasmic protein [Escherichia
           coli MS 45-1]
 gi|307555363|gb|ADN48138.1| putative periplasmic amino-acid ABC transporter binding protein
           [Escherichia coli ABU 83972]
 gi|315294821|gb|EFU54164.1| lysine-arginine-ornithine-binding periplasmic protein [Escherichia
           coli MS 153-1]
 gi|324015878|gb|EGB85097.1| lysine-arginine-ornithine-binding periplasmic protein [Escherichia
           coli MS 60-1]
          Length = 341

 Score =  352 bits (902), Expect = 6e-95,   Method: Compositional matrix adjust.
 Identities = 153/319 (47%), Positives = 224/319 (70%), Gaps = 2/319 (0%)

Query: 24  ASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPL 83
            + L  ++K+GF++CGI+ GL GF+   A+G + G DVD CR +++A+F D +K++Y PL
Sbjct: 25  GATLDAVQKKGFVQCGISDGLPGFSYADADGKFSGIDVDVCRGVAAAVFGDDTKVKYTPL 84

Query: 84  NAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQL 143
            AKERF ALQS ++D+LSRNT WT  R+  +G+AF  +TY+DG GF+ H K G+ S  +L
Sbjct: 85  TAKERFTALQSGEVDLLSRNTTWTSSRDAGMGMAFTGVTYYDGIGFLTHDKAGLKSAKEL 144

Query: 144 SGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYA 203
            GA++C+QAGT TEL +ADYFKA+NMKY P+ F+R +E   A  + RCD    D S LYA
Sbjct: 145 DGATVCIQAGTDTELNVADYFKANNMKYTPVTFDRSDESAKALESGRCDTLASDQSQLYA 204

Query: 204 LKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQ 263
           L++    P+E ++LP++ISK PL P + +GD EW++IV WT +AM+ AEE+GI  +N+++
Sbjct: 205 LRIKLSNPTEWIVLPEVISKEPLGPVVRRGDDEWFSIVRWTLFAMLNAEEMGINSQNVDE 264

Query: 264 VSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIP 323
            + +   PD+   LG  K  + G+ L L   W + II+ +GNY E+F+RN+G++S LKI 
Sbjct: 265 KAANPATPDMAHLLG--KEGDYGKDLKLDNKWAFNIIKQVGNYSEIFERNVGSESPLKIK 322

Query: 324 RGYNALWSKGGLMYAPPIR 342
           RG N LW+ GG+ YAPP+R
Sbjct: 323 RGQNNLWNNGGIQYAPPVR 341


>gi|49087174|gb|AAT51425.1| PA3858 [synthetic construct]
          Length = 342

 Score =  352 bits (902), Expect = 6e-95,   Method: Compositional matrix adjust.
 Identities = 156/334 (46%), Positives = 234/334 (70%), Gaps = 2/334 (0%)

Query: 9   ILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALS 68
           +L  + L  ++ +   + L   K++G+++CG++ GL GF+   A G +KG DVD CRAL+
Sbjct: 10  LLAAVCLGASATAEAGATLDAGKRKGYVQCGVSDGLPGFSYADAKGRFKGLDVDICRALA 69

Query: 69  SAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQG 128
           +A+F D  K+++ PL+A ERF ALQS  +D+LSRNT WT  R+ +LG+ F  +TYFDGQG
Sbjct: 70  AALFGDAEKVRFTPLSATERFSALQSGTVDLLSRNTSWTSSRDTALGIHFTGVTYFDGQG 129

Query: 129 FIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRA 188
           F++++K G+SS  +L  A++C+Q+GTT EL +ADYF+AH ++Y  ++ +  E+   A  A
Sbjct: 130 FLVNRKLGVSSARELKDATVCIQSGTTNELNVADYFRAHGIRYKAVLDDSYEKSARALEA 189

Query: 189 HRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAM 248
            +CD  + D S LYA +L   +P ++V+LP++ISK PL PA+ QGD  W+NIV WT Y +
Sbjct: 190 GQCDVLSSDQSQLYAQRLKLAKPEQYVVLPEVISKEPLGPAVRQGDEAWFNIVRWTLYGL 249

Query: 249 VTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGE 308
           + AEELG+T  N+ + ++D+ NPDV R LG +   + G+ L L +DW  +++R +GNYGE
Sbjct: 250 LNAEELGVTSSNVERQARDSRNPDVARLLGSE--GDAGKDLQLPRDWVVQMVRQVGNYGE 307

Query: 309 MFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           +F RN+G+ S LK+PRG NA W+ GGL YAPPIR
Sbjct: 308 IFARNVGDGSPLKMPRGLNAQWNLGGLHYAPPIR 341


>gi|91212699|ref|YP_542685.1| putative periplasmic amino-acid ABC transporter binding protein
           [Escherichia coli UTI89]
 gi|117625557|ref|YP_858880.1| putative periplasmic amino-acid ABC transporter binding protein
           [Escherichia coli APEC O1]
 gi|215488575|ref|YP_002331006.1| predicted periplasmic binding transport protein;
           periplasmic-binding component of ABC superfamily
           [Escherichia coli O127:H6 str. E2348/69]
 gi|237705973|ref|ZP_04536454.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA]
 gi|306816388|ref|ZP_07450520.1| putative periplasmic binding transport protein; periplasmic-binding
           component of ABC superfamily [Escherichia coli NC101]
 gi|312968401|ref|ZP_07782610.1| general L-amino acid-binding periplasmic protein aapJ [Escherichia
           coli 2362-75]
 gi|331649069|ref|ZP_08350157.1| putative amino-acid ABC transporter-binding protein YhdW
           [Escherichia coli M605]
 gi|331659557|ref|ZP_08360499.1| putative amino-acid ABC transporter-binding protein YhdW
           [Escherichia coli TA206]
 gi|91074273|gb|ABE09154.1| putative periplasmic amino-acid ABC transporter binding protein
           [Escherichia coli UTI89]
 gi|115514681|gb|ABJ02756.1| putative periplasmic amino-acid ABC transporter binding protein
           [Escherichia coli APEC O1]
 gi|215266647|emb|CAS11086.1| predicted periplasmic binding transport protein;
           periplasmic-binding component of ABC superfamily
           [Escherichia coli O127:H6 str. E2348/69]
 gi|222034984|emb|CAP77727.1| amino-acid ABC transporter-binding protein yhdW [Escherichia coli
           LF82]
 gi|226899013|gb|EEH85272.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA]
 gi|294494121|gb|ADE92877.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Escherichia coli IHE3034]
 gi|305849953|gb|EFM50412.1| putative periplasmic binding transport protein; periplasmic-binding
           component of ABC superfamily [Escherichia coli NC101]
 gi|307625131|gb|ADN69435.1| predicted periplasmic binding transport protein;
           periplasmic-binding component of ABC superfamily
           [Escherichia coli UM146]
 gi|312286619|gb|EFR14530.1| general L-amino acid-binding periplasmic protein aapJ [Escherichia
           coli 2362-75]
 gi|312947826|gb|ADR28653.1| predicted periplasmic binding transport protein;
           periplasmic-binding component of ABC superfamily
           [Escherichia coli O83:H1 str. NRG 857C]
 gi|315289024|gb|EFU48422.1| lysine-arginine-ornithine-binding periplasmic protein [Escherichia
           coli MS 110-3]
 gi|315300933|gb|EFU60153.1| lysine-arginine-ornithine-binding periplasmic protein [Escherichia
           coli MS 16-3]
 gi|320194754|gb|EFW69384.1| Glutamate Aspartate periplasmic binding protein precursor GltI
           [Escherichia coli WV_060327]
 gi|323189120|gb|EFZ74404.1| general L-amino acid-binding periplasmic protein aapJ [Escherichia
           coli RN587/1]
 gi|323951212|gb|EGB47087.1| lysine-arginine-ornithine-binding periplasmic protein [Escherichia
           coli H252]
 gi|323957584|gb|EGB53298.1| lysine-arginine-ornithine-binding periplasmic protein [Escherichia
           coli H263]
 gi|330909319|gb|EGH37833.1| glutamate Aspartate periplasmic binding protein precursor GltI
           [Escherichia coli AA86]
 gi|331042816|gb|EGI14958.1| putative amino-acid ABC transporter-binding protein YhdW
           [Escherichia coli M605]
 gi|331054139|gb|EGI26168.1| putative amino-acid ABC transporter-binding protein YhdW
           [Escherichia coli TA206]
          Length = 341

 Score =  352 bits (902), Expect = 7e-95,   Method: Compositional matrix adjust.
 Identities = 153/319 (47%), Positives = 224/319 (70%), Gaps = 2/319 (0%)

Query: 24  ASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPL 83
            + L  ++K+GF++CGI+ GL GF+   A+G + G DVD CR +++A+F D +K++Y PL
Sbjct: 25  GATLDAVQKKGFVQCGISDGLPGFSYADADGKFSGIDVDVCRGVAAAVFGDDTKVKYTPL 84

Query: 84  NAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQL 143
            AKERF ALQS ++D+LSRNT WT  R+  +G+AF  +TY+DG GF+ H K G+ S  +L
Sbjct: 85  TAKERFTALQSGEVDLLSRNTTWTSSRDAGMGMAFTGVTYYDGIGFLTHDKAGLKSAKEL 144

Query: 144 SGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYA 203
            GA++C+QAGT TEL +ADYFKA+NMKY P+ F+R +E   A  + RCD    D S LYA
Sbjct: 145 DGATVCIQAGTDTELNVADYFKANNMKYTPVTFDRSDESAKALESGRCDTLASDQSQLYA 204

Query: 204 LKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQ 263
           L++    P+E ++LP++ISK PL P + +GD EW++IV WT +AM+ AEE+GI  +N+++
Sbjct: 205 LRIKLSNPAEWIVLPEVISKEPLGPVVRRGDDEWFSIVRWTLFAMLNAEEMGINSQNVDE 264

Query: 264 VSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIP 323
            + +   PD+   LG  K  + G+ L L   W + II+ +GNY E+F+RN+G++S LKI 
Sbjct: 265 KAANPATPDMAHLLG--KEGDYGKDLKLDNKWAFNIIKQVGNYSEIFERNVGSESPLKIK 322

Query: 324 RGYNALWSKGGLMYAPPIR 342
           RG N LW+ GG+ YAPP+R
Sbjct: 323 RGQNNLWNNGGIQYAPPVR 341


>gi|320327255|gb|EFW83269.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Pseudomonas syringae pv. glycinea str. race 4]
 gi|330882636|gb|EGH16785.1| amino acid ABC transporter periplasmic amino acid-binding protein
           [Pseudomonas syringae pv. glycinea str. race 4]
          Length = 342

 Score =  351 bits (901), Expect = 8e-95,   Method: Compositional matrix adjust.
 Identities = 160/342 (46%), Positives = 229/342 (66%), Gaps = 2/342 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           M K     +  L     T  +   + L  I+K+GF++CG++ GL GF+   + G   G D
Sbjct: 3   MLKSTLAVVTALAAFGVTGAANAGATLDAIQKKGFVQCGVSDGLPGFSVPDSTGKITGID 62

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
            D CRA+++A+F D +K+++  LNAKERF ALQS +IDILSRNT WT  R+  +GL F  
Sbjct: 63  ADVCRAVAAAVFGDATKVKFSQLNAKERFTALQSGEIDILSRNTTWTSSRDAGMGLVFTG 122

Query: 121 ITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVE 180
           +TY+DG GF+++ K G+ S  +L GA+IC+QAGTTTEL ++DYF+++ +KY PI F+  +
Sbjct: 123 VTYYDGIGFLVNNKLGVKSAKELDGATICIQAGTTTELNVSDYFRSNGLKYTPITFDTSD 182

Query: 181 EIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNI 240
           E   +    RCD  T D S LYA +    +P ++++LP++ISK PL P + +GD +W++I
Sbjct: 183 ESAKSLEGGRCDVLTSDQSQLYAQRSKLAKPDDYIVLPEVISKEPLGPVVRKGDEDWFSI 242

Query: 241 VSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRII 300
           V WT +AM+ AEE  IT KN+   +K T NPDV R LG D +   G+ L L KDW  +I+
Sbjct: 243 VRWTLFAMLNAEEAKITSKNVEAEAKSTKNPDVARMLGADGT--YGKDLKLPKDWVVQIV 300

Query: 301 RHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           + +GNYGE+F+RNLG+ + LKI RG NALW+ GG+ YAPPIR
Sbjct: 301 KQVGNYGEVFERNLGDGTPLKIKRGQNALWNAGGIQYAPPIR 342


>gi|193071524|ref|ZP_03052434.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Escherichia coli E110019]
 gi|192955161|gb|EDV85654.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Escherichia coli E110019]
          Length = 341

 Score =  351 bits (901), Expect = 8e-95,   Method: Compositional matrix adjust.
 Identities = 154/319 (48%), Positives = 223/319 (69%), Gaps = 2/319 (0%)

Query: 24  ASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPL 83
            + L  ++K+GF++CGI+ GL GF+   A+G + G DVD CR +++A+F D +K++Y PL
Sbjct: 25  GATLDAVQKKGFVQCGISDGLPGFSYADADGKFSGIDVDVCRGVAAAVFGDDTKVKYTPL 84

Query: 84  NAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQL 143
            AKERF ALQS ++D+LSRNT WT  R+  +G+AF  +TY+DG GF+ H K G+ S  +L
Sbjct: 85  TAKERFTALQSGEVDLLSRNTTWTSSRDAGMGMAFTGVTYYDGIGFLTHDKAGLKSAKEL 144

Query: 144 SGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYA 203
            GA++C+QAGT TEL +ADYFKA+NMKY P+ F+R +E   A  + RCD    D S LYA
Sbjct: 145 DGATVCIQAGTDTELNVADYFKANNMKYTPVTFDRSDESAKALESGRCDTLASDQSQLYA 204

Query: 204 LKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQ 263
           L++    P+E ++LP++ISK PL P + +GD EW++IV WT +AM+ AEE+GI  +N+++
Sbjct: 205 LRIKLSNPAEWIVLPEVISKEPLGPVVRRGDDEWFSIVRWTLFAMLNAEEMGINSQNVDE 264

Query: 264 VSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIP 323
            + +   PD+   LG  K    G+ L L   W Y II+ +GNY E+F+RN+G++S LKI 
Sbjct: 265 KAANPATPDMAHLLG--KEGYYGKDLKLDNKWAYNIIKQVGNYSEIFERNVGSESPLKIK 322

Query: 324 RGYNALWSKGGLMYAPPIR 342
           RG N LW+ GG+ YAPP+R
Sbjct: 323 RGQNNLWNNGGIQYAPPVR 341


>gi|309785598|ref|ZP_07680229.1| general L-amino acid-binding periplasmic protein aapJ [Shigella
           dysenteriae 1617]
 gi|308926718|gb|EFP72194.1| general L-amino acid-binding periplasmic protein aapJ [Shigella
           dysenteriae 1617]
          Length = 341

 Score =  351 bits (901), Expect = 9e-95,   Method: Compositional matrix adjust.
 Identities = 154/330 (46%), Positives = 228/330 (69%), Gaps = 2/330 (0%)

Query: 13  IILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIF 72
           ++L   + +   + L  ++K+GF++CGI+ GL  F+   A+G + G DVD CR +++A+F
Sbjct: 14  VLLAIANQAHAGATLDAVQKKGFVQCGISDGLPRFSYADADGKFSGIDVDVCRGVAAAVF 73

Query: 73  DDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMH 132
            D +K++Y PL AKERF ALQS ++D+LSRNT WT  R+  +G+AF  +TY+DG GF+ H
Sbjct: 74  GDNTKVKYTPLTAKERFTALQSGEVDLLSRNTTWTSSRDAGMGMAFTGVTYYDGIGFLTH 133

Query: 133 KKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCD 192
            K G+ S  +L GA++C+QAGT TEL +ADYFKA+NMKY P+ F+R +E   A  + RCD
Sbjct: 134 DKAGLKSAKELDGATVCIQAGTDTELNVADYFKANNMKYTPVTFDRSDESAKALESGRCD 193

Query: 193 AYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAE 252
               D S LYAL++    P+E ++LP++ISK PL P + +GD EW++IV WT +AM+ AE
Sbjct: 194 TLASDQSQLYALRIKLSNPAEWIVLPEVISKEPLGPVVRRGDDEWFSIVRWTLFAMLNAE 253

Query: 253 ELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDR 312
           E+GI  +N+++ + +   PD+   LG  K  + G+ L L   W Y II+ +GNY E+F+R
Sbjct: 254 EMGINSQNVDEKAANPATPDMAHLLG--KEGDYGKDLKLDNKWAYNIIKQVGNYSEIFER 311

Query: 313 NLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           N+G++S LKI RG N LW+ GG+ YAPP+R
Sbjct: 312 NVGSESPLKIKRGQNNLWNNGGIQYAPPVR 341


>gi|323941639|gb|EGB37818.1| lysine-arginine-ornithine-binding periplasmic protein [Escherichia
           coli E482]
          Length = 341

 Score =  351 bits (900), Expect = 9e-95,   Method: Compositional matrix adjust.
 Identities = 153/319 (47%), Positives = 223/319 (69%), Gaps = 2/319 (0%)

Query: 24  ASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPL 83
            + L  ++K+GF++CGI+ GL GF+   A+G + G DVD CR +++A+F D +K++Y PL
Sbjct: 25  GATLDAVQKKGFVQCGISDGLPGFSYADADGKFSGIDVDICRGVAAAVFGDDTKVKYTPL 84

Query: 84  NAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQL 143
            AKERF ALQS ++D+LSRNT WT  R+  +G+AF  +TY+DG GF+ H K G+ S  +L
Sbjct: 85  TAKERFTALQSGEVDLLSRNTTWTSSRDAGMGMAFTGVTYYDGIGFLTHDKAGLKSAKEL 144

Query: 144 SGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYA 203
            GA++C+QAGT TEL +ADYFKA+NMKY P+ F+R +E   A  + RCD    D S LYA
Sbjct: 145 DGATVCIQAGTDTELNVADYFKANNMKYTPVTFDRSDESAKALESGRCDTLASDQSQLYA 204

Query: 204 LKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQ 263
           L++    P+E ++LP++ISK PL P + + D EW++IV WT +AM+ AEE+GI  +N+++
Sbjct: 205 LRIKLSNPAEWIVLPEVISKEPLGPVVRRADDEWFSIVRWTLFAMLNAEEMGINSQNVDE 264

Query: 264 VSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIP 323
            + +   PD+   LG  K  + G+ L L   W Y II+ +GNY E+F+RN+G++S LKI 
Sbjct: 265 KAANPATPDMAHLLG--KEGDYGKDLKLDNKWAYNIIKQVGNYSEIFERNVGSESPLKIK 322

Query: 324 RGYNALWSKGGLMYAPPIR 342
           RG N LW+ GG+ YAPP+R
Sbjct: 323 RGQNNLWNNGGIQYAPPVR 341


>gi|325275056|ref|ZP_08141044.1| general amino acid ABC transporter, periplasmic binding protein
           [Pseudomonas sp. TJI-51]
 gi|324099819|gb|EGB97677.1| general amino acid ABC transporter, periplasmic binding protein
           [Pseudomonas sp. TJI-51]
          Length = 342

 Score =  351 bits (900), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 157/319 (49%), Positives = 225/319 (70%), Gaps = 2/319 (0%)

Query: 24  ASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPL 83
            + L  +KK+GF++CG++ GL GF+   A G   G D D CRA+++A+F D +K+++  L
Sbjct: 26  GATLDAVKKKGFVQCGVSDGLPGFSVPDAQGKIIGIDADVCRAVAAAVFGDANKVKFSQL 85

Query: 84  NAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQL 143
           NAKERF ALQS ++D+LSRNT WT  R+  +GL F  +TY+DG GF+++KK G+SS  +L
Sbjct: 86  NAKERFTALQSGEVDVLSRNTTWTSSRDAGMGLVFTGVTYYDGVGFLVNKKLGVSSAKEL 145

Query: 144 SGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYA 203
            GA+IC+QAGTTTEL ++D+F+A+ +KY PI F+  +E   +  + RCD  T D S L+A
Sbjct: 146 DGATICIQAGTTTELNVSDFFRANGLKYTPITFDTSDESAKSLESGRCDVLTSDKSQLFA 205

Query: 204 LKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQ 263
            +     P+E+V+LP+ ISK PL P + +GD +W++IV WT +AM+ AEE GIT KN+  
Sbjct: 206 QRSKLAAPTEYVVLPETISKEPLGPVVRKGDEDWFSIVKWTLFAMLNAEEAGITSKNVEA 265

Query: 264 VSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIP 323
            +K T NPDV R LG D     G+ L L KDW  +I++ +GNYGE+F++NLG  ++LKI 
Sbjct: 266 EAKATKNPDVARLLGAD--GEYGKDLKLPKDWVVQIVKQVGNYGEVFEKNLGQGTDLKID 323

Query: 324 RGYNALWSKGGLMYAPPIR 342
           RG NALW+ GG+ YAPP+R
Sbjct: 324 RGMNALWNNGGIQYAPPVR 342


>gi|330950965|gb|EGH51225.1| amino acid ABC transporter periplasmic amino acid-binding protein
           [Pseudomonas syringae Cit 7]
          Length = 342

 Score =  351 bits (900), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 160/342 (46%), Positives = 227/342 (66%), Gaps = 2/342 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           M K     +  L     T  +   + L  I+K+GF++CG++ GL GF+   + G   G D
Sbjct: 3   MLKSTLAVVTALAAFGVTGAANAGATLDAIQKKGFIQCGVSDGLPGFSVPDSTGKITGID 62

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
            D CRA+++A+F D +K+++  LNAKERF ALQS +IDILSRNT WT  R+  +GL F  
Sbjct: 63  ADVCRAVAAAVFGDATKVKFSQLNAKERFTALQSGEIDILSRNTTWTSSRDAGMGLVFTG 122

Query: 121 ITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVE 180
           +TY+DG GF+++ K G+ S  +L GA+IC+QAGTTTEL ++DYF+++ +KY PI F+  +
Sbjct: 123 VTYYDGIGFLVNNKLGVKSAKELDGATICIQAGTTTELNVSDYFRSNGLKYTPITFDTSD 182

Query: 181 EIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNI 240
           E   +    RCD  T D S LYA +    +P ++++LP++ISK PL P + +GD +W++I
Sbjct: 183 ESAKSLEGGRCDVLTSDQSQLYAQRSKLAKPDDYIVLPEVISKEPLGPVVRKGDEDWFSI 242

Query: 241 VSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRII 300
           V WT +AM+ AEE  IT KN+   +K T NPDV R LG D     G+ L L KDW  +I+
Sbjct: 243 VRWTLFAMLNAEEAKITSKNVEAEAKSTKNPDVARMLGAD--GTYGKDLKLPKDWVVQIV 300

Query: 301 RHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           + +GNYGE+F+RNLG  + LKI RG NALW+ GG+ YAPPIR
Sbjct: 301 KQVGNYGEVFERNLGEGTPLKIKRGQNALWNAGGIQYAPPIR 342


>gi|257487410|ref|ZP_05641451.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Pseudomonas syringae pv. tabaci ATCC 11528]
 gi|289628605|ref|ZP_06461559.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Pseudomonas syringae pv. aesculi str. NCPPB3681]
 gi|289647200|ref|ZP_06478543.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Pseudomonas syringae pv. aesculi str. 2250]
 gi|298485800|ref|ZP_07003879.1| Amino acid ABC transporter, periplasmic amino acid-binding protein
           [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
 gi|302188404|ref|ZP_07265077.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Pseudomonas syringae pv. syringae 642]
 gi|298159826|gb|EFI00868.1| Amino acid ABC transporter, periplasmic amino acid-binding protein
           [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
 gi|330867828|gb|EGH02537.1| amino acid ABC transporter periplasmic amino acid-binding protein
           [Pseudomonas syringae pv. aesculi str. 0893_23]
 gi|330887729|gb|EGH20390.1| amino acid ABC transporter periplasmic amino acid-binding protein
           [Pseudomonas syringae pv. mori str. 301020]
 gi|330988313|gb|EGH86416.1| amino acid ABC transporter periplasmic amino acid-binding protein
           [Pseudomonas syringae pv. lachrymans str. M301315]
 gi|331008998|gb|EGH89054.1| amino acid ABC transporter periplasmic amino acid-binding protein
           [Pseudomonas syringae pv. tabaci ATCC 11528]
          Length = 342

 Score =  351 bits (900), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 160/342 (46%), Positives = 227/342 (66%), Gaps = 2/342 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           M K     +  L     T  +   + L  I+K+GF++CG++ GL GF+   + G   G D
Sbjct: 3   MLKSTLAVVTALAAFGVTGAANAGATLDAIQKKGFVQCGVSDGLPGFSVPDSTGKITGID 62

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
            D CRA+++A+F D +K+++  LNAKERF ALQS +IDILSRNT WT  R+  +GL F  
Sbjct: 63  ADVCRAVAAAVFGDATKVKFSQLNAKERFTALQSGEIDILSRNTTWTSSRDAGMGLVFTG 122

Query: 121 ITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVE 180
           +TY+DG GF+++ K G+ S  +L GA+IC+QAGTTTEL ++DYF+++ +KY PI F+  +
Sbjct: 123 VTYYDGIGFLVNNKLGVKSAKELDGATICIQAGTTTELNVSDYFRSNGLKYTPITFDTSD 182

Query: 181 EIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNI 240
           E   +    RCD  T D S LYA +    +P ++++LP++ISK PL P + +GD +W++I
Sbjct: 183 ESAKSLEGGRCDVLTSDQSQLYAQRSKLAKPDDYIVLPEVISKEPLGPVVRKGDEDWFSI 242

Query: 241 VSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRII 300
           V WT +AM+ AEE  IT KN+   +K T NPDV R LG D     G+ L L KDW  +I+
Sbjct: 243 VRWTLFAMLNAEEAKITSKNVEAEAKSTKNPDVARMLGAD--GTYGKDLKLPKDWVVQIV 300

Query: 301 RHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           + +GNYGE+F+RNLG  + LKI RG NALW+ GG+ YAPPIR
Sbjct: 301 KQVGNYGEVFERNLGEGTPLKIKRGQNALWNAGGIQYAPPIR 342


>gi|331684909|ref|ZP_08385501.1| putative amino-acid ABC transporter-binding protein YhdW
           [Escherichia coli H299]
 gi|331078524|gb|EGI49730.1| putative amino-acid ABC transporter-binding protein YhdW
           [Escherichia coli H299]
          Length = 341

 Score =  350 bits (899), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 153/319 (47%), Positives = 223/319 (69%), Gaps = 2/319 (0%)

Query: 24  ASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPL 83
            + L  ++K+G ++CGI+ GL GF+   A+G + G DVD CR +++A+F D +K++Y PL
Sbjct: 25  GATLDAVQKKGVVQCGISDGLPGFSYADADGKFSGIDVDVCRGVAAAVFGDDTKVKYTPL 84

Query: 84  NAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQL 143
            AKERF ALQS ++D+LSRNT WT  R+  +G+AF  +TY+DG GF+ H K G+ S  +L
Sbjct: 85  TAKERFTALQSGEVDLLSRNTTWTSSRDAGMGMAFTGVTYYDGIGFLTHDKAGLKSAKEL 144

Query: 144 SGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYA 203
            GA++C+QAGT TEL +ADYFKA+NMKY P+ F+R +E   A  + RCD    D S LYA
Sbjct: 145 DGATVCIQAGTDTELNVADYFKANNMKYTPVTFDRSDESAKALESGRCDTLASDQSQLYA 204

Query: 204 LKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQ 263
           L++    P+E ++LP++ISK PL P + +GD EW++IV WT +AM+ AEE+GI  +N+++
Sbjct: 205 LRIKLSNPAEWIVLPEVISKEPLGPVVRRGDDEWFSIVRWTLFAMLNAEEMGINSQNVDE 264

Query: 264 VSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIP 323
            + +   PD+   LG  K  + G+ L L   W Y II+ +GNY E+F+RN+G++S LKI 
Sbjct: 265 KAANPATPDMAHLLG--KEGDYGKDLKLDNKWAYNIIKQVGNYSEIFERNVGSESPLKIK 322

Query: 324 RGYNALWSKGGLMYAPPIR 342
           RG N LW+ GG+ YAPP+R
Sbjct: 323 RGQNNLWNNGGIQYAPPVR 341


>gi|237799855|ref|ZP_04588316.1| amino acid ABC transporter periplasmic amino acid-binding protein
           [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331022710|gb|EGI02767.1| amino acid ABC transporter periplasmic amino acid-binding protein
           [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 322

 Score =  350 bits (899), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 159/319 (49%), Positives = 223/319 (69%), Gaps = 2/319 (0%)

Query: 24  ASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPL 83
            + L  I+K+GF++CG++ GL GF+   +NG   G D D CRA+++A+F D +K+++  L
Sbjct: 6   GATLDAIQKKGFVQCGVSDGLPGFSVPDSNGKITGIDADVCRAVAAAVFGDATKVKFSQL 65

Query: 84  NAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQL 143
           NAKERF ALQS +IDILSRNT WT  R+  +GL F  +TY+DG GF+++ K G+ S  +L
Sbjct: 66  NAKERFTALQSGEIDILSRNTTWTSSRDAGMGLVFTGVTYYDGIGFLVNNKLGVKSAKEL 125

Query: 144 SGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYA 203
            GA+IC+QAGTTTEL ++DYF+++ +KY PI F+  +E   +    RCD  T D S LYA
Sbjct: 126 DGATICIQAGTTTELNVSDYFRSNGLKYTPITFDTSDESAKSLEGGRCDVLTSDQSQLYA 185

Query: 204 LKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQ 263
            +    +P ++V+LP++ISK PL P + +GD EW++IV WT +AM+ AEE  IT KN+  
Sbjct: 186 QRSKLAKPDDYVVLPEVISKEPLGPVVRKGDEEWFSIVRWTLFAMLNAEEAKITSKNVEA 245

Query: 264 VSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIP 323
            +K T NPDV R LG D +   G+ L L KDW  +I++ +GNYGE+F+RNLG  + LKI 
Sbjct: 246 EAKSTKNPDVARMLGADGT--YGKDLKLPKDWVVQIVKQVGNYGEVFERNLGENTPLKIK 303

Query: 324 RGYNALWSKGGLMYAPPIR 342
           RG NALW+ GG+ YAPPIR
Sbjct: 304 RGQNALWNAGGIQYAPPIR 322


>gi|227327916|ref|ZP_03831940.1| general L-amino ABC transporter binding protein [Pectobacterium
           carotovorum subsp. carotovorum WPP14]
          Length = 305

 Score =  350 bits (897), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 153/307 (49%), Positives = 218/307 (71%), Gaps = 2/307 (0%)

Query: 36  LKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSK 95
           ++CGI+ GL GF+   A+G + G DVD CR L++A+F D +K++Y PL AKERF ALQS 
Sbjct: 1   MQCGISDGLPGFSYADASGKYSGIDVDVCRGLAAAVFGDANKVKYTPLTAKERFTALQSG 60

Query: 96  QIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTT 155
           ++D+LSRNT WT  R+  +G+ F  +TY+DG GF+ H K G++S  +L GA++C+QAGT 
Sbjct: 61  EVDVLSRNTTWTSSRDGGMGMLFTGVTYYDGIGFLTHNKAGLTSAKELDGATVCIQAGTD 120

Query: 156 TELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHV 215
           TEL +ADYFK H M+Y P+ F+R +E   A  + RCD    D S LYAL++   +P+E +
Sbjct: 121 TELNVADYFKTHKMQYTPVTFDRSDESAKALESGRCDTLASDQSQLYALRIKLSKPAEFI 180

Query: 216 ILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQR 275
           +LP++ISK PL P + +GD EW+ IV WT +AM+ AEE+G+T KN++Q++   T PD+  
Sbjct: 181 VLPEVISKEPLGPVVRRGDEEWFAIVRWTLFAMLNAEEMGVTSKNVDQLAAKPTTPDMSH 240

Query: 276 FLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGL 335
            LG + S   G+ L L  DW ++II+ +GNYGE+F+RN+G  SELKI RG N LW+KGG+
Sbjct: 241 LLGHEGS--YGKDLKLPNDWAFKIIKQVGNYGEIFERNVGMGSELKIKRGLNELWNKGGI 298

Query: 336 MYAPPIR 342
            YAP +R
Sbjct: 299 QYAPAVR 305


>gi|320325827|gb|EFW81888.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Pseudomonas syringae pv. glycinea str. B076]
          Length = 342

 Score =  350 bits (897), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 160/342 (46%), Positives = 228/342 (66%), Gaps = 2/342 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           M K     +  L     T  +   + L  I+K+GF++CG++ GL GF+   + G   G D
Sbjct: 3   MLKSTLAVVTALAAFGVTGAANAGATLDAIQKKGFVQCGVSDGLPGFSVPDSTGKITGID 62

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
            D CRA+++A+F D +K+++  LNAKERF ALQS +IDILSRNT WT  R+  +GL F  
Sbjct: 63  ADVCRAVAAAVFGDATKVKFSQLNAKERFTALQSGEIDILSRNTTWTSSRDAGMGLVFTG 122

Query: 121 ITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVE 180
           +TY+DG GF+++ K G+ S  +L GA+IC+QAGTTTEL ++DYF+++ +KY PI F+  +
Sbjct: 123 VTYYDGIGFLVNNKLGVKSAKELDGATICIQAGTTTELNVSDYFRSNGLKYTPITFDTSD 182

Query: 181 EIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNI 240
           E   +    RCD  T D S LYA +    +P ++++LP++ISK PL P + +GD +W++I
Sbjct: 183 ESAKSLEGGRCDVLTSDQSQLYAQRSKLAKPDDYIVLPEVISKEPLGPVVRKGDEDWFSI 242

Query: 241 VSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRII 300
           V WT +AM+ AEE  IT KN+   +K T NPDV R LG D     G+ L L KDW  +I+
Sbjct: 243 VRWTLFAMLNAEEAKITSKNVEAEAKLTKNPDVARMLGAD--GTYGKDLKLPKDWVVQIV 300

Query: 301 RHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           + +GNYGE+F+RNLG+ + LKI RG NALW+ GG+ YAPPIR
Sbjct: 301 KQVGNYGEVFERNLGDGTPLKIKRGQNALWNAGGIQYAPPIR 342


>gi|110807125|ref|YP_690645.1| putative periplasmic binding transport protein [Shigella flexneri 5
           str. 8401]
 gi|110616673|gb|ABF05340.1| putative periplasmic binding transport protein [Shigella flexneri 5
           str. 8401]
          Length = 341

 Score =  349 bits (896), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 153/319 (47%), Positives = 223/319 (69%), Gaps = 2/319 (0%)

Query: 24  ASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPL 83
            + L  ++K+GF++CGI+ GL  F+   A+G + G DVD CR +++A+F D +K++Y PL
Sbjct: 25  GATLDAVQKKGFVQCGISDGLPRFSYADADGKFSGIDVDVCRGVAAAVFGDDTKVKYTPL 84

Query: 84  NAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQL 143
            AKERF ALQS ++D+LSRNT WT  R+  +G+AF  +TY+DG GF+ H K G+ S  +L
Sbjct: 85  TAKERFTALQSGEVDLLSRNTTWTSSRDAGMGMAFTGVTYYDGIGFLTHDKAGLKSAKEL 144

Query: 144 SGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYA 203
            GA++C+QAGT TEL +ADYFKA+NMKY P+ F+R +E   A  + RCD    D S LYA
Sbjct: 145 DGATVCIQAGTDTELNVADYFKANNMKYTPVTFDRSDESAKALESGRCDTLASDQSQLYA 204

Query: 204 LKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQ 263
           L++    P+E ++LP++ISK PL P + +GD EW++IV WT +AM+ AEE+GI  +N+++
Sbjct: 205 LRIKLSNPAEWIVLPEVISKEPLGPVVRRGDDEWFSIVRWTLFAMLNAEEMGINSQNVDE 264

Query: 264 VSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIP 323
            + +   PD+   LG  K  + G+ L L   W Y II+ +GNY E+F+RN+G++S LKI 
Sbjct: 265 KAANPATPDMAHLLG--KEGDYGKDLKLDNKWAYNIIKQVGNYSEIFERNVGSESPLKIK 322

Query: 324 RGYNALWSKGGLMYAPPIR 342
           RG N LW+ GG+ YAPP+R
Sbjct: 323 RGQNNLWNNGGIQYAPPVR 341


>gi|92112255|ref|YP_572183.1| extracellular solute-binding protein [Chromohalobacter salexigens
           DSM 3043]
 gi|91795345|gb|ABE57484.1| amino acid ABC transporter substrate-binding protein, PAAT family
           [Chromohalobacter salexigens DSM 3043]
          Length = 342

 Score =  349 bits (896), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 164/343 (47%), Positives = 228/343 (66%), Gaps = 3/343 (0%)

Query: 1   MYKD-FFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGF 59
           +YK+ F V++   ++L   + ++ A+ L D+K+RG L CG+N GL GF+   A+G+W+G 
Sbjct: 2   LYKNKFIVAVPAALLLSGFATASQAATLDDVKERGNLNCGVNVGLAGFSAPDADGNWQGL 61

Query: 60  DVDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFR 119
           DV+ CR ++SAIF DP  + + PL AKERF ALQS +ID+LSRNT WT  R+ SLGL F 
Sbjct: 62  DVETCRGIASAIFGDPDNVVFTPLTAKERFTALQSGEIDVLSRNTTWTATRDNSLGLNFT 121

Query: 120 PITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERV 179
             T++DGQGF++ K   I S+  L+GASIC+Q+GTT EL LADYF + +++   + F+  
Sbjct: 122 ATTFYDGQGFMVSKDLNIESLEGLNGASICIQSGTTHELNLADYFPSRDIEIKTVTFDTP 181

Query: 180 EEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYN 239
           ++    +   RCD  T D S L AL+L    P    IL  +ISK PL P + QGD +W +
Sbjct: 182 DQTAQGFAHGRCDVLTSDTSQLSALRLQLPEPDSVEILETLISKEPLGPVVRQGDDQWLD 241

Query: 240 IVSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRI 299
           IV WT +AMV AEE+G+   N++++  +  NP V R LG  K  N GE LGL  DW Y I
Sbjct: 242 IVQWTIFAMVNAEEMGVNSDNVDEMRDNPPNPGVARLLG--KDGNYGEQLGLPNDWAYNI 299

Query: 300 IRHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           I+++GNYGE+F   +G  S LKI RG NALW++GG++YAPPIR
Sbjct: 300 IKNVGNYGEVFATTVGEDSPLKIQRGMNALWNEGGILYAPPIR 342


>gi|307546909|ref|YP_003899388.1| ABC transporter periplasmic protein [Halomonas elongata DSM 2581]
 gi|307218933|emb|CBV44203.1| ABC-type transport system periplasmic substrate-binding protein
           [Halomonas elongata DSM 2581]
          Length = 342

 Score =  348 bits (894), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 158/314 (50%), Positives = 213/314 (67%), Gaps = 2/314 (0%)

Query: 29  DIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKER 88
           ++K+RG L CG+N GL GF+    +G W+G DV+ CRA+SSAIF DP K+ + PL AKER
Sbjct: 31  EVKERGELHCGVNVGLAGFSSSDEDGTWQGLDVETCRAVSSAIFGDPEKVAFTPLTAKER 90

Query: 89  FLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASI 148
           F ALQS +ID+LSRNT WT  R+ SLGL F   T++DGQGF++ K+ GI S+  L GASI
Sbjct: 91  FTALQSGEIDVLSRNTTWTATRDNSLGLNFTATTFYDGQGFMVDKELGIESLEDLDGASI 150

Query: 149 CVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTN 208
           C+Q+GTT EL LADYF + N+    + F+  ++    + + RCD  T D S L AL+L  
Sbjct: 151 CIQSGTTHELNLADYFPSRNIDIKTVTFDTPDQTAQGFASGRCDVLTSDTSQLSALRLQL 210

Query: 209 DRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDT 268
             P    IL ++ISK PL P + QGD +W+NI+ WT +AMV AEE+G+   N++++ +D 
Sbjct: 211 PEPDSVEILTELISKEPLGPVVRQGDDQWFNIIKWTIFAMVNAEEMGVNSDNVDEMKQDP 270

Query: 269 TNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNA 328
            NP V R LG+D +   GE LGL  DW Y II  +GNYGE+F   +G  S L I RG NA
Sbjct: 271 PNPGVARLLGVDGT--YGEQLGLGNDWAYNIISQVGNYGEVFADTVGENSPLGISRGMNA 328

Query: 329 LWSKGGLMYAPPIR 342
           LW++GG++YAPP+R
Sbjct: 329 LWNEGGILYAPPVR 342


>gi|115522563|ref|YP_779474.1| extracellular solute-binding protein [Rhodopseudomonas palustris
           BisA53]
 gi|115516510|gb|ABJ04494.1| extracellular solute-binding protein, family 3 [Rhodopseudomonas
           palustris BisA53]
          Length = 347

 Score =  348 bits (893), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 156/311 (50%), Positives = 220/311 (70%), Gaps = 3/311 (0%)

Query: 32  KRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERFLA 91
           +R  + CG+N GL GF+     G W GFDVDFCRA+++AIFDDP K++++ L+A ERF  
Sbjct: 40  RRDAVLCGVNKGLPGFSIPDDKGSWTGFDVDFCRAVAAAIFDDPKKVKFVALDANERFKE 99

Query: 92  LQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASICVQ 151
           LQS+++DILSRN+ W++ RE    L F  + Y+DG GF++   + I S  +L G+ +CVQ
Sbjct: 100 LQSRKVDILSRNSTWSMARETGFELYFPAVAYYDGAGFMLPASRKIDSALELDGSQVCVQ 159

Query: 152 AGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTNDRP 211
             TTT+L +AD+F+A+N+KY  +   ++EE+  AY A +C+  + DIS LYAL++   +P
Sbjct: 160 DATTTQLNVADFFRANNLKYQEVKAAKLEEVVKAYEAGQCNVLSADISQLYALRVNFAKP 219

Query: 212 SEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTTNP 271
            +H ILPD+ISK PLAP + Q D +W  IV WT YAM+ AEELG++  NI++  K +  P
Sbjct: 220 IDHTILPDVISKEPLAPVVRQRDDDWMMIVKWTLYAMINAEELGVSSTNIDEALK-SKKP 278

Query: 272 DVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNALWS 331
           DV R +G + +   GE LGL+KDW  RIIRH+GNYGE+++RN+G+ S+L IPRG N LWS
Sbjct: 279 DVMRLVGTEGA--YGEELGLSKDWAARIIRHVGNYGEVYERNVGSDSKLGIPRGLNQLWS 336

Query: 332 KGGLMYAPPIR 342
            GG+ YAPPIR
Sbjct: 337 AGGIQYAPPIR 347


>gi|90409066|ref|ZP_01217191.1| general L-amino acid-binding protein [Psychromonas sp. CNPT3]
 gi|90309823|gb|EAS37983.1| general L-amino acid-binding protein [Psychromonas sp. CNPT3]
          Length = 337

 Score =  348 bits (892), Expect = 9e-94,   Method: Compositional matrix adjust.
 Identities = 158/320 (49%), Positives = 221/320 (69%), Gaps = 3/320 (0%)

Query: 23  NASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLP 82
           +A  L  + K G L CG++TG+ GF+   + G WKG DVDFCR+++SA+  D SK++Y+P
Sbjct: 21  SADTLAKVLKNGTLHCGVSTGIPGFSATDSKGVWKGIDVDFCRSVASAVLGDASKVKYIP 80

Query: 83  LNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQ 142
           L AKERF ALQS +ID+L R++ WT  R+ SLGL F  + Y+DGQGF++ K   ++S   
Sbjct: 81  LTAKERFTALQSGEIDVLVRSSTWTATRDTSLGLNFAGVNYYDGQGFLVKKSLNVNSAKD 140

Query: 143 LSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALY 202
           L GA+ C+QAGTTTEL L DYFK++NM+Y  + ++   +    ++  RCDA T D S LY
Sbjct: 141 LDGATFCIQAGTTTELNLTDYFKSNNMQYKAVTYDTSGQTIDGFKKGRCDAVTSDASQLY 200

Query: 203 ALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNIN 262
            LKL    P   ++LP+IISK PL P + QGD +W+N+V WT +A ++AEELG+T  N++
Sbjct: 201 GLKLKMKDPQSVMVLPEIISKEPLGPVVRQGDDKWFNVVRWTLFASISAEELGVTTANVD 260

Query: 263 QVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKI 322
            + K + NP V+R LGI  S   G  LGL++ W Y II+++GNYGE+F+RN+G++S L I
Sbjct: 261 TMLK-SKNPSVKRLLGI--SGKTGADLGLSEKWAYNIIKNVGNYGEVFERNVGSKSPLNI 317

Query: 323 PRGYNALWSKGGLMYAPPIR 342
            RG N LW+ GGLMY  PIR
Sbjct: 318 KRGLNNLWNNGGLMYPMPIR 337


>gi|119383545|ref|YP_914601.1| cationic amino acid ABC transporter, periplasmic binding protein
           [Paracoccus denitrificans PD1222]
 gi|119373312|gb|ABL68905.1| L-aspartate-binding protein / L-glutamate-binding protein /
           L-glutamine-binding protein / L-asparagine-binding
           protein [Paracoccus denitrificans PD1222]
          Length = 341

 Score =  348 bits (892), Expect = 9e-94,   Method: Compositional matrix adjust.
 Identities = 157/338 (46%), Positives = 224/338 (66%), Gaps = 2/338 (0%)

Query: 5   FFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFC 64
           FF S+  + +    + +     L ++K RG L CG+NTGL+GFA   ANG+W GFDV FC
Sbjct: 6   FFGSVTAVALAASGALAAEGDTLKEVKARGVLNCGVNTGLIGFAAPDANGNWSGFDVAFC 65

Query: 65  RALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYF 124
           +A+++A+  D +KI+Y+P   + RF AL S ++D+L+RN+ WT  R+  L L F  + Y+
Sbjct: 66  KAMAAAVLGDATKIKYVPTTGQTRFTALSSGEVDLLARNSTWTFQRDTDLKLDFIGVNYY 125

Query: 125 DGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDA 184
           DGQGF++ K  G+SS  +L+GA+IC+Q GTTTEL LADYFKA+NM Y P+  +   E + 
Sbjct: 126 DGQGFMVRKDLGVSSAKELNGATICIQTGTTTELNLADYFKANNMDYQPVNIDSNAEGEQ 185

Query: 185 AYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWT 244
            Y A  CDAYT D S L A + +   P  H+ILP+IISK PL PA+  GD  W +I  WT
Sbjct: 186 QYMAGACDAYTTDASGLAATRASFADPENHIILPEIISKEPLGPAVRHGDNNWGDIARWT 245

Query: 245 HYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMG 304
            YA++ AEE G+T  NI++++K + NP+VQR LG   + ++G+ +GL  +W  R I+  G
Sbjct: 246 LYALIAAEEYGVTSANIDELAKSSQNPEVQRLLGT--TDDLGKMIGLDAEWAKRAIKAGG 303

Query: 305 NYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           NYGE+F   +G Q+ + + RG NA W++GGLMYA P R
Sbjct: 304 NYGEIFAATIGEQTPIGLARGLNAQWTQGGLMYAMPFR 341


>gi|24114551|ref|NP_709061.1| putative periplasmic binding transport protein [Shigella flexneri
           2a str. 301]
 gi|24053744|gb|AAN44768.1| putative periplasmic binding transport protein [Shigella flexneri
           2a str. 301]
 gi|281602643|gb|ADA75627.1| putative periplasmic binding transport protein [Shigella flexneri
           2002017]
          Length = 341

 Score =  347 bits (891), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 152/319 (47%), Positives = 222/319 (69%), Gaps = 2/319 (0%)

Query: 24  ASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPL 83
            + L  ++K+GF++CGI+ GL  F+   A+G + G DVD CR +++A+F D +K++Y PL
Sbjct: 25  GATLDAVQKKGFVQCGISDGLPRFSYADADGKFSGIDVDVCRGVAAAVFGDDTKVKYTPL 84

Query: 84  NAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQL 143
            AKERF ALQS ++D+LSRNT WT  R+  +G+AF  +TY+DG GF+ H K G+ S  +L
Sbjct: 85  TAKERFTALQSGEVDLLSRNTTWTSSRDAGMGMAFTGVTYYDGIGFLTHDKAGLKSAKEL 144

Query: 144 SGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYA 203
            GA++C+QAGT TEL +ADYFKA+NMKY P+ F+R +E   A  + RCD    D S LYA
Sbjct: 145 DGATVCIQAGTDTELNVADYFKANNMKYTPVTFDRSDESAKALESGRCDTLASDQSQLYA 204

Query: 204 LKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQ 263
           L++    P+E ++LP++ISK PL P + +GD EW++IV WT +AM+ AEE+GI  +N+++
Sbjct: 205 LRIKLSNPAEWIVLPEVISKEPLGPVVRRGDDEWFSIVRWTLFAMLNAEEMGINSQNVDE 264

Query: 264 VSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIP 323
            + +   PD+   LG  K  + G+ L L   W Y II+ + NY E+F+RN+G++S LKI 
Sbjct: 265 KAANPATPDMAHLLG--KEGDYGKDLKLDNKWAYNIIKQVSNYSEIFERNVGSESPLKIK 322

Query: 324 RGYNALWSKGGLMYAPPIR 342
           RG N LW+ GG+ YAPP+R
Sbjct: 323 RGQNNLWNNGGIQYAPPVR 341


>gi|292486754|ref|YP_003529624.1| putative ABC transporter periplasmic protein [Erwinia amylovora
           CFBP1430]
 gi|292900844|ref|YP_003540213.1| ABC transporter substrate-binding protein [Erwinia amylovora ATCC
           49946]
 gi|291200692|emb|CBJ47825.1| ABC transporter, substrate-binding protein [Erwinia amylovora ATCC
           49946]
 gi|291552171|emb|CBA19208.1| putative ABC transport system, periplasmic component [Erwinia
           amylovora CFBP1430]
 gi|312170822|emb|CBX79082.1| putative ABC transport system, periplasmic component [Erwinia
           amylovora ATCC BAA-2158]
          Length = 341

 Score =  346 bits (888), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 161/343 (46%), Positives = 229/343 (66%), Gaps = 3/343 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNA-SILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGF 59
           M K    +++    LF  +   +A + L  IKK+GF++CGI+ GL GF+   ANG + G 
Sbjct: 1   MKKMMLSTLVTAAALFTLANQAHAGTTLDAIKKKGFIQCGISDGLPGFSYADANGKFSGI 60

Query: 60  DVDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFR 119
           DVD CRA ++A+  D  K++Y PL AKERF ALQS ++DILSRNT WT  R+  +G  F 
Sbjct: 61  DVDVCRAAAAAVLGDAGKVKYTPLTAKERFTALQSGEVDILSRNTTWTSARDGGMGFIFA 120

Query: 120 PITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERV 179
            + Y+DG GF+ H+K G+ S  +L GA++C+QAGT TEL +ADYFKA+ M+Y P+ F+R 
Sbjct: 121 GVNYYDGIGFLTHQKAGLKSAKELDGATVCIQAGTDTELNVADYFKANKMQYTPVTFDRS 180

Query: 180 EEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYN 239
           +E   A  + RCD    D S LYAL++   +P + ++LP++ISK PL P + + D +W+ 
Sbjct: 181 DESAKALDSGRCDTLASDQSQLYALRIKLGKPDDFIVLPEVISKEPLGPVVRRDDDDWFT 240

Query: 240 IVSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRI 299
           IV W+ YAM+ AEE+GIT KN++ +S   +NPD+   LG +   + G+ L L   W Y I
Sbjct: 241 IVKWSLYAMLNAEEMGITSKNVDSMSAKPSNPDMAHLLGAE--GDYGKDLKLGNKWAYNI 298

Query: 300 IRHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           I+ +GNY E+FDRN+G  S+LKI RG NALW+ GG+ YAPP+R
Sbjct: 299 IKQVGNYQEVFDRNVGKDSQLKIVRGQNALWNNGGIQYAPPVR 341


>gi|330999032|ref|ZP_08322757.1| general L-amino acid-binding periplasmic protein AapJ
           [Parasutterella excrementihominis YIT 11859]
 gi|329575774|gb|EGG57300.1| general L-amino acid-binding periplasmic protein AapJ
           [Parasutterella excrementihominis YIT 11859]
          Length = 340

 Score =  346 bits (888), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 149/342 (43%), Positives = 227/342 (66%), Gaps = 2/342 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           M +      L  + L   + +    +L  +K    + CG+NT   GF+   + G+W G D
Sbjct: 1   MNQTILAGALSAVSLSLAAPAFAGPVLDKVKANDVVVCGVNTAAPGFSNADSKGNWTGLD 60

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
           VD+CRAL++A+  D +K++++PLN+ +RF ALQ+ ++D+L+RNT W L R+ SLG  F  
Sbjct: 61  VDYCRALAAAVLGDANKVKFVPLNSPQRFSALQAGEVDVLARNTTWNLTRDASLGAVFVG 120

Query: 121 ITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVE 180
             Y+DGQGF++ KK  + S  QL+GA+ICVQ+GT++E ++ADYFK+H MKY  ++F+  E
Sbjct: 121 TNYYDGQGFLVPKKLNVKSAKQLNGATICVQSGTSSEPSVADYFKSHGMKYKAVLFDTTE 180

Query: 181 EIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNI 240
               A+ + RC  YT D+S L   +     P ++VILP++ISK PL P++ +GD EW+ I
Sbjct: 181 ATQGAFLSGRCQVYTTDMSDLAGARTKAANPDDYVILPEVISKEPLGPSVRRGDNEWFQI 240

Query: 241 VSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRII 300
             W   A + AEE GITQ N +++ K +T+P+V+R LG     ++G+ LGL KDW+YRI+
Sbjct: 241 ARWVLNAFIEAEEKGITQANADELRKTSTDPNVKRLLG--SGEDMGKLLGLDKDWSYRIV 298

Query: 301 RHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           + +GNYGE F+RNLG ++ L +PRG N  W+ GG++YAPP+R
Sbjct: 299 KQVGNYGESFERNLGPKTPLALPRGINNQWTNGGILYAPPVR 340


>gi|188532411|ref|YP_001906208.1| General L-amino ABC transporter binding protein [Erwinia
           tasmaniensis Et1/99]
 gi|188027453|emb|CAO95300.1| General L-amino ABC transporter binding protein [Erwinia
           tasmaniensis Et1/99]
          Length = 341

 Score =  345 bits (886), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 160/343 (46%), Positives = 229/343 (66%), Gaps = 3/343 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNA-SILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGF 59
           M K    +++    LF  +   +A + L  IKK+GF++CGI+ GL GF+   A+G + G 
Sbjct: 1   MKKMMLSTLVSAAALFSIANQAHAGTTLDAIKKKGFVQCGISDGLPGFSYADASGKFSGI 60

Query: 60  DVDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFR 119
           DVD CRA ++A+  D  K++Y PL AKERF ALQS ++DILSRNT WT  R+  +G  F 
Sbjct: 61  DVDVCRAAAAAVLGDAGKVKYTPLTAKERFTALQSGEVDILSRNTTWTSSRDGGMGFIFA 120

Query: 120 PITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERV 179
            + Y+DG GF+ H+K G+ S  +L GA++C+QAGT TEL +ADYFKA+ M+Y P+ F+R 
Sbjct: 121 GVNYYDGIGFLTHQKAGLKSAKELDGATVCIQAGTDTELNVADYFKANKMQYTPVTFDRS 180

Query: 180 EEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYN 239
           +E   A  + RCD    D S LYAL++   +P + ++LP++ISK PL P + + D +W+ 
Sbjct: 181 DESAKALDSGRCDTLASDQSQLYALRIKLGKPDDFIVLPEVISKEPLGPVVRRDDNDWFT 240

Query: 240 IVSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRI 299
           IV W+ YAM+ AEE+GIT KN++ +S   +NPD+   LG +   + G+ L L   W Y I
Sbjct: 241 IVKWSLYAMLNAEEMGITSKNVDSLSAKPSNPDMSHLLGAE--GDFGKDLKLDNKWAYNI 298

Query: 300 IRHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           I+ +GNY E+FDRN+G  S+LKI RG NALW+ GG+ YAPP+R
Sbjct: 299 IKQVGNYQEVFDRNVGKDSQLKIARGQNALWNNGGIQYAPPVR 341


>gi|158422580|ref|YP_001523872.1| extracellular solute-binding protein [Azorhizobium caulinodans ORS
           571]
 gi|158329469|dbj|BAF86954.1| extracellular solute-binding protein [Azorhizobium caulinodans ORS
           571]
          Length = 336

 Score =  345 bits (886), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 153/319 (47%), Positives = 218/319 (68%), Gaps = 4/319 (1%)

Query: 24  ASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPL 83
           A  L  +K RG L CG++TG+ GF++ + +G W GFDVDFCRA+++A+ +DP+K+ ++PL
Sbjct: 22  AQTLKAVKDRGTLNCGVSTGIPGFSQ-QVDGKWSGFDVDFCRAVAAAVLNDPAKVNFVPL 80

Query: 84  NAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQL 143
           NA++RF AL   ++D+LSRNT WTL RE      F  +TYFDGQGF++   + I S  +L
Sbjct: 81  NAEDRFTALSGSKVDLLSRNTTWTLEREAKQKFLFGAVTYFDGQGFLVPAARKIESALEL 140

Query: 144 SGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYA 203
            G+ +CVQ GTT      DYFK +NMK   +    V+++  AY    C+  + D+SALYA
Sbjct: 141 DGSKVCVQVGTTAASYAEDYFKTNNMKLELVTLPTVQDLVKAYENGTCNTISTDVSALYA 200

Query: 204 LKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQ 263
           L+    +P+ H++LPD+I+K PL P + QGD EW+N+V WTHY M+  EELG++  ++++
Sbjct: 201 LRTGFAKPASHIVLPDVITKEPLGPVVRQGDDEWFNVVKWTHYVMINGEELGVSSLSLDE 260

Query: 264 VSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIP 323
             K +  PDV+R +G D   + G  LGLTKD+  RIIR +GNYGE F+RN+G  S+L IP
Sbjct: 261 ALK-SQKPDVKRLVGTD--GDFGTELGLTKDFAVRIIRAVGNYGEAFERNIGTGSKLAIP 317

Query: 324 RGYNALWSKGGLMYAPPIR 342
           RG N LWS GG+ YAPP+R
Sbjct: 318 RGVNQLWSAGGIQYAPPVR 336


>gi|262274329|ref|ZP_06052140.1| amino acid ABC transporter amino acid-binding protein [Grimontia
           hollisae CIP 101886]
 gi|262220892|gb|EEY72206.1| amino acid ABC transporter amino acid-binding protein [Grimontia
           hollisae CIP 101886]
          Length = 381

 Score =  345 bits (886), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 154/318 (48%), Positives = 220/318 (69%), Gaps = 3/318 (0%)

Query: 25  SILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLN 84
           + L  +KK G + CG+ TGL GF+   +NG W+G DV+FC+A+++A+  D  K++Y+PL 
Sbjct: 67  NTLEKVKKSGVISCGVGTGLPGFSNPNSNGAWEGIDVEFCQAMAAAVLGDKDKVKYVPLT 126

Query: 85  AKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLS 144
           AKERF ALQS +IDILSRNT WTL R+ +LGL F  + Y+DGQGF++ K  G+ S  +L 
Sbjct: 127 AKERFTALQSGEIDILSRNTTWTLQRDGTLGLNFVGVNYYDGQGFMVKKDLGVKSALELD 186

Query: 145 GASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYAL 204
           GAS+CVQ+GTTTEL L+DYF+++ M + P+V++  +     + + RCD  T D S LYA 
Sbjct: 187 GASVCVQSGTTTELNLSDYFRSNGMSFKPVVYDTYDATVKGFESGRCDTLTTDQSGLYAS 246

Query: 205 KLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQV 264
           ++    P   V+LP+IISK PL P + QGD  W+NI  WT   M+  EE GIT  N++++
Sbjct: 247 RIKLADPDSAVVLPEIISKEPLGPVVRQGDDNWFNIAKWTLNTMINGEEFGITSANVDEM 306

Query: 265 SKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPR 324
             ++ +P+++R LG D     G+ LGL  DW Y++I+ +GNYGE F R +G+ S L+I R
Sbjct: 307 V-NSKDPNIRRILGQDGPK--GKGLGLNDDWGYQVIKQVGNYGESFQRTVGSGSPLQISR 363

Query: 325 GYNALWSKGGLMYAPPIR 342
           G NALWS+GG++YAPPIR
Sbjct: 364 GVNALWSEGGILYAPPIR 381


>gi|154248466|ref|YP_001419424.1| extracellular solute-binding protein [Xanthobacter autotrophicus
           Py2]
 gi|154162551|gb|ABS69767.1| extracellular solute-binding protein family 3 [Xanthobacter
           autotrophicus Py2]
          Length = 336

 Score =  345 bits (886), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 155/335 (46%), Positives = 230/335 (68%), Gaps = 4/335 (1%)

Query: 9   ILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALS 68
           +   + L   + + NA+ L ++K RG + CG++ GL GF+      +W G DVDFCRA++
Sbjct: 5   LFAAVGLLSLAGAVNAATLDEVKARGSVNCGVSQGLPGFSSPNDKNEWGGLDVDFCRAIA 64

Query: 69  SAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQG 128
           +AIF+DP+K+++ PL+AK+RF AL S  ID+LSRNT WT+ R+ +LG  F  + Y+DGQG
Sbjct: 65  AAIFNDPAKVKFSPLSAKDRFTALTSGAIDVLSRNTTWTMSRDTTLGFNFAGVIYYDGQG 124

Query: 129 FIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIV-FERVEEIDAAYR 187
           F++ K  G+ S  +L GASICVQ GT+ EL ++D+F+++NMK   ++ F  ++E   AY 
Sbjct: 125 FLVRKALGLKSAKELQGASICVQTGTSNELNVSDFFRSNNMKNGEVIAFGTIDETVKAYE 184

Query: 188 AHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYA 247
           + RCD +T D S L A++L     ++HVILP+ ISK PL P +  GD +W+++V W ++A
Sbjct: 185 SGRCDVFTADRSQLAAVRLKLTNAADHVILPETISKEPLGPLVRHGDDQWFDLVKWVYFA 244

Query: 248 MVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYG 307
           ++ AEELG+TQKN+++   ++ NPDV+R LG D     GE +GLT DW  RII+  GNYG
Sbjct: 245 LLNAEELGVTQKNVDE-QVNSQNPDVKRLLGTD--GKYGEGIGLTADWAVRIIKATGNYG 301

Query: 308 EMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           E++DRN+G  + L I RG N LW+KGG+ Y  P+R
Sbjct: 302 EIYDRNVGPATPLGIERGLNNLWNKGGIQYGMPVR 336


>gi|150397777|ref|YP_001328244.1| extracellular solute-binding protein [Sinorhizobium medicae WSM419]
 gi|150029292|gb|ABR61409.1| extracellular solute-binding protein family 3 [Sinorhizobium
           medicae WSM419]
          Length = 336

 Score =  345 bits (886), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 156/322 (48%), Positives = 228/322 (70%), Gaps = 3/322 (0%)

Query: 21  STNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQY 80
           +T A+ L  +K+RG L+CG++ G++GF+     G+W GFD+DFCRA+++A   D  +++Y
Sbjct: 18  ATQAATLDVVKQRGELRCGVSQGVLGFSAPDDKGEWSGFDIDFCRAVAAAALGDADQVKY 77

Query: 81  LPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSV 140
           +PL+ KERF ALQS ++D+LSR T WTL R+  LG++F  +TY+DGQ F++    G+ SV
Sbjct: 78  VPLSTKERFTALQSGEVDLLSRQTTWTLSRDTDLGMSFVGVTYYDGQAFMVRDDIGVKSV 137

Query: 141 SQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISA 200
            +LSGAS+C + GTTTE  +ADYF A+ ++Y  I FE+ ++   A+ A RCD Y+ D SA
Sbjct: 138 KELSGASVCTETGTTTEQNMADYFSANKIEYKVIAFEKADQTIQAFNAGRCDVYSTDASA 197

Query: 201 LYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKN 260
           LY+ ++T + P   V+LP++ISK PL PA+ QGD +W+ +V WT +AMV AEELGIT ++
Sbjct: 198 LYSQRMTLNDPDRFVVLPEVISKEPLGPAVRQGDDQWFKVVRWTLFAMVEAEELGITLES 257

Query: 261 INQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSEL 320
              + +  T    +RFLG+D  +  G ALGL  DW Y+++  +GNYGE+F+R+LG  S L
Sbjct: 258 AASLLESGTVAQ-KRFLGVDNEA--GRALGLNPDWAYQVVSAVGNYGEIFERHLGQASAL 314

Query: 321 KIPRGYNALWSKGGLMYAPPIR 342
           KI RG N LW+ GGL+YAPP+R
Sbjct: 315 KIDRGLNKLWNAGGLIYAPPVR 336


>gi|308188311|ref|YP_003932442.1| amino-acid ABC transporter-binding protein yhdW precursor [Pantoea
           vagans C9-1]
 gi|308058821|gb|ADO10993.1| Putative amino-acid ABC transporter-binding protein yhdW precursor
           [Pantoea vagans C9-1]
          Length = 341

 Score =  345 bits (885), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 155/319 (48%), Positives = 219/319 (68%), Gaps = 2/319 (0%)

Query: 24  ASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPL 83
            + L  IKK+GF++CGI+ GL GF+   A G + G DVD CRA ++A+F D +K++Y PL
Sbjct: 25  GTTLDAIKKKGFVQCGISDGLPGFSYADAGGKFTGIDVDVCRAAAAAVFGDATKVKYTPL 84

Query: 84  NAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQL 143
            AKERF ALQS ++D+LSRNT WT  R+  +G  F  + Y+DG GF+ H+K G+ S  +L
Sbjct: 85  TAKERFTALQSGEVDVLSRNTTWTSSRDGGMGFLFAGVNYYDGIGFLTHQKAGLKSAKEL 144

Query: 144 SGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYA 203
            GA++C+QAGT TEL +AD+FKA+ M+Y P+ F+R +E   A  + RCD    D S LYA
Sbjct: 145 DGATVCIQAGTDTELNVADFFKANKMQYTPVTFDRSDESAKALDSGRCDTLASDQSQLYA 204

Query: 204 LKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQ 263
           L++   +P E ++LP++ISK PL P + +GD +W+ IV W+ YAM+ AEE+GI  KN++Q
Sbjct: 205 LRIKLGKPDEFIVLPEVISKEPLGPLVRRGDDDWFTIVKWSLYAMLNAEEMGINSKNVDQ 264

Query: 264 VSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIP 323
           ++   T PD+   LG +   + G+ L L   W Y II+ +GNY E FDRN+G  S LKI 
Sbjct: 265 MTAKPTTPDMAHLLGAE--GDFGKDLKLDNKWAYNIIKQVGNYQESFDRNVGKDSALKIA 322

Query: 324 RGYNALWSKGGLMYAPPIR 342
           RG NALW++GG+ YAPP+R
Sbjct: 323 RGQNALWNQGGIQYAPPVR 341


>gi|153011796|ref|YP_001373009.1| extracellular solute-binding protein [Ochrobactrum anthropi ATCC
           49188]
 gi|151563684|gb|ABS17180.1| extracellular solute-binding protein family 3 [Ochrobactrum
           anthropi ATCC 49188]
          Length = 335

 Score =  345 bits (884), Expect = 7e-93,   Method: Compositional matrix adjust.
 Identities = 155/313 (49%), Positives = 223/313 (71%), Gaps = 3/313 (0%)

Query: 30  IKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERF 89
           IK+RG ++CG++ G++GF+    NG W GFDVDFCRA+++A   +P K+ Y+PL+ K+RF
Sbjct: 26  IKERGEVRCGVSQGVLGFSVPDKNGVWGGFDVDFCRAVAAATLGNPDKVAYVPLSTKDRF 85

Query: 90  LALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASIC 149
            ALQS ++D+LSR T WTL R+  LG++F  + Y+DGQ F+++K+ G+ SV ++SGAS+C
Sbjct: 86  TALQSGEVDLLSRQTTWTLSRDTDLGMSFVGVNYYDGQAFMVNKEVGVKSVKEISGASVC 145

Query: 150 VQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTND 209
            + GTTTE  +ADYF A+ ++Y  I FE+ ++   A+   RCD Y+ D SALYA +LT +
Sbjct: 146 TETGTTTEQNMADYFSANKIEYQVIAFEKPDQTIQAFNTGRCDVYSTDASALYAQRLTLN 205

Query: 210 RPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTT 269
            P   V+LP++ISK PL PA+ QGD +W+ IV WT +A++ AEE+GIT++N   + +  T
Sbjct: 206 DPDRFVVLPEVISKEPLGPAVRQGDDQWFKIVRWTLFALIEAEEMGITKENAASLLESGT 265

Query: 270 NPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNAL 329
               +RFLG++  S  G+A+GL   W Y+ I  +GNYGE+F+R+LG  S LKI RG N L
Sbjct: 266 VAQ-KRFLGVE--SEAGKAMGLDAKWAYQAISAVGNYGEIFERHLGKDSPLKIDRGLNRL 322

Query: 330 WSKGGLMYAPPIR 342
           WS GGLMYAPP R
Sbjct: 323 WSDGGLMYAPPAR 335


>gi|323139262|ref|ZP_08074316.1| extracellular solute-binding protein family 3 [Methylocystis sp.
           ATCC 49242]
 gi|322395483|gb|EFX98030.1| extracellular solute-binding protein family 3 [Methylocystis sp.
           ATCC 49242]
          Length = 343

 Score =  344 bits (883), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 156/344 (45%), Positives = 239/344 (69%), Gaps = 5/344 (1%)

Query: 1   MYKDFFVSILCLIILFFTSFS--TNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKG 58
           M++    + L L+I  F   +  + AS L  +K+ G L CG++ G+VGF+     G+W G
Sbjct: 3   MFQKRVRASLSLLIASFCLLAAPSQASTLDSVKQSGALACGVSNGIVGFSIADDKGNWSG 62

Query: 59  FDVDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAF 118
           FDVDFCRA++SAIF D SK++++P+  +ERF AL+S + D+LSRN+ W    E+  GL F
Sbjct: 63  FDVDFCRAVASAIFGDASKLRFVPVGTEERFEALKSGKFDLLSRNSTWAFSNEVDQGLIF 122

Query: 119 RPITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFER 178
             +T++DGQGF++ K + I+S  +L+G+ +CV++ TTTE  +AD+FK ++M + P+ FE 
Sbjct: 123 AGVTFYDGQGFLVPKSRKIASALELNGSKVCVKSATTTEANVADFFKQNHMSFEPVRFET 182

Query: 179 VEEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWY 238
           + EI  AY A +C+A + DIS L+A+KL   +P++++IL D+ISK PL P + QGD +W 
Sbjct: 183 LAEIIKAYDAGQCNAISSDISQLHAIKLELKKPADNLILADVISKEPLGPVVRQGDDQWL 242

Query: 239 NIVSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYR 298
           N+V W  +AM+ AEELG++  NI Q +K +  P V+RF+G +   +IG+ LGL+ DW   
Sbjct: 243 NLVKWVIFAMLNAEELGVSSSNIEQ-AKKSQKPAVRRFIGAE--GDIGKQLGLSPDWALN 299

Query: 299 IIRHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           I++++GNYGE+ +RN+G +S+L I RG N LWS GG+ YAPP+R
Sbjct: 300 IVKNVGNYGEVLERNVGKKSKLGIARGLNQLWSMGGVQYAPPLR 343


>gi|326797351|ref|YP_004315171.1| ABC-type transporter periplasmic subunit family 3 [Marinomonas
           mediterranea MMB-1]
 gi|326548115|gb|ADZ93335.1| ABC-type transporter, periplasmic subunit family 3 [Marinomonas
           mediterranea MMB-1]
          Length = 340

 Score =  344 bits (882), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 148/324 (45%), Positives = 223/324 (68%), Gaps = 2/324 (0%)

Query: 19  SFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKI 78
           S +  A+ L D+K +GF++CG++ G+ GF+     G+W G DVD CRA ++A+F D   +
Sbjct: 19  SATAGAATLDDVKSKGFIQCGVSQGVPGFSNADEAGNWSGIDVDACRAAAAAVFGDAQAV 78

Query: 79  QYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGIS 138
           ++ PL+AKERF ALQS +ID+LSRNT WT  R+ +LGL F  + ++DGQGF++    G++
Sbjct: 79  KFTPLSAKERFTALQSGEIDMLSRNTTWTYTRDTALGLDFTAVNFYDGQGFMVRNDLGVT 138

Query: 139 SVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDI 198
           S  +L GA++C + GTTTEL +AD+F+ H + Y P++ ++ +E  AAY + RCD +T D 
Sbjct: 139 SAMELDGATVCTEQGTTTELNMADFFRKHGLSYVPVIVQKADEALAAYASGRCDVFTTDK 198

Query: 199 SALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQ 258
           S L A +     PS HVILP+ ISK PL P +  GD +W +IV+W  +  V AEE+GI+ 
Sbjct: 199 SGLAAHRSKLADPSAHVILPETISKEPLGPVVRHGDNQWKDIVTWAMFVQVNAEEMGISS 258

Query: 259 KNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQS 318
           KN+ ++  ++ +P ++R LG +   N+GE+LGL  DW Y II  +GNYGE+F+ N+G  +
Sbjct: 259 KNVAKIKAESKDPAIRRLLGAE--GNMGESLGLGADWAYDIIAEVGNYGEVFENNVGPNT 316

Query: 319 ELKIPRGYNALWSKGGLMYAPPIR 342
            + +PRG N LW++GG+MYAPP+R
Sbjct: 317 PVGLPRGINNLWTEGGVMYAPPVR 340


>gi|259906955|ref|YP_002647311.1| General L-amino ABC transporter binding protein [Erwinia pyrifoliae
           Ep1/96]
 gi|224962577|emb|CAX54032.1| General L-amino ABC transporter binding protein [Erwinia pyrifoliae
           Ep1/96]
 gi|283476749|emb|CAY72585.1| putative ABC transport system, periplasmic component [Erwinia
           pyrifoliae DSM 12163]
 gi|310766170|gb|ADP11120.1| General L-amino ABC transporter binding protein [Erwinia sp.
           Ejp617]
          Length = 341

 Score =  344 bits (882), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 159/343 (46%), Positives = 229/343 (66%), Gaps = 3/343 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNA-SILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGF 59
           M K    +++    LF  +   +A + L  IKK+GF++CGI+ GL GF+   A+G + G 
Sbjct: 1   MKKMMLSTLVTAAALFTLANQAHAGTTLDAIKKKGFIQCGISDGLPGFSYADASGKFSGI 60

Query: 60  DVDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFR 119
           DVD CRA ++A+  D  K++Y PL AKERF ALQS ++DILSRNT WT  R+  +G  F 
Sbjct: 61  DVDVCRAAAAAVLGDAGKVKYTPLTAKERFTALQSGEVDILSRNTTWTSARDGGMGFIFA 120

Query: 120 PITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERV 179
            + Y+DG GF+ H+K G+ S  +L GA++C+QAGT TEL +ADYFKA+ M+Y P+ F+R 
Sbjct: 121 GVNYYDGIGFLTHQKAGLKSAKELDGATVCIQAGTDTELNVADYFKANKMQYTPVTFDRS 180

Query: 180 EEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYN 239
           +E   A  + RCD    D S LYAL++   +P + ++LP++ISK PL P + + D +W+ 
Sbjct: 181 DESAKALDSGRCDTLASDQSQLYALRIKLGKPDDFIVLPEVISKEPLGPVVRRDDDDWFT 240

Query: 240 IVSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRI 299
           IV W+ +AM+ AEE+GIT KN++ +S   +NPD+   LG +   + G+ L L   W Y I
Sbjct: 241 IVKWSLFAMLNAEEMGITSKNVDSMSAKPSNPDMAHLLGAE--GDFGKDLKLGNKWAYNI 298

Query: 300 IRHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           I+ +GNY E+FDRN+G  S+LKI RG NALW+ GG+ YAPP+R
Sbjct: 299 IKQVGNYQEVFDRNVGKDSQLKIARGQNALWNNGGIQYAPPVR 341


>gi|84499808|ref|ZP_00998096.1| glutamate/glutamine/aspartate/asparagine ABC transporter,
           periplasmic substrate-binding protein [Oceanicola
           batsensis HTCC2597]
 gi|84392952|gb|EAQ05163.1| glutamate/glutamine/aspartate/asparagine ABC transporter,
           periplasmic substrate-binding protein [Oceanicola
           batsensis HTCC2597]
          Length = 339

 Score =  344 bits (882), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 153/313 (48%), Positives = 211/313 (67%), Gaps = 3/313 (0%)

Query: 31  KKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERFL 90
           K RG L CG++TGL GF+   ANG+W+GFDV  CRA+++A+  DP+ ++++P   K RF 
Sbjct: 29  KARGTLNCGVSTGLAGFSAPNANGEWEGFDVAVCRAVATAVLGDPNAVEFVPTTGKTRFT 88

Query: 91  ALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASICV 150
           AL S +ID+L+RNT WTL R+  L   F  + Y+DGQGFI  K  G+SS  +L GA++C+
Sbjct: 89  ALASGEIDMLARNTTWTLSRDADLKFTFIGVNYYDGQGFITPKALGVSSAKELDGATVCI 148

Query: 151 QAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTNDR 210
           Q GTTTEL LAD+F+ +N+ Y P+  E   E    Y A  CD YT D S L A + T + 
Sbjct: 149 QTGTTTELNLADFFRVNNISYEPVPIETNAEAQQQYLAGACDVYTTDASGLAATRATFET 208

Query: 211 PSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTT- 269
           P++HVILP+IISK PL P +  GD+EW ++V W+  AM+ AEELG+T  N+ ++S  TT 
Sbjct: 209 PTDHVILPEIISKEPLGPLVRHGDSEWGDVVRWSLNAMIAAEELGVTSANVEEMSSSTTD 268

Query: 270 NPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNAL 329
           NP++ R LG +   N+GE LGL  DW   II  +GNYGE+F+ N+G  + + + RG NA 
Sbjct: 269 NPEINRLLGTE--GNLGEMLGLEADWAKNIIMQVGNYGEVFEANIGESTPIGLARGLNAQ 326

Query: 330 WSKGGLMYAPPIR 342
           W+ GGL+YAPP R
Sbjct: 327 WTDGGLLYAPPFR 339


>gi|288962140|ref|YP_003452435.1| general L-amino acid transport system substrate-binding protein
           [Azospirillum sp. B510]
 gi|288914406|dbj|BAI75891.1| general L-amino acid transport system substrate-binding protein
           [Azospirillum sp. B510]
          Length = 353

 Score =  344 bits (882), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 152/314 (48%), Positives = 229/314 (72%), Gaps = 4/314 (1%)

Query: 30  IKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERF 89
           +K++G+++CG+N GL GF+     G W G DVD CRA+++A+F D  K++Y PL+A++R 
Sbjct: 43  VKQKGYVQCGVNLGLYGFSAPDDKGKWSGLDVDMCRAVAAAVFGDAEKVKYTPLSAQQRL 102

Query: 90  LALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASIC 149
            ALQS +IDIL+RNT  TL R+ + GL F P  Y+DGQGF++  K G+ S  QL+GA++C
Sbjct: 103 PALQSGEIDILARNTTRTLTRDTANGLNFAPTNYYDGQGFMVSAKLGLKSAKQLNGATVC 162

Query: 150 VQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTN- 208
           V  GTTTE  ++DYF+A+ M + P+V E+ EE++ A+ A RCDA T D S L A++    
Sbjct: 163 VLPGTTTEQNVSDYFRANKMTFKPVVIEKNEELNKAFFAGRCDALTSDASQLAAIRAAEV 222

Query: 209 DRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDT 268
             P+++VILP++ISK PL+PAI QGD EW N+V+W  YAMV AEE G+T + ++  +  +
Sbjct: 223 PNPADYVILPELISKEPLSPAIRQGDEEWTNLVTWAFYAMVQAEEKGLTSETVD-AALTS 281

Query: 269 TNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNA 328
            +PDV+R LG+  ++  G+ALG+ ++W + II+ +GNY + ++RN+G  S+LK+PRG NA
Sbjct: 282 PDPDVKRLLGV--TAGNGKALGVEENWAFNIIKQVGNYAQSYERNVGAGSKLKMPRGQNA 339

Query: 329 LWSKGGLMYAPPIR 342
           L+++GGLMYAPP++
Sbjct: 340 LYTEGGLMYAPPMK 353


>gi|89110028|ref|AP_003808.1| predicted amino-acid transporter subunit [Escherichia coli str.
           K-12 substr. W3110]
 gi|170082796|ref|YP_001732116.1| amino-acid ABC transporter periplasmic-binding protein [Escherichia
           coli str. K-12 substr. DH10B]
 gi|218702040|ref|YP_002409669.1| amino-acid ABC transporter periplasmic-binding protein [Escherichia
           coli IAI39]
 gi|254163203|ref|YP_003046311.1| putative amino-acid transporter subunit [Escherichia coli B str.
           REL606]
 gi|606209|gb|AAA58072.1| ORF_o305; frameshift upstream would extend start [Escherichia coli
           str. K-12 substr. MG1655]
 gi|85676059|dbj|BAE77309.1| predicted amino-acid transporter subunit [Escherichia coli str. K12
           substr. W3110]
 gi|169890631|gb|ACB04338.1| predicted amino-acid transporter subunit; periplasmic-binding
           component of ABC superfamily [Escherichia coli str. K-12
           substr. DH10B]
 gi|218372026|emb|CAR19884.1| amino-acid transporter subunit ; periplasmic-binding component of
           ABC superfamily [Escherichia coli IAI39]
 gi|242378802|emb|CAQ33594.1| yhdW, subunit of YhdW/YhdX/YhdY/YhdZ ABC transporter [Escherichia
           coli BL21(DE3)]
 gi|253975104|gb|ACT40775.1| predicted amino-acid transporter subunit [Escherichia coli B str.
           REL606]
 gi|253979260|gb|ACT44930.1| predicted amino-acid transporter subunit [Escherichia coli
           BL21(DE3)]
 gi|309703687|emb|CBJ03028.1| Putative ABC transporter, substrate-binding protein [Escherichia
           coli ETEC H10407]
 gi|315137851|dbj|BAJ45010.1| extracellular solute-binding protein [Escherichia coli DH1]
          Length = 305

 Score =  343 bits (881), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 150/307 (48%), Positives = 216/307 (70%), Gaps = 2/307 (0%)

Query: 36  LKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSK 95
           ++CGI+ GL GF+   A+G + G DVD CR +++A+F D +K++Y PL AKERF ALQS 
Sbjct: 1   MQCGISDGLPGFSYADADGKFSGIDVDICRGVAAAVFGDDTKVKYTPLTAKERFTALQSG 60

Query: 96  QIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTT 155
           ++D+LSRNT WT  R+  +G+AF  +TY+DG GF+ H K G+ S  +L GA++C+QAGT 
Sbjct: 61  EVDLLSRNTTWTSSRDAGMGMAFTGVTYYDGIGFLTHDKAGLKSAKELDGATVCIQAGTD 120

Query: 156 TELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHV 215
           TEL +ADYFKA+NMKY P+ F+R +E   A  + RCD    D S LYAL++    P+E +
Sbjct: 121 TELNVADYFKANNMKYTPVTFDRSDESAKALESGRCDTLASDQSQLYALRIKLSNPAEWI 180

Query: 216 ILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQR 275
           +LP++ISK PL P + +GD EW++IV WT +AM+ AEE+GI  +N+++ + +   PD+  
Sbjct: 181 VLPEVISKEPLGPVVRRGDDEWFSIVRWTLFAMLNAEEMGINSQNVDEKAANPATPDMAH 240

Query: 276 FLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGL 335
            LG  K  + G+ L L   W Y II+ +GNY E+F+RN+G++S LKI RG N LW+ GG+
Sbjct: 241 LLG--KEGDYGKDLKLDNKWAYNIIKQVGNYSEIFERNVGSESPLKIKRGQNNLWNNGGI 298

Query: 336 MYAPPIR 342
            YAPP+R
Sbjct: 299 QYAPPVR 305


>gi|144899134|emb|CAM75998.1| ABC-type amino acid transport/signal transduction systems,
           periplasmic component/domain [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 340

 Score =  343 bits (881), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 152/314 (48%), Positives = 228/314 (72%), Gaps = 3/314 (0%)

Query: 30  IKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERF 89
           +K +GF++CG+N GL GF+     G+W G DVD CRA+++A+F D SK++Y PL+A++R 
Sbjct: 29  VKAKGFVQCGVNLGLYGFSAPDDKGNWSGLDVDACRAVAAAVFGDASKVKYTPLSAQQRL 88

Query: 90  LALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASIC 149
            ALQS +ID+L+RNT WTL R+ + GL F    Y+DGQGF++  K G+ +  +L+GA++C
Sbjct: 89  PALQSGEIDLLARNTTWTLSRDTANGLNFTVTNYYDGQGFMVPTKLGVKAAKELNGATVC 148

Query: 150 VQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTN- 208
           V  GTTTE  LAD+F+A+ M Y P+V E+ EE+ +A+ A RCD YT D S L A++    
Sbjct: 149 VLPGTTTEQNLADWFRANKMTYKPVVIEKNEELASAFIAGRCDVYTSDASQLAAIRANEM 208

Query: 209 DRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDT 268
             P++++ILP++ISK PLA A+  GD +W ++V W+ YAM+ AEE G+T  N++Q++  +
Sbjct: 209 PNPADYLILPELISKEPLAVAVRHGDDQWMDVVRWSIYAMIAAEEKGVTMANVDQMAASS 268

Query: 269 TNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNA 328
            +P+++R LG+  ++  G+ALGL + W   II+ +GNYGE FDRN+G+ S+LKI RG NA
Sbjct: 269 PDPEIKRLLGV--TAGNGKALGLDEAWAKTIIKQVGNYGESFDRNVGSGSKLKIARGQNA 326

Query: 329 LWSKGGLMYAPPIR 342
           L+++GGLMYAPP +
Sbjct: 327 LYTQGGLMYAPPFK 340


>gi|281180310|dbj|BAI56640.1| amino acid ABC transporter substrate binding component [Escherichia
           coli SE15]
          Length = 305

 Score =  343 bits (881), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 150/307 (48%), Positives = 216/307 (70%), Gaps = 2/307 (0%)

Query: 36  LKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSK 95
           ++CGI+ GL GF+   A+G + G DVD CR +++A+F D +K++Y PL AKERF ALQS 
Sbjct: 1   MQCGISDGLPGFSYADADGKFSGIDVDVCRGVAAAVFGDDTKVKYTPLTAKERFTALQSG 60

Query: 96  QIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTT 155
           ++D+LSRNT WT  R+  +G+AF  +TY+DG GF+ H K G+ S  +L GA++C+QAGT 
Sbjct: 61  EVDLLSRNTTWTSSRDAGMGMAFTGVTYYDGIGFLTHDKAGLKSAKELDGATVCIQAGTD 120

Query: 156 TELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHV 215
           TEL +ADYFKA+NMKY P+ F+R +E   A  + RCD    D S LYAL++    P+E +
Sbjct: 121 TELNVADYFKANNMKYTPVTFDRSDESAKALESGRCDTLASDQSQLYALRIKLSNPTEWI 180

Query: 216 ILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQR 275
           +LP++ISK PL P + +GD EW++IV WT +AM+ AEE+GI  +N+++ + +   PD+  
Sbjct: 181 VLPEVISKEPLGPVVRRGDDEWFSIVRWTLFAMLNAEEMGINSQNVDEKAANPATPDMAH 240

Query: 276 FLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGL 335
            LG  K  + G+ L L   W Y II+ +GNY E+F+RN+G++S LKI RG N LW+ GG+
Sbjct: 241 LLG--KEGDYGKDLKLDNKWAYNIIKQVGNYSEIFERNVGSESPLKIKRGQNNLWNNGGI 298

Query: 336 MYAPPIR 342
            YAPP+R
Sbjct: 299 QYAPPVR 305


>gi|15803803|ref|NP_289837.1| putative periplasmic binding transport protein [Escherichia coli
           O157:H7 EDL933]
 gi|209920741|ref|YP_002294825.1| amino acid ABC transporter substrate binding component [Escherichia
           coli SE11]
 gi|218555833|ref|YP_002388746.1| amino-acid ABC transporter periplasmic-binding protein [Escherichia
           coli IAI1]
 gi|218696968|ref|YP_002404635.1| amino-acid transporter subunit ; periplasmic-binding component of
           ABC superfamily [Escherichia coli 55989]
 gi|218706883|ref|YP_002414402.1| amino-acid ABC transporter periplasmic-binding protein [Escherichia
           coli UMN026]
 gi|12517899|gb|AAG58397.1|AE005554_8 putative periplasmic binding transport protein [Escherichia coli
           O157:H7 str. EDL933]
 gi|13363614|dbj|BAB37564.1| putative periplasmic binding transport protein [Escherichia coli
           O157:H7 str. Sakai]
 gi|209757458|gb|ACI77041.1| putative periplasmic binding transport protein [Escherichia coli]
 gi|209757460|gb|ACI77042.1| putative periplasmic binding transport protein [Escherichia coli]
 gi|209757462|gb|ACI77043.1| putative periplasmic binding transport protein [Escherichia coli]
 gi|209757464|gb|ACI77044.1| putative periplasmic binding transport protein [Escherichia coli]
 gi|209757466|gb|ACI77045.1| putative periplasmic binding transport protein [Escherichia coli]
 gi|209914000|dbj|BAG79074.1| amino acid ABC transporter substrate binding component [Escherichia
           coli SE11]
 gi|218353700|emb|CAU99962.1| amino-acid transporter subunit ; periplasmic-binding component of
           ABC superfamily [Escherichia coli 55989]
 gi|218362601|emb|CAR00226.1| amino-acid transporter subunit ; periplasmic-binding component of
           ABC superfamily [Escherichia coli IAI1]
 gi|218433980|emb|CAR14897.1| amino-acid transporter subunit ; periplasmic-binding component of
           ABC superfamily [Escherichia coli UMN026]
          Length = 305

 Score =  343 bits (880), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 150/307 (48%), Positives = 216/307 (70%), Gaps = 2/307 (0%)

Query: 36  LKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSK 95
           ++CGI+ GL GF+   A+G + G DVD CR +++A+F D +K++Y PL AKERF ALQS 
Sbjct: 1   MQCGISDGLPGFSYADADGKFSGIDVDVCRGVAAAVFGDDTKVKYTPLTAKERFTALQSG 60

Query: 96  QIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTT 155
           ++D+LSRNT WT  R+  +G+AF  +TY+DG GF+ H K G+ S  +L GA++C+QAGT 
Sbjct: 61  EVDLLSRNTTWTSSRDAGMGMAFTGVTYYDGIGFLTHDKAGLKSAKELDGATVCIQAGTD 120

Query: 156 TELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHV 215
           TEL +ADYFKA+NMKY P+ F+R +E   A  + RCD    D S LYAL++    P+E +
Sbjct: 121 TELNVADYFKANNMKYTPVTFDRSDESAKALESGRCDTLASDQSQLYALRIKLSNPAEWI 180

Query: 216 ILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQR 275
           +LP++ISK PL P + +GD EW++IV WT +AM+ AEE+GI  +N+++ + +   PD+  
Sbjct: 181 VLPEVISKEPLGPVVRRGDDEWFSIVRWTLFAMLNAEEMGINSQNVDEKAANPATPDMAH 240

Query: 276 FLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGL 335
            LG  K  + G+ L L   W Y II+ +GNY E+F+RN+G++S LKI RG N LW+ GG+
Sbjct: 241 LLG--KEGDYGKDLKLDNKWAYNIIKQVGNYSEIFERNVGSESPLKIKRGQNNLWNNGGI 298

Query: 336 MYAPPIR 342
            YAPP+R
Sbjct: 299 QYAPPVR 305


>gi|163733776|ref|ZP_02141218.1| glutamate/glutamine/aspartate/asparagine-binding protein
           [Roseobacter litoralis Och 149]
 gi|161392887|gb|EDQ17214.1| glutamate/glutamine/aspartate/asparagine-binding protein
           [Roseobacter litoralis Och 149]
          Length = 338

 Score =  343 bits (880), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 149/316 (47%), Positives = 215/316 (68%), Gaps = 2/316 (0%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           L D+K RG L CG+ TGLVGFA   A+G+W GFDV  CRA+++A+  D + ++++P   K
Sbjct: 25  LDDVKARGTLNCGVTTGLVGFAAPNADGEWNGFDVAICRAVAAAVLGDATAVEFVPTTGK 84

Query: 87  ERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGA 146
            RF AL S +ID+L+RNT WT  R++ L   F  + Y+DGQGF++ K  G++S  +L GA
Sbjct: 85  TRFTALASGEIDMLARNTTWTFSRDVDLKFTFVGVNYYDGQGFMVPKSLGVTSAKELDGA 144

Query: 147 SICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKL 206
           ++C+Q GTTTEL LAD+F+A+N+ Y P+  E   E    Y A  CD YT D S L A + 
Sbjct: 145 TVCIQTGTTTELNLADFFRANNISYEPVPIETNAEGQQQYLAGACDTYTTDASGLAATRA 204

Query: 207 TNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSK 266
           T + P+EHV+LP+IISK PL P +  GD EW ++V WT  A++TAEELG+T  N+++++ 
Sbjct: 205 TFENPTEHVLLPEIISKEPLGPLVRHGDDEWGDVVRWTLNALITAEELGVTSANVSEMAT 264

Query: 267 DTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGY 326
            + NP+V+R LG + +  +GE LGL  DW  + I   GNYGE+F +N+G ++ + + RG 
Sbjct: 265 GSNNPEVKRLLGSEGT--LGEMLGLEADWAMKAIATQGNYGEIFAKNIGEETPIALSRGL 322

Query: 327 NALWSKGGLMYAPPIR 342
           NA W+ GGL+Y+PP R
Sbjct: 323 NAQWTNGGLIYSPPFR 338


>gi|254504317|ref|ZP_05116468.1| hypothetical protein SADFL11_4356 [Labrenzia alexandrii DFL-11]
 gi|222440388|gb|EEE47067.1| hypothetical protein SADFL11_4356 [Labrenzia alexandrii DFL-11]
          Length = 338

 Score =  343 bits (879), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 160/342 (46%), Positives = 231/342 (67%), Gaps = 7/342 (2%)

Query: 3   KDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVD 62
           K+ F S+         +F  +AS L  +K+ G+  CG++ G  GF+   ++G+W G DVD
Sbjct: 2   KNTFKSLAVAAAFSGAAFPASASTLERVKENGYFTCGVSQGNPGFSNPDSDGNWSGLDVD 61

Query: 63  FCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPIT 122
           +CRA+++A+  DP+ +++ PL++ ERF ALQS +ID+LSR T WT+ R+ +LG  F  + 
Sbjct: 62  YCRAIAAAVLGDPAAVKFRPLSSPERFTALQSGEIDVLSRTTTWTMSRDTNLGANFAGVM 121

Query: 123 YFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEI 182
           Y+DGQ  ++ K+ GI+S  +L+GAS+C   GTTTEL +AD+F+ +NM+Y  + FE+ +E+
Sbjct: 122 YYDGQAMMVRKELGITSAMELAGASVCTATGTTTELNVADFFRVNNMEYEVVAFEKNDEV 181

Query: 183 DAAYRAHRCDAYTGDISALYA--LKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNI 240
             AY A RCD YT D S L+A  LKLTN  PSEH+ILP++ISK PL P + QGD +W NI
Sbjct: 182 TQAYDAGRCDVYTTDKSGLHANRLKLTN--PSEHMILPEVISKEPLGPVVRQGDDQWLNI 239

Query: 241 VSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRII 300
             WT   ++ AEELG+TQ N+  + + + NP V+R +G++   N G ALGL +DW  RII
Sbjct: 240 AKWTLNVLINAEELGVTQANVADM-ESSDNPAVKRLIGVE--GNFGGALGLDQDWAVRII 296

Query: 301 RHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
             +GNYGE+F RN+G  + L I RG NA W  GG +YAPP+R
Sbjct: 297 SAVGNYGEIFVRNVGVDTPLGIERGLNASWIDGGTLYAPPVR 338


>gi|218550552|ref|YP_002384343.1| amino-acid ABC transporter periplasmic-binding protein [Escherichia
           fergusonii ATCC 35469]
 gi|218358093|emb|CAQ90739.1| amino-acid transporter subunit ; periplasmic-binding component of
           ABC superfamily [Escherichia fergusonii ATCC 35469]
          Length = 305

 Score =  343 bits (879), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 149/307 (48%), Positives = 216/307 (70%), Gaps = 2/307 (0%)

Query: 36  LKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSK 95
           ++CGI+ GL GF+   A+G + G DVD CR +++A+F D +K++Y PL AKERF ALQS 
Sbjct: 1   MQCGISDGLPGFSYADADGKFSGIDVDVCRGVAAAVFGDDTKVKYTPLTAKERFTALQSG 60

Query: 96  QIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTT 155
           ++D+LSRNT WT  R+  +G+AF  +TY+DG GF+ H K G+ S  +L GA++C+QAGT 
Sbjct: 61  EVDLLSRNTTWTSSRDAGMGMAFTGVTYYDGIGFLTHDKAGLKSAKELDGATVCIQAGTD 120

Query: 156 TELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHV 215
           TEL +ADYFKA+NMKY P+ F+R +E   A  + RCD    D S LYAL++    P+E +
Sbjct: 121 TELNVADYFKANNMKYTPVTFDRSDESAKALESGRCDTLASDQSQLYALRIKLSNPAEWI 180

Query: 216 ILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQR 275
           +LP++ISK PL P + +GD EW++IV WT +AM+ AEE+G+  +N+++ + +   PD+  
Sbjct: 181 VLPEVISKEPLGPVVRRGDDEWFSIVRWTLFAMLNAEEMGVNSQNVDEKAANPATPDMAH 240

Query: 276 FLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGL 335
            LG  K  + G+ L L   W Y II+ +GNY E+F+RN+G++S LKI RG N LW+ GG+
Sbjct: 241 LLG--KEGDYGKDLKLDNKWAYNIIKQVGNYSEIFERNVGSESPLKIKRGQNNLWNNGGI 298

Query: 336 MYAPPIR 342
            YAPP+R
Sbjct: 299 QYAPPVR 305


>gi|254512097|ref|ZP_05124164.1| glutamate/glutamine/aspartate/asparagine ABC transporter,
           periplasmic substrate-binding protein [Rhodobacteraceae
           bacterium KLH11]
 gi|221535808|gb|EEE38796.1| glutamate/glutamine/aspartate/asparagine ABC transporter,
           periplasmic substrate-binding protein [Rhodobacteraceae
           bacterium KLH11]
          Length = 346

 Score =  342 bits (878), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 150/314 (47%), Positives = 213/314 (67%), Gaps = 2/314 (0%)

Query: 29  DIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKER 88
           D+K RG L CG++TGLVGFA   ANG W+GFDV  CRA+++A+  D + ++++P   K R
Sbjct: 35  DVKARGKLNCGVSTGLVGFAAPDANGVWQGFDVALCRAVAAAVLGDANAVEFVPTTTKTR 94

Query: 89  FLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASI 148
           F AL S +ID+LSRNT WT  R+  L   F  + Y+DGQGF++ K  G+ S  +L GA +
Sbjct: 95  FTALASGEIDMLSRNTTWTYSRDADLKFEFTGVNYYDGQGFMVPKALGVGSAKELDGARV 154

Query: 149 CVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTN 208
           C+Q GTTTEL LAD+F+++N+ Y P+  E   E    Y A  CD YT D SAL + + T 
Sbjct: 155 CIQTGTTTELNLADFFRSNNISYEPVPIETNAEAQQQYLAGACDVYTTDASALASTRATF 214

Query: 209 DRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDT 268
           + P EH++LP+IISK PL P +  G+ EW ++V WT  A++TAEELG+T  NI+++S  +
Sbjct: 215 ENPDEHILLPEIISKEPLGPLVRHGENEWGDVVRWTLNALITAEELGVTSANIDEMSAGS 274

Query: 269 TNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNA 328
            NP+V R LG +   N+GE +GL  DW  R I+  GNYGE+F +N+G ++ + + RG NA
Sbjct: 275 NNPEVDRLLGTE--GNLGEMMGLDADWAARAIKAGGNYGELFAKNIGEETPIGLARGLNA 332

Query: 329 LWSKGGLMYAPPIR 342
            W++GGL+Y+PP R
Sbjct: 333 QWTEGGLLYSPPFR 346


>gi|88797541|ref|ZP_01113130.1| ABC-type amino acid transport/signal transduction systems,
           periplasmic component/domain [Reinekea sp. MED297]
 gi|88779713|gb|EAR10899.1| ABC-type amino acid transport/signal transduction systems,
           periplasmic component/domain [Reinekea sp. MED297]
          Length = 331

 Score =  342 bits (877), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 156/318 (49%), Positives = 219/318 (68%), Gaps = 3/318 (0%)

Query: 24  ASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPL 83
           AS L D++K GFLKCG++TG+ GF+    NG+W G DVD CRA+++A+  +  K++Y+PL
Sbjct: 16  ASTLNDVRKTGFLKCGVSTGIPGFSNPDRNGNWTGLDVDVCRAVAAAVLGNAEKVRYIPL 75

Query: 84  NAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQL 143
              +RF ALQS +ID+LSR T WT  R+ +L + F  ++++DGQGF++ +  GI S  +L
Sbjct: 76  TPGDRFNALQSGEIDVLSRITTWTHSRDTTLDIIFAGVSFYDGQGFMVREDAGIRSPQEL 135

Query: 144 SGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYA 203
            GA+ICVQ GTTTE  LADYF+ H ++Y P+ F   +     ++A RC A T D S LYA
Sbjct: 136 DGAAICVQKGTTTEQNLADYFREHGLRYQPVSFTSSDRAINGFKAGRCSAVTSDRSQLYA 195

Query: 204 LKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQ 263
            +   D PS   ILP +ISK PL PA+ Q D +WYNIV W  +A+V AEELG+T  N+++
Sbjct: 196 QRTKLDDPSSARILPTVISKEPLGPAVRQDDMQWYNIVKWCLFALVNAEELGVTSANVDE 255

Query: 264 VSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIP 323
           + K +  P VQR LG++  S+ G A+GL  DW Y II  +GNY E++D N+G  SEL+I 
Sbjct: 256 MRK-SNKPVVQRLLGVN--SDTGRAMGLASDWGYNIISQVGNYQEIYDGNVGKDSELEID 312

Query: 324 RGYNALWSKGGLMYAPPI 341
           RG N+LWSKGG+++APP+
Sbjct: 313 RGLNSLWSKGGILFAPPL 330


>gi|239815922|ref|YP_002944832.1| extracellular solute-binding protein family 3 [Variovorax paradoxus
           S110]
 gi|239802499|gb|ACS19566.1| extracellular solute-binding protein family 3 [Variovorax paradoxus
           S110]
          Length = 344

 Score =  342 bits (877), Expect = 5e-92,   Method: Compositional matrix adjust.
 Identities = 154/317 (48%), Positives = 220/317 (69%), Gaps = 3/317 (0%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           L  +K+RG +KCG+  G+ GF+     G+W G DVD CRA+++A+  DP K+ ++PLN++
Sbjct: 30  LDAVKQRGTVKCGVTNGVAGFSAPDTQGNWSGLDVDTCRAIAAAVLGDPKKVDFVPLNSQ 89

Query: 87  ERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGA 146
           +RF ALQ+ +IDIL+RNT WTL R+ SLG  F  ITY+DGQGF++ KK  ++S  QL  A
Sbjct: 90  QRFSALQAGEIDILARNTTWTLTRDASLGFNFTTITYYDGQGFLVPKKLKVTSAKQLKNA 149

Query: 147 SICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKL 206
           +IC Q+GTT E  ++DYF+A N+    +VFE  E    A+ + RC A+T D SAL  L+ 
Sbjct: 150 TICTQSGTTNEKNVSDYFRAQNIPVKTVVFESFEASFKAFFSGRCQAFTTDASALAGLRN 209

Query: 207 TN-DRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVS 265
                P ++VILP++ISK PLAP + +GD EW+ I  W   A++ AEE G+TQ N +++ 
Sbjct: 210 KEAPNPDDYVILPELISKEPLAPLVRRGDDEWFAIAKWVPNALIEAEEFGVTQANADELK 269

Query: 266 KDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRG 325
             + +P  QR LG     ++G+ LGL KDW++R I+ +GNYGEMF+RN+G +S LK+PRG
Sbjct: 270 AGSKDPAQQRLLGA--GEDLGKLLGLDKDWSFRAIKAVGNYGEMFERNVGPKSVLKLPRG 327

Query: 326 YNALWSKGGLMYAPPIR 342
            N LW+KGGL+YAPP+R
Sbjct: 328 SNNLWNKGGLIYAPPVR 344


>gi|218691562|ref|YP_002399774.1| amino-acid ABC transporter periplasmic-binding protein [Escherichia
           coli ED1a]
 gi|218429126|emb|CAR10069.2| amino-acid transporter subunit ; periplasmic-binding component of
           ABC superfamily [Escherichia coli ED1a]
          Length = 305

 Score =  342 bits (877), Expect = 5e-92,   Method: Compositional matrix adjust.
 Identities = 149/307 (48%), Positives = 216/307 (70%), Gaps = 2/307 (0%)

Query: 36  LKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSK 95
           ++CGI+ GL GF+   A+G + G DVD CR +++A+F D +K++Y PL AKERF ALQS 
Sbjct: 1   MQCGISDGLPGFSYADADGKFSGIDVDVCRGVAAAVFGDDTKVKYTPLTAKERFTALQSG 60

Query: 96  QIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTT 155
           ++D+LSRNT WT  R+  +G+AF  +TY+DG GF+ H K G+ S  +L GA++C+QAGT 
Sbjct: 61  EVDLLSRNTTWTSSRDAGMGMAFTGVTYYDGIGFLTHDKAGLKSAKELDGATVCIQAGTD 120

Query: 156 TELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHV 215
           TEL +ADYFKA+NMKY P+ F+R +E   A  + RCD    D S LYAL++    P+E +
Sbjct: 121 TELNVADYFKANNMKYTPVTFDRSDESAKALESGRCDTLASDQSQLYALRIKLSNPTEWI 180

Query: 216 ILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQR 275
           +LP++ISK PL P + +GD EW++IV WT +AM+ AEE+GI  +N+++ + +   PD+  
Sbjct: 181 VLPEVISKEPLGPVVRRGDDEWFSIVRWTLFAMLNAEEMGINSQNVDEKAANPATPDMAH 240

Query: 276 FLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGL 335
            LG  K  + G+ L L   W + II+ +GNY E+F+RN+G++S LKI RG N LW+ GG+
Sbjct: 241 LLG--KEGDYGKDLKLDNKWAFNIIKQVGNYSEIFERNVGSESPLKIKRGQNNLWNNGGI 298

Query: 336 MYAPPIR 342
            YAPP+R
Sbjct: 299 QYAPPVR 305


>gi|218560337|ref|YP_002393250.1| amino-acid transporter subunit ; periplasmic-binding component of
           ABC superfamily [Escherichia coli S88]
 gi|218367106|emb|CAR04880.1| amino-acid transporter subunit ; periplasmic-binding component of
           ABC superfamily [Escherichia coli S88]
          Length = 305

 Score =  342 bits (876), Expect = 6e-92,   Method: Compositional matrix adjust.
 Identities = 149/307 (48%), Positives = 216/307 (70%), Gaps = 2/307 (0%)

Query: 36  LKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSK 95
           ++CGI+ GL GF+   A+G + G DVD CR +++A+F D +K++Y PL AKERF ALQS 
Sbjct: 1   MQCGISDGLPGFSYADADGKFSGIDVDVCRGVAAAVFGDDTKVKYTPLTAKERFTALQSG 60

Query: 96  QIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTT 155
           ++D+LSRNT WT  R+  +G+AF  +TY+DG GF+ H K G+ S  +L GA++C+QAGT 
Sbjct: 61  EVDLLSRNTTWTSSRDAGMGMAFTGVTYYDGIGFLTHDKAGLKSAKELDGATVCIQAGTD 120

Query: 156 TELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHV 215
           TEL +ADYFKA+NMKY P+ F+R +E   A  + RCD    D S LYAL++    P+E +
Sbjct: 121 TELNVADYFKANNMKYTPVTFDRSDESAKALESGRCDTLASDQSQLYALRIKLSNPAEWI 180

Query: 216 ILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQR 275
           +LP++ISK PL P + +GD EW++IV WT +AM+ AEE+GI  +N+++ + +   PD+  
Sbjct: 181 VLPEVISKEPLGPVVRRGDDEWFSIVRWTLFAMLNAEEMGINSQNVDEKAANPATPDMAH 240

Query: 276 FLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGL 335
            LG  K  + G+ L L   W + II+ +GNY E+F+RN+G++S LKI RG N LW+ GG+
Sbjct: 241 LLG--KEGDYGKDLKLDNKWAFNIIKQVGNYSEIFERNVGSESPLKIKRGQNNLWNNGGI 298

Query: 336 MYAPPIR 342
            YAPP+R
Sbjct: 299 QYAPPVR 305


>gi|119897622|ref|YP_932835.1| putative amino acid-binding protein [Azoarcus sp. BH72]
 gi|119670035|emb|CAL93948.1| putative amino acid-binding protein [Azoarcus sp. BH72]
          Length = 344

 Score =  342 bits (876), Expect = 6e-92,   Method: Compositional matrix adjust.
 Identities = 159/332 (47%), Positives = 229/332 (68%), Gaps = 8/332 (2%)

Query: 16  FFTSFSTNAS----ILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAI 71
           F  + S  A+     L  IK++G L CG+++G+ GF+   + G+W G DVD CRAL++A+
Sbjct: 16  FAATLSATAAHAGATLDQIKRKGELACGVSSGVPGFSATDSRGNWSGLDVDVCRALAAAV 75

Query: 72  FDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIM 131
             D +K++++PL +++RF ALQ+ ++DILSRNT WTL R+ SLGLAF  ITY+DGQGF++
Sbjct: 76  LGDANKVKWVPLGSQQRFSALQAGEVDILSRNTTWTLTRDASLGLAFTAITYYDGQGFLV 135

Query: 132 HKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRC 191
            K   ++S  QL  A ICVQ+GTTTE  LADYF+   ++  P+VFE+ +    A+   RC
Sbjct: 136 PKSIKVTSAKQLRDAEICVQSGTTTEKNLADYFRRQGIRVKPVVFEKFDASLKAFFNGRC 195

Query: 192 DAYTGDISALYALKLTN-DRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVT 250
            AYT D S+L  ++     +P +++ILP+ ISK PL P + +GD EW+ IV W  YA++ 
Sbjct: 196 VAYTTDASSLAGIRAGEAPKPDDYLILPETISKEPLGPIVRRGDDEWFTIVKWVVYALIE 255

Query: 251 AEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMF 310
           AEELG+T+ N ++ +    +P V R LG  K+ ++G+ LGL   W YR +R +GNYGE+F
Sbjct: 256 AEELGVTRDNADKQAAG-GDPAVGRLLG--KTEDLGKPLGLDAQWAYRAVRAVGNYGEVF 312

Query: 311 DRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           +RNLG  S L++PRG NALWS+GGLMYAPP+R
Sbjct: 313 ERNLGAGSPLRLPRGQNALWSQGGLMYAPPLR 344


>gi|296536584|ref|ZP_06898665.1| ABC superfamily ATP binding cassette transporter, amino acid
           binding protein [Roseomonas cervicalis ATCC 49957]
 gi|296263094|gb|EFH09638.1| ABC superfamily ATP binding cassette transporter, amino acid
           binding protein [Roseomonas cervicalis ATCC 49957]
          Length = 323

 Score =  341 bits (875), Expect = 9e-92,   Method: Compositional matrix adjust.
 Identities = 154/320 (48%), Positives = 221/320 (69%), Gaps = 7/320 (2%)

Query: 24  ASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPL 83
           A  LG I+ RG + CG+    +GFA   + G ++G D D+CRAL+ A+F D  K +++P 
Sbjct: 10  ADTLGAIRARGHVLCGVTPNTIGFAAPDSQGVFRGLDADYCRALAVAVFGDADKARFVPT 69

Query: 84  NAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQL 143
            A +RF ALQS ++D+L R T WTL RE +LG  F  + ++DG GF++ +  G+ S  QL
Sbjct: 70  TAPQRFPALQSGEVDVLIRTTTWTLSREAALGFVFAGVNFYDGNGFMVRRALGVQSARQL 129

Query: 144 SGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYA 203
            GAS+C+Q G+TTEL + DYF+AH M+ +P+ +E VEEI  A+ A RCD Y+ D S L A
Sbjct: 130 DGASVCLQQGSTTELNVTDYFRAHGMRLNPVTYENVEEIRTAFAAGRCDVYSSDTSTLAA 189

Query: 204 LKLTNDRPSEH-VILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNIN 262
            +      ++  V+LP+IISK PL PA+ +GD  W++IV WTH+A++TAEELGITQ N+ 
Sbjct: 190 FRAGQGAAADQFVLLPEIISKEPLGPAVRKGDARWFDIVRWTHFALLTAEELGITQANLA 249

Query: 263 QVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKI 322
           + + D+T+PDVQRFLG  +S ++G  LGL  DW  RI+  +GN+GEM++RN+   + + I
Sbjct: 250 RFA-DSTSPDVQRFLG--RSGDLGRMLGLQPDWAARIVGQLGNFGEMWERNI---TPMGI 303

Query: 323 PRGYNALWSKGGLMYAPPIR 342
            RG NALW++GGL YAPP+R
Sbjct: 304 QRGINALWTQGGLQYAPPMR 323


>gi|255264624|ref|ZP_05343966.1| glutamate/glutamine/aspartate/asparagine-binding protein
           bztAprecursor [Thalassiobium sp. R2A62]
 gi|255106959|gb|EET49633.1| glutamate/glutamine/aspartate/asparagine-binding protein
           bztAprecursor [Thalassiobium sp. R2A62]
          Length = 338

 Score =  341 bits (875), Expect = 9e-92,   Method: Compositional matrix adjust.
 Identities = 154/342 (45%), Positives = 220/342 (64%), Gaps = 4/342 (1%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           M K  F+    L +    +  + A+ L D+K RG L CG+ TGLVGFA   A+G+W+GFD
Sbjct: 1   MKKSVFLG--ALTVAGLAAGMSAAATLDDVKARGTLNCGVTTGLVGFAAPDASGEWEGFD 58

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
           V  CRA+++A+  D + ++++P   K RF AL S +ID+L+RNT WT  R++ L   F  
Sbjct: 59  VGVCRAVAAAVLGDSNAVEFVPTTGKTRFTALASGEIDMLARNTTWTFSRDVDLKFEFVG 118

Query: 121 ITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVE 180
           + Y+DGQGF+  K+ G+SS   L GA++C+Q GTTTEL LAD+F+A+N+ Y P+  E   
Sbjct: 119 VNYYDGQGFMAPKELGVSSAKDLDGATVCIQTGTTTELNLADFFRANNISYEPVPIETNA 178

Query: 181 EIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNI 240
           E    Y A  CD +T D S L A + T + P +HV+LP+I+SK PL P +  GD EW +I
Sbjct: 179 EAQQQYLAGACDVFTTDASGLAATRATFENPGDHVLLPEIVSKEPLGPLVRHGDNEWGDI 238

Query: 241 VSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRII 300
           V WT  A++TAEELG+T  NI ++S  T NP+V R LG +    +G  LGL   W    I
Sbjct: 239 VRWTLNALITAEELGVTSANIGELSAGTNNPEVNRLLGTE--GELGGMLGLDAAWAKNAI 296

Query: 301 RHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
              GNYGE+F++N+G  + + + RG NA+W++GGL+Y+PP R
Sbjct: 297 MAGGNYGEIFEKNIGENTPIGLARGLNAMWTEGGLIYSPPFR 338


>gi|296387623|ref|ZP_06877098.1| putative amino acid-binding protein [Pseudomonas aeruginosa PAb1]
          Length = 305

 Score =  340 bits (873), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 150/307 (48%), Positives = 218/307 (71%), Gaps = 2/307 (0%)

Query: 36  LKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSK 95
           ++CG++ GL GF+   A G +KG DVD CRAL++A+F D  K+++ PL+A ERF ALQS 
Sbjct: 1   MQCGVSDGLPGFSYADAKGRFKGLDVDICRALAAALFGDAEKVRFTPLSATERFSALQSG 60

Query: 96  QIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTT 155
            +D+LSRNT WT  R+ +LG+ F  +TYFDGQGF++++K G+SS  +L   ++C+Q+GTT
Sbjct: 61  TVDLLSRNTSWTSSRDTALGIHFTGVTYFDGQGFLVNRKLGVSSARELKDTTVCIQSGTT 120

Query: 156 TELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHV 215
            EL +ADYF+AH ++Y  ++ +  E+   A  A +CD  + D S LYA +L   +P ++V
Sbjct: 121 NELNVADYFRAHGIRYKAVLDDSYEKSARALEAGQCDVLSSDQSQLYAQRLKLAKPEQYV 180

Query: 216 ILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQR 275
           +LP++ISK PL PA+ QGD  W+NIV WT Y ++ AEELG+T  N+ + ++D+ NPDV R
Sbjct: 181 VLPEVISKEPLGPAVRQGDEAWFNIVRWTLYGLLNAEELGVTSSNVERQARDSRNPDVAR 240

Query: 276 FLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGL 335
            LG     + G+ L L +DW  +++R +GNYGE+F RN+G+ S LK+PRG NA W+ GGL
Sbjct: 241 LLG--SEGDAGKDLQLPRDWVVQMVRQVGNYGEIFARNVGDGSPLKMPRGLNAQWNLGGL 298

Query: 336 MYAPPIR 342
            YAPPIR
Sbjct: 299 HYAPPIR 305


>gi|312959110|ref|ZP_07773629.1| extracellular solute-binding protein, family 3 [Pseudomonas
           fluorescens WH6]
 gi|311286880|gb|EFQ65442.1| extracellular solute-binding protein, family 3 [Pseudomonas
           fluorescens WH6]
          Length = 343

 Score =  340 bits (873), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 159/338 (47%), Positives = 227/338 (67%), Gaps = 4/338 (1%)

Query: 7   VSILCLI-ILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCR 65
           ++I+C   +L  + F+   + L  ++K+GF++CG++ GL GF+   A+G   G D D CR
Sbjct: 8   LAIVCAAAVLGVSGFAQAGATLDAVQKKGFVQCGVSDGLPGFSVPDASGKILGIDADVCR 67

Query: 66  ALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP-ITYF 124
           A+++A+F D +K+++  LNAKERF ALQS ++DILSRNT  T  R+  +GL F   ITY+
Sbjct: 68  AVAAAVFGDATKVKFSQLNAKERFTALQSGEVDILSRNTTMTSSRDAGMGLKFPGFITYY 127

Query: 125 DGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDA 184
           DG GF+++ K G+ S  +L GA+IC+QAGTTTEL ++DYF+ + +KY PI F+  +E   
Sbjct: 128 DGIGFLVNNKLGVKSAKELDGATICIQAGTTTELNVSDYFRGNGLKYTPITFDTSDESAK 187

Query: 185 AYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWT 244
           +  + RCD  T D S L+A +     P ++V+LP+ ISK PL P +  GD EW  IV W 
Sbjct: 188 SLESGRCDVLTSDKSQLFAQRSKLASPKDYVVLPETISKEPLGPVVRNGDDEWLAIVRWV 247

Query: 245 HYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMG 304
            YAM+ AEE GIT KN+   +K T NPDV R LG D     G+ L + KDW  +I++ +G
Sbjct: 248 GYAMLNAEEAGITSKNVEAEAKSTKNPDVARLLGAD--GEYGKDLKVKKDWVVQIVKQVG 305

Query: 305 NYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           NYGE+F+RNLG  + L+I RG NALW+KGG+ YAPP+R
Sbjct: 306 NYGEVFERNLGKSTPLEIDRGLNALWNKGGIQYAPPVR 343


>gi|87121084|ref|ZP_01076975.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Marinomonas sp. MED121]
 gi|86163576|gb|EAQ64850.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Marinomonas sp. MED121]
          Length = 340

 Score =  340 bits (873), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 149/334 (44%), Positives = 222/334 (66%), Gaps = 2/334 (0%)

Query: 9   ILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALS 68
           I    +    S    A  L D+K +GF++CG++ G+ GF+   +NG+W G DVD CRA +
Sbjct: 9   ISTAAVALTVSAGATAGTLDDVKAKGFIQCGVSQGVPGFSNADSNGNWTGIDVDACRAAA 68

Query: 69  SAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQG 128
           +A+F D  K+++ PL+AKERF ALQS +ID+LSRNT WT  R+ SLGL F  + ++DGQG
Sbjct: 69  AAVFGDAQKVKFTPLSAKERFTALQSGEIDVLSRNTTWTYTRDTSLGLDFTAVNFYDGQG 128

Query: 129 FIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRA 188
           F++ K  G+ S  +L GA++C + GTTTEL +AD+F+ H ++Y P+V ++ +E  AAY +
Sbjct: 129 FMVRKDLGVDSALELDGATVCTEQGTTTELNMADFFRKHQLEYVPVVVQKADEALAAYAS 188

Query: 189 HRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAM 248
            RCD +T D S L A +      S HVIL + ISK PL P +  GD +W +IV+W  +  
Sbjct: 189 GRCDVFTTDKSGLAAHRSKLADSSAHVILDETISKEPLGPVVRHGDNQWKDIVTWAMFVQ 248

Query: 249 VTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGE 308
           V AEE+GI+  N+ ++  +T +P ++R LG +   ++G  L L  DW Y +I  +GNYGE
Sbjct: 249 VNAEEMGISSSNVAKIKAETKDPGIRRLLGAE--GDMGAQLSLPADWAYNVIAQVGNYGE 306

Query: 309 MFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           +F+RN+G  + + +PRG N LW++GG+MYAPP+R
Sbjct: 307 VFERNVGPSTPVGLPRGINKLWTEGGVMYAPPVR 340


>gi|330811534|ref|YP_004355996.1| Putative amino acid ABC transporter, periplasmic component
           [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
 gi|327379642|gb|AEA70992.1| Putative amino acid ABC transporter, periplasmic component
           [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
          Length = 343

 Score =  340 bits (873), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 158/343 (46%), Positives = 225/343 (65%), Gaps = 3/343 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           + K     +    +L  + F+   + L  ++K+GF++CG++ GL GF+   + G   G D
Sbjct: 3   LLKSTLAVMTAAAVLGVSGFAQAGATLDAVQKKGFVQCGVSDGLPGFSVPDSTGKIVGID 62

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
            DFCRA+++A+F D +K+++  LNAKERF ALQS +ID+LSRN+  T  R+  +GL F  
Sbjct: 63  ADFCRAVAAAVFGDATKVKFSQLNAKERFTALQSGEIDMLSRNSTMTSSRDAGMGLKFPG 122

Query: 121 -ITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERV 179
            ITY+DG GF+ + K G+ S  +L GA+IC+QAGTTTEL ++DYF+A+ +KY PI F+  
Sbjct: 123 FITYYDGIGFLANNKLGVKSAKELDGATICIQAGTTTELNVSDYFRANGLKYTPITFDTS 182

Query: 180 EEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYN 239
           +E   +  + RCD  T D S L+A +     P ++V+LP+ ISK PL P +  GD EW  
Sbjct: 183 DESAKSLESGRCDVLTSDKSQLFAQRSKLASPKDYVVLPETISKEPLGPVVRNGDDEWLA 242

Query: 240 IVSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRI 299
           IV WT YA++ AEE G+T KN+   +K T NPDV R LG D     G+ L L KDW  +I
Sbjct: 243 IVRWTGYALLNAEEAGVTSKNVEAEAKSTKNPDVARMLGAD--GEYGKDLKLPKDWVVQI 300

Query: 300 IRHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           ++ +GNYGEMF+RNLG  + L+I RG NALW+ GG+ YAPP+R
Sbjct: 301 VKQVGNYGEMFERNLGKGTPLEIDRGLNALWNAGGIQYAPPVR 343


>gi|56695433|ref|YP_165781.1| glutamate/glutamine/aspartate/asparagine ABC transporter,
           periplasmic substrate-binding protein [Ruegeria pomeroyi
           DSS-3]
 gi|56677170|gb|AAV93836.1| glutamate/glutamine/aspartate/asparagine ABC transporter,
           periplasmic substrate-binding protein [Ruegeria pomeroyi
           DSS-3]
          Length = 380

 Score =  340 bits (873), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 150/314 (47%), Positives = 213/314 (67%), Gaps = 2/314 (0%)

Query: 29  DIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKER 88
           D+K RG L CG+ TGLVGFA   +NG+WKGFDV  CRA+++A+  D + ++++P   K R
Sbjct: 69  DVKARGKLNCGVTTGLVGFAAPDSNGEWKGFDVALCRAVAAAVLGDGNAVEFVPTTGKTR 128

Query: 89  FLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASI 148
           F AL S ++D+L+RNT WT  R++ L   F  + Y+DGQGF++ K  G+SS  +L GA++
Sbjct: 129 FTALASGEVDMLARNTTWTFSRDVDLKFEFVGVNYYDGQGFMVPKSLGVSSAKELDGATV 188

Query: 149 CVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTN 208
           C+Q GTTTEL LAD+F+A+N+ Y P+  E   E    Y A  CD YT D S L A + T 
Sbjct: 189 CIQTGTTTELNLADFFRANNISYEPVPIETNAEAQQQYLAGACDVYTTDASGLAATRATF 248

Query: 209 DRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDT 268
           + P +HV+LP+IISK PL P +  GD EW ++V WT  A+V+AEE+GIT  NI+++S  T
Sbjct: 249 ENPGDHVLLPEIISKEPLGPLVRHGDHEWGDVVRWTLNALVSAEEMGITSANIDEMSAGT 308

Query: 269 TNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNA 328
            NP++ R LG + +  +GE LGL  +W  R I+  GNYGE+F +N+G  + + + RG NA
Sbjct: 309 NNPEINRILGSEGT--LGEMLGLDAEWAKRAIKVGGNYGEVFAQNIGESTPIGLARGLNA 366

Query: 329 LWSKGGLMYAPPIR 342
            W+ GGL+Y+PP R
Sbjct: 367 QWTDGGLLYSPPFR 380


>gi|149913099|ref|ZP_01901633.1| hypothetical protein RAZWK3B_03885 [Roseobacter sp. AzwK-3b]
 gi|149813505|gb|EDM73331.1| hypothetical protein RAZWK3B_03885 [Roseobacter sp. AzwK-3b]
          Length = 338

 Score =  340 bits (872), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 149/316 (47%), Positives = 211/316 (66%), Gaps = 2/316 (0%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           L D+K RG L CG+ TGLVGFA   ANG+W+GFDV  CRA+++A+  DP+ ++++P   K
Sbjct: 25  LDDVKARGKLNCGVTTGLVGFAAPDANGEWQGFDVGVCRAVAAAVLGDPTAVEFVPTTGK 84

Query: 87  ERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGA 146
            RF AL S +ID+L+RNT WT  R++ L   F  I Y+DGQGF++ K  G++S  +L GA
Sbjct: 85  TRFTALASGEIDLLARNTTWTFSRDVDLKFEFVGINYYDGQGFMVPKSLGVTSAKELDGA 144

Query: 147 SICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKL 206
           ++C+Q GTTTEL LAD+F+ +N+ Y P+  E   E    Y    CD YT D S L A + 
Sbjct: 145 TVCIQTGTTTELNLADFFRVNNISYEPVPIETNAEAQPLYLEGACDVYTTDASGLAATRA 204

Query: 207 TNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSK 266
             + PSEHVILP+IISK PL P +  GD+EW +I  WT  A++ AEE G+T  N+ +++ 
Sbjct: 205 AFETPSEHVILPEIISKEPLGPLVRHGDSEWGDIARWTLNALIAAEEYGVTSANVAELAN 264

Query: 267 DTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGY 326
            T NP++ R LG + +  +GE LGL  +W  R I   GNYGE+F++N+G  + + + RG 
Sbjct: 265 GTDNPEINRLLGTEGT--LGEMLGLDAEWAKRAIMAGGNYGELFEKNIGENTPIGLSRGL 322

Query: 327 NALWSKGGLMYAPPIR 342
           NA W++GGL+Y+PP R
Sbjct: 323 NAQWTEGGLLYSPPFR 338


>gi|209966385|ref|YP_002299300.1| general L-amino acid-binding periplasmic protein AapJ
           [Rhodospirillum centenum SW]
 gi|209959851|gb|ACJ00488.1| general L-amino acid-binding periplasmic protein AapJ
           [Rhodospirillum centenum SW]
          Length = 353

 Score =  340 bits (871), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 159/319 (49%), Positives = 223/319 (69%), Gaps = 5/319 (1%)

Query: 25  SILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLN 84
           S L  IK+RG L+CG+NTGL GF+   + G W G DVD C+A+++A   D  K+ Y PL+
Sbjct: 39  STLDQIKQRGVLRCGVNTGLAGFSTPDSQGRWTGLDVDVCKAIAAAALGDAGKVHYAPLS 98

Query: 85  AKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLS 144
           A++R  ALQS ++DILSRNT W+L R+   G+ F P+ Y+DGQGF++ K  G++S  QL 
Sbjct: 99  AQQRLTALQSGEVDILSRNTTWSLSRDTQ-GMNFGPVVYYDGQGFMVPKALGVTSAKQLD 157

Query: 145 GASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISAL-YA 203
           GA++CVQ GTTTEL LADYF A+ M + P+V E  +E+ AA+ + RCD +T D S L   
Sbjct: 158 GATVCVQTGTTTELNLADYFAANRMSFKPVVIESFDEVVAAFFSGRCDVFTTDGSQLASV 217

Query: 204 LKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQ 263
             ++   P ++VILP+IISK PLAP +  GD +W++IV WT YA++ AEE GIT  N+++
Sbjct: 218 RAVSAAAPDDYVILPEIISKEPLAPVVRHGDDQWFDIVKWTVYALLEAEEKGITAANVDE 277

Query: 264 VSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIP 323
             K + +P VQR LG+     +G++LGL   W YR I+ +GNYGE+F+RN+G  + L++ 
Sbjct: 278 -KKKSADPTVQRLLGV--QPGMGQSLGLDDAWAYRAIKAVGNYGEVFERNVGKATPLRLE 334

Query: 324 RGYNALWSKGGLMYAPPIR 342
           RG NALW+ GGLMYAPP+R
Sbjct: 335 RGLNALWTNGGLMYAPPVR 353


>gi|82778575|ref|YP_404924.1| putative periplasmic binding transport protein [Shigella
           dysenteriae Sd197]
 gi|81242723|gb|ABB63433.1| putative periplasmic binding transport protein [Shigella
           dysenteriae Sd197]
          Length = 305

 Score =  340 bits (871), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 149/307 (48%), Positives = 215/307 (70%), Gaps = 2/307 (0%)

Query: 36  LKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSK 95
           ++CGI+ GL  F+   A+G + G DVD CR +++A+F D +K++Y PL AKERF ALQS 
Sbjct: 1   MQCGISDGLPRFSYADADGKFSGIDVDVCRGVAAAVFGDNTKVKYTPLTAKERFTALQSG 60

Query: 96  QIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTT 155
           ++D+LSRNT WT  R+  +G+AF  +TY+DG GF+ H K G+ S  +L GA++C+QAGT 
Sbjct: 61  EVDLLSRNTTWTSSRDAGMGMAFTGVTYYDGIGFLTHDKAGLKSAKELDGATVCIQAGTD 120

Query: 156 TELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHV 215
           TEL +ADYFKA+NMKY P+ F+R +E   A  + RCD    D S LYAL++    P+E +
Sbjct: 121 TELNVADYFKANNMKYTPVTFDRSDESAKALESGRCDTLASDQSQLYALRIKLSNPAEWI 180

Query: 216 ILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQR 275
           +LP++ISK PL P + +GD EW++IV WT +AM+ AEE+GI  +N+++ + +   PD+  
Sbjct: 181 VLPEVISKEPLGPVVRRGDDEWFSIVRWTLFAMLNAEEMGINSQNVDEKAANPATPDMAH 240

Query: 276 FLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGL 335
            LG  K  + G+ L L   W Y II+ +GNY E+F+RN+G++S LKI RG N LW+ GG+
Sbjct: 241 LLG--KEGDYGKDLKLDNKWAYNIIKQVGNYSEIFERNVGSESPLKIKRGQNNLWNNGGI 298

Query: 336 MYAPPIR 342
            YAPP+R
Sbjct: 299 QYAPPVR 305


>gi|291619131|ref|YP_003521873.1| YhdW [Pantoea ananatis LMG 20103]
 gi|291154161|gb|ADD78745.1| YhdW [Pantoea ananatis LMG 20103]
 gi|327395461|dbj|BAK12883.1| putative amino-acid ABC transporter-binding protein YhdW precursor
           [Pantoea ananatis AJ13355]
          Length = 349

 Score =  340 bits (871), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 152/316 (48%), Positives = 218/316 (68%), Gaps = 2/316 (0%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           L  IKK+GF++CGI+ GL GF+   A+G + G DVD CRA ++A+F D +K++Y PL AK
Sbjct: 36  LDAIKKKGFIQCGISDGLPGFSYADASGKFTGLDVDICRAAAAAVFGDATKVKYTPLTAK 95

Query: 87  ERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGA 146
           ERF ALQS ++D+LSRNT WT  R+  +G  F  + Y+DG GF+ HKK G+ S  +L GA
Sbjct: 96  ERFTALQSGEVDVLSRNTTWTSSRDGGMGFMFTGVNYYDGIGFLTHKKAGLKSAKELDGA 155

Query: 147 SICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKL 206
           ++C+QAGT TEL +AD+FKA+ M+Y P+ F+R +E   A  + RCD    D S LYAL++
Sbjct: 156 TVCIQAGTDTELNVADFFKANKMQYTPVTFDRSDESAKALDSGRCDTLASDQSQLYALRI 215

Query: 207 TNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSK 266
              +P + ++LP++ISK PL P + +GD +W+ IV W+ +AM+ AEE+GI  KN+++++ 
Sbjct: 216 KLGKPDDFIVLPEVISKEPLGPLVRRGDDDWFTIVKWSLFAMLNAEEMGINSKNVDEMTA 275

Query: 267 DTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGY 326
               PD+   LG +   + G+ L L   W Y II+ +GNY E FDRN+G  S LKI RG 
Sbjct: 276 KPATPDMAHLLGAE--GDFGKDLKLDNKWAYNIIKQVGNYQESFDRNVGKDSPLKIARGQ 333

Query: 327 NALWSKGGLMYAPPIR 342
           NALW++GG+ YAPP+R
Sbjct: 334 NALWNQGGIQYAPPVR 349


>gi|74313796|ref|YP_312215.1| putative periplasmic binding transport protein [Shigella sonnei
           Ss046]
 gi|73857273|gb|AAZ89980.1| putative periplasmic binding transport protein [Shigella sonnei
           Ss046]
          Length = 305

 Score =  340 bits (871), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 149/307 (48%), Positives = 215/307 (70%), Gaps = 2/307 (0%)

Query: 36  LKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSK 95
           ++CGI+ GL GF+   A+G + G DVD CR +++A+F D +K++Y PL AKERF ALQS 
Sbjct: 1   MQCGISDGLPGFSYADADGKFSGIDVDVCRGVAAAVFGDDTKVKYTPLTAKERFTALQSG 60

Query: 96  QIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTT 155
           ++D+LSRNT WT  R+  +G+AF  +T +DG GF+ H K G+ S  +L GA++C+QAGT 
Sbjct: 61  EVDLLSRNTTWTSSRDAGMGMAFTGVTDYDGIGFLTHDKAGLKSAKELDGATVCIQAGTD 120

Query: 156 TELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHV 215
           TEL +ADYFKA+NMKY P+ F+R +E   A  + RCD    D S LYAL++    P+E +
Sbjct: 121 TELNVADYFKANNMKYTPVTFDRSDESAKALESGRCDTLASDQSQLYALRIKLSNPAEWI 180

Query: 216 ILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQR 275
           +LP++ISK PL P + +GD EW++IV WT +AM+ AEE+GI  +N+++ + +   PD+  
Sbjct: 181 VLPEVISKEPLGPVVRRGDDEWFSIVRWTLFAMLNAEEMGINSQNVDEKAANPATPDMAH 240

Query: 276 FLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGL 335
            LG  K  + G+ L L   W Y II+ +GNY E+F+RN+G++S LKI RG N LW+ GG+
Sbjct: 241 LLG--KEGDYGKDLKLDNKWAYNIIKQVGNYSEIFERNVGSESPLKIKRGQNNLWNNGGI 298

Query: 336 MYAPPIR 342
            YAPP+R
Sbjct: 299 QYAPPVR 305


>gi|229588541|ref|YP_002870660.1| putative amino acid ABC transporter substrate-binding protein
           [Pseudomonas fluorescens SBW25]
 gi|229360407|emb|CAY47264.1| putative amino acid ABC transport system, substrate-binding protein
           [Pseudomonas fluorescens SBW25]
          Length = 343

 Score =  340 bits (871), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 157/330 (47%), Positives = 222/330 (67%), Gaps = 3/330 (0%)

Query: 14  ILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFD 73
           +L  + F+   + L  ++K+GF++CG++ GL GF+   A+G   G D D CRA+++A+F 
Sbjct: 16  VLGVSGFAQAGATLDAVQKKGFVQCGVSDGLPGFSVPDASGKILGIDADVCRAVAAAVFG 75

Query: 74  DPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP-ITYFDGQGFIMH 132
           D +K+++  LNAKERF ALQS ++DILSRNT  T  R+  +GL F   ITY+DG GF+++
Sbjct: 76  DATKVKFSQLNAKERFTALQSGEVDILSRNTTMTSSRDAGMGLKFPGFITYYDGIGFLVN 135

Query: 133 KKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCD 192
            K G+ S  +L GA+IC+QAGTTTEL ++DYF+ +N+KY PI F+  +E   +  + RCD
Sbjct: 136 NKLGVKSAKELDGATICIQAGTTTELNVSDYFRGNNLKYTPITFDTSDESAKSLESGRCD 195

Query: 193 AYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAE 252
             T D S L+A +     P ++V+LP+ ISK PL P +  GD EW  IV W  YAM+ AE
Sbjct: 196 VLTSDKSQLFAQRSKLAAPKDYVVLPETISKEPLGPVVRNGDDEWLAIVRWVGYAMLNAE 255

Query: 253 ELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDR 312
           E GIT KN+   +K T NPDV R LG D     G+ L + KDW  +I++ +GNYGE+F+R
Sbjct: 256 EAGITSKNVEAEAKSTKNPDVARLLGAD--GEYGKDLKVKKDWVVQIVKQVGNYGEVFER 313

Query: 313 NLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           NLG  + L+I RG NALW+ GG+ YAPP+R
Sbjct: 314 NLGKSTPLEIDRGLNALWNNGGIQYAPPVR 343


>gi|89901102|ref|YP_523573.1| extracellular solute-binding protein [Rhodoferax ferrireducens
           T118]
 gi|89345839|gb|ABD70042.1| extracellular solute-binding protein, family 3 [Rhodoferax
           ferrireducens T118]
          Length = 344

 Score =  339 bits (870), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 162/339 (47%), Positives = 221/339 (65%), Gaps = 5/339 (1%)

Query: 6   FVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCR 65
             +++  +  F ++ +     L  IK RG + CG+NTGL GF    + G W G DVD CR
Sbjct: 9   LTAVVATVGAFMSAPAHAGKTLDGIKARGQVVCGVNTGLAGFGAADSAGKWTGLDVDVCR 68

Query: 66  ALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFD 125
           A+++A   D  KI+Y+PLNA++RF ALQS ++D+LSRNT +TL R+ SLGL    +TY+D
Sbjct: 69  AIAAATLGDAEKIKYVPLNAQQRFTALQSGEVDVLSRNTTFTLTRDASLGLHDTAVTYYD 128

Query: 126 GQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAA 185
           GQGF++  K  I S  QL G ++CVQ+GTTTE  L DY KA+ +   P+VFE++E  + A
Sbjct: 129 GQGFMVPVKSKIKSAKQLKGQTVCVQSGTTTEKNLTDYSKANGLNIKPVVFEKLEAAENA 188

Query: 186 YRAHRCDAYTGDISALYAL--KLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSW 243
           Y   RC AYT D S L +   K+  D P EH+ILP++ISK PL P + +GD EW+ IV W
Sbjct: 189 YFTGRCIAYTTDASGLASTRNKVAKD-PKEHIILPELISKEPLGPMVRRGDDEWFAIVKW 247

Query: 244 THYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHM 303
             Y ++ AEE GITQ N+  +   + +P VQR LG  + S  G+ LGL+KDW    I+  
Sbjct: 248 VIYGLLEAEEYGITQANLEGLKATSKDPVVQRILGTSEDS--GKLLGLSKDWMANAIKAT 305

Query: 304 GNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           GNYGE+F+RN+G  S L +PRG N  W+KGGLMYA P+R
Sbjct: 306 GNYGEIFERNVGPNSPLGLPRGVNNQWNKGGLMYAYPVR 344


>gi|320184061|gb|EFW58881.1| Glutamate Aspartate periplasmic binding protein precursor GltI
           [Shigella flexneri CDC 796-83]
          Length = 349

 Score =  339 bits (869), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 154/327 (47%), Positives = 226/327 (69%), Gaps = 10/327 (3%)

Query: 24  ASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDF--------CRALSSAIFDDP 75
            + L  ++K+GF++CGI+ GL+GF+   A+G + G DVD         CR++++A+F D 
Sbjct: 25  GATLDAVQKKGFVQCGISDGLLGFSYADADGKFSGIDVDVDVDVDVDVCRSVAAAVFGDD 84

Query: 76  SKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKK 135
           +K++Y PL AKERF ALQS ++D+LSRNT WT  R+  +G+AF  +TY+DG GF+ H K 
Sbjct: 85  TKVKYTPLTAKERFTALQSGEVDLLSRNTTWTSSRDAGMGMAFTGVTYYDGIGFLTHDKA 144

Query: 136 GISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYT 195
           G+ S  +L GA++C+QAGT TEL +ADYFKA+NMKY P+ F+R +E   A  + RCD   
Sbjct: 145 GLKSAKELDGATVCIQAGTDTELNVADYFKANNMKYTPVTFDRSDESAKALESGRCDTLA 204

Query: 196 GDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELG 255
            D S LYAL++    P+E ++LP++ISK PL P + +GD EW++IV WT +AM+ AEE+G
Sbjct: 205 SDQSQLYALRIKLSNPAEWIVLPEVISKEPLGPVVRRGDDEWFSIVRWTLFAMLNAEEMG 264

Query: 256 ITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLG 315
           I  +N+++ + +   PD+   LG  K  + G+ L L   W Y II+ +GNY E+F+RN+G
Sbjct: 265 INSQNVDEKAANPATPDMAHLLG--KEGDYGKDLKLDNKWAYNIIKQVGNYSEIFERNVG 322

Query: 316 NQSELKIPRGYNALWSKGGLMYAPPIR 342
           ++S LKI RG N LW+ GG+ YAPP+R
Sbjct: 323 SESPLKIKRGQNNLWNNGGIQYAPPVR 349


>gi|262277476|ref|ZP_06055269.1| general L-amino acid-binding periplasmic protein AapJ [alpha
           proteobacterium HIMB114]
 gi|262224579|gb|EEY75038.1| general L-amino acid-binding periplasmic protein AapJ [alpha
           proteobacterium HIMB114]
          Length = 347

 Score =  339 bits (869), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 154/319 (48%), Positives = 220/319 (68%), Gaps = 4/319 (1%)

Query: 25  SILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLN 84
           S L   K +GF+KCG++ G+ GF+   A+G+W G DVD CRA+++A+  D SK++Y  L+
Sbjct: 32  STLDTTKSQGFVKCGVSQGVPGFSNADASGNWTGIDVDVCRAVAAAVLGDASKVKYTGLS 91

Query: 85  AKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQL- 143
           AKERF ALQ+ +IDILSRNT WTL R+ S+GL F  + ++DGQGF++ K  G+ SV+   
Sbjct: 92  AKERFTALQAGEIDILSRNTTWTLERDASIGLTFVGVNFYDGQGFMVRKSTGLKSVNDFK 151

Query: 144 SGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYA 203
           +G  +C   GTTTEL +AD+FK+  +KY P+VFE+ +E+  AY A RCD YT D SAL A
Sbjct: 152 NGVKVCTNLGTTTELNMADFFKSKGVKYEPVVFEKADEVVQAYDAGRCDTYTTDKSALAA 211

Query: 204 LKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQ 263
                  P+EHV+LP+ ISK PL P + QGD++W ++V W+    + AEE G+   NI+ 
Sbjct: 212 QSTKMKDPTEHVVLPETISKEPLGPVVRQGDSKWEDVVRWSLNVFIEAEEYGVNSGNIDS 271

Query: 264 VSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIP 323
           + K++ NP +QR +G + + N GEALGL   W+YRII+ +GNYGE + RNL + + +   
Sbjct: 272 M-KESKNPAIQRIVGAEGTKN-GEALGLDNQWSYRIIKQIGNYGESYKRNLAD-TNIMPE 328

Query: 324 RGYNALWSKGGLMYAPPIR 342
           RG N LW+KGG++Y PP+R
Sbjct: 329 RGPNQLWTKGGILYVPPVR 347


>gi|319793876|ref|YP_004155516.1| extracellular solute-binding protein family 3 [Variovorax paradoxus
           EPS]
 gi|315596339|gb|ADU37405.1| extracellular solute-binding protein family 3 [Variovorax paradoxus
           EPS]
          Length = 344

 Score =  338 bits (867), Expect = 7e-91,   Method: Compositional matrix adjust.
 Identities = 152/342 (44%), Positives = 227/342 (66%), Gaps = 3/342 (0%)

Query: 2   YKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDV 61
           ++   ++   L+     + +     L  +K+RG +KCG+  G+ GF+     G+W G DV
Sbjct: 5   FRPALIAAASLVAFATAAPAFAGKTLDAVKQRGTVKCGVTNGVAGFSAPDTQGNWSGLDV 64

Query: 62  DFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPI 121
           D CRA+++A+  D  K+ ++PLN+++RF ALQ+ +IDIL+RNT WTL R+ SLG  F  I
Sbjct: 65  DTCRAIAAAVLGDAKKVDFVPLNSQQRFSALQAGEIDILARNTTWTLTRDASLGFNFTTI 124

Query: 122 TYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEE 181
           TY+DGQGF++ KK  ++S  QL  A+IC Q+GTT E  ++DYF+A N+    +VFE  E 
Sbjct: 125 TYYDGQGFLVPKKLKVTSAKQLKNATICTQSGTTNEKNVSDYFRAQNIPVKTVVFESFEA 184

Query: 182 IDAAYRAHRCDAYTGDISALYALKLTN-DRPSEHVILPDIISKSPLAPAIIQGDTEWYNI 240
              A+ + RC A+T D SAL  L+      P +++ILP++ISK PLAP + +GD EW+ I
Sbjct: 185 SFKAFFSGRCQAFTTDASALAGLRNKEAPNPDDYIILPELISKEPLAPLVRRGDDEWFAI 244

Query: 241 VSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRII 300
             W   A++ AEE G+TQ N +++   + +P  QR +G     ++G+ LGL KDW++R I
Sbjct: 245 AKWVPNALIEAEEAGVTQANADELKASSKDPAQQRLVGT--GEDLGKLLGLDKDWSFRAI 302

Query: 301 RHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           + +GNYGE+F+RN+G +S LK+PRG N LWSKGGL+YAPP+R
Sbjct: 303 KAVGNYGEVFERNVGPKSVLKLPRGSNNLWSKGGLIYAPPVR 344


>gi|83950493|ref|ZP_00959226.1| glutamate/glutamine/aspartate/asparagine ABC transporter,
           periplasmic substrate-binding protein [Roseovarius
           nubinhibens ISM]
 gi|83838392|gb|EAP77688.1| glutamate/glutamine/aspartate/asparagine ABC transporter,
           periplasmic substrate-binding protein [Roseovarius
           nubinhibens ISM]
          Length = 339

 Score =  338 bits (867), Expect = 7e-91,   Method: Compositional matrix adjust.
 Identities = 156/343 (45%), Positives = 220/343 (64%), Gaps = 5/343 (1%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           M K  F+    L +    + +  A  L D+K RG L CG+ TGLVGFA    NG W GFD
Sbjct: 1   MKKSVFLG--ALTVAGLAAGAAAAGTLDDVKARGKLNCGVTTGLVGFAAPDENGRWDGFD 58

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
           V  CRA+++A+  DP  ++++P   K RF AL S +ID+L+RNT WT  R++ L   F  
Sbjct: 59  VGVCRAVAAAVLGDPDAVEFVPTTGKTRFTALASGEIDVLARNTTWTFSRDVDLKFTFVG 118

Query: 121 ITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVE 180
           + Y++GQGF++ K+ G+SS  +L GA++C+Q GTTTEL LAD+F+A+N+ Y P+  E   
Sbjct: 119 VNYYNGQGFMVPKELGVSSAKELDGATVCIQTGTTTELNLADFFRANNISYEPVPIETNA 178

Query: 181 EIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNI 240
           E    Y A  CD YT D S L A + + + P++HV+LP+IISK PL P +  GD EW ++
Sbjct: 179 EGQQQYLAGACDTYTTDASGLAATRASFENPADHVVLPEIISKEPLGPLVRHGDDEWGDV 238

Query: 241 VSWTHYAMVTAEELGITQKNINQVSKDT-TNPDVQRFLGIDKSSNIGEALGLTKDWTYRI 299
           V WT  A++ AEELGIT  NI ++S     NP+V R LG +   N+GE LGL  DW  + 
Sbjct: 239 VRWTLNALIAAEELGITSANIGELSAAAGDNPEVNRLLGTE--GNLGEMLGLDADWAVKA 296

Query: 300 IRHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           ++  GNYGE+F++N+G  S + + RG NA W+ GGL+Y+PP R
Sbjct: 297 VQAGGNYGELFEKNIGENSPVGLARGLNAQWTDGGLLYSPPFR 339


>gi|254439839|ref|ZP_05053333.1| lysine-arginine-ornithine-binding periplasmic protein
           [Octadecabacter antarcticus 307]
 gi|198255285|gb|EDY79599.1| lysine-arginine-ornithine-binding periplasmic protein
           [Octadecabacter antarcticus 307]
          Length = 338

 Score =  338 bits (866), Expect = 9e-91,   Method: Compositional matrix adjust.
 Identities = 149/316 (47%), Positives = 208/316 (65%), Gaps = 2/316 (0%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           L D+K RG L CG+ TGLVGFA   ANG W+GFDV  CRAL++A+  DP  ++++P   +
Sbjct: 25  LDDVKARGTLNCGVTTGLVGFAAPDANGVWEGFDVGVCRALAAAVLGDPMAVEFVPTTGQ 84

Query: 87  ERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGA 146
            RF AL S +ID L+RNT WT  R++ L   F  I Y+DGQGF++ ++ G+SS   L GA
Sbjct: 85  TRFTALASGEIDFLARNTTWTFSRDVDLKFEFTGINYYDGQGFMVPRELGVSSAKDLDGA 144

Query: 147 SICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKL 206
           ++C+Q GTTTEL LADYF+++N+ Y P+  E   E    Y A  CD YT D S L A + 
Sbjct: 145 TVCIQTGTTTELNLADYFRSNNISYEPVPIETNAEGQQQYLAGACDTYTTDASGLAATRA 204

Query: 207 TNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSK 266
           T + P +HV+LP+IISK PL P +  GD EW ++  WT  A++ AEELG+T  NI +++ 
Sbjct: 205 TFENPGDHVLLPEIISKEPLGPLVRHGDNEWADVARWTLNALIAAEELGVTSANIAELAN 264

Query: 267 DTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGY 326
            T NP++ R LG +    +G  LGL  DW    I   GNYGE+F++N+G  + + + RG 
Sbjct: 265 GTDNPEINRLLGTE--GELGAMLGLEADWAKNAIMAGGNYGELFEKNIGENTPIGLARGL 322

Query: 327 NALWSKGGLMYAPPIR 342
           NA+W++GGL+Y+PP R
Sbjct: 323 NAMWTEGGLIYSPPFR 338


>gi|30064596|ref|NP_838767.1| putative periplasmic binding transport protein [Shigella flexneri
           2a str. 2457T]
 gi|56480353|ref|NP_709270.2| putative periplasmic binding transport protein [Shigella flexneri
           2a str. 301]
 gi|30042855|gb|AAP18578.1| putative periplasmic binding transport protein [Shigella flexneri
           2a str. 2457T]
 gi|56383904|gb|AAN44977.2| putative periplasmic binding transport protein [Shigella flexneri
           2a str. 301]
 gi|313648492|gb|EFS12934.1| general L-amino acid-binding periplasmic protein aapJ [Shigella
           flexneri 2a str. 2457T]
          Length = 305

 Score =  338 bits (866), Expect = 9e-91,   Method: Compositional matrix adjust.
 Identities = 148/307 (48%), Positives = 214/307 (69%), Gaps = 2/307 (0%)

Query: 36  LKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSK 95
           ++CGI+ GL  F+   A+G + G DVD CR +++A+F D +K++Y PL AKERF ALQS 
Sbjct: 1   MQCGISDGLPRFSYADADGKFSGIDVDVCRGVAAAVFGDDTKVKYTPLTAKERFTALQSG 60

Query: 96  QIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTT 155
           ++D+LSRNT WT  R+  +G+AF  +TY+DG GF+ H K G+ S  +L GA++C+QAGT 
Sbjct: 61  EVDLLSRNTTWTSSRDAGMGMAFTGVTYYDGIGFLTHDKAGLKSAKELDGATVCIQAGTD 120

Query: 156 TELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHV 215
           TEL +ADYFKA+NMKY P+ F+R +E   A  + RCD    D S LYAL++    P+E +
Sbjct: 121 TELNVADYFKANNMKYTPVTFDRSDESAKALESGRCDTLASDQSQLYALRIKLSNPAEWI 180

Query: 216 ILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQR 275
           +LP++ISK PL P + +GD EW++IV WT +AM+ AEE+GI  +N+++ + +   PD+  
Sbjct: 181 VLPEVISKEPLGPVVRRGDDEWFSIVRWTLFAMLNAEEMGINSQNVDEKAANPATPDMAH 240

Query: 276 FLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGL 335
            LG  K  + G+ L L   W Y II+ + NY E+F+RN+G++S LKI RG N LW+ GG+
Sbjct: 241 LLG--KEGDYGKDLKLDNKWAYNIIKQVSNYSEIFERNVGSESPLKIKRGQNNLWNNGGI 298

Query: 336 MYAPPIR 342
            YAPP+R
Sbjct: 299 QYAPPVR 305


>gi|254451978|ref|ZP_05065415.1| glutamate/glutamine/aspartate/asparagine ABC transporter,
           periplasmic substrate-binding protein [Octadecabacter
           antarcticus 238]
 gi|198266384|gb|EDY90654.1| glutamate/glutamine/aspartate/asparagine ABC transporter,
           periplasmic substrate-binding protein [Octadecabacter
           antarcticus 238]
          Length = 338

 Score =  338 bits (866), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 150/316 (47%), Positives = 205/316 (64%), Gaps = 2/316 (0%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           L D+K RG L CG+ TGLVGFA   ANG W+GFDV  CRAL++A+  DP  ++++P   +
Sbjct: 25  LDDVKARGTLNCGVTTGLVGFAAPDANGVWEGFDVGLCRALAAAVLGDPMAVEFVPTTGQ 84

Query: 87  ERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGA 146
            RF AL S +ID L+RNT WT  R++ L   F  I Y+DGQGF++ +  G+SS   L GA
Sbjct: 85  TRFTALASGEIDFLARNTTWTFSRDVDLKFEFVGINYYDGQGFMVPRALGVSSAKDLDGA 144

Query: 147 SICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKL 206
           ++C+Q GTTTEL LADYF+++N+ Y P+  E   E    Y A  CD YT D S L A + 
Sbjct: 145 TVCIQTGTTTELNLADYFRSNNISYEPVPIETNAEGQQQYLAGACDTYTTDASGLAATRA 204

Query: 207 TNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSK 266
           T + P +HV+LP+IISK PL P +  GD EW ++  WT  A++ AEELG+T  NI +++ 
Sbjct: 205 TFENPGDHVLLPEIISKEPLGPLVRHGDNEWADVARWTLNALIAAEELGVTSANIAEMAS 264

Query: 267 DTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGY 326
            T NP++ R LG      +G  LGL  DW  + I   GNYGE+F++N+G  + + + RG 
Sbjct: 265 GTDNPEINRLLG--SEGELGAMLGLESDWAMKAIMAGGNYGELFEKNIGENTPIGLARGL 322

Query: 327 NALWSKGGLMYAPPIR 342
           NALW+ GGL+Y PP R
Sbjct: 323 NALWTDGGLVYTPPFR 338


>gi|299134008|ref|ZP_07027201.1| extracellular solute-binding protein family 3 [Afipia sp. 1NLS2]
 gi|298590755|gb|EFI50957.1| extracellular solute-binding protein family 3 [Afipia sp. 1NLS2]
          Length = 350

 Score =  337 bits (865), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 159/311 (51%), Positives = 219/311 (70%), Gaps = 3/311 (0%)

Query: 32  KRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERFLA 91
           KRG + CG+N GL GFA   ANG+W GFDVD CRA+++A+FDD +K+ ++PL+  +RF  
Sbjct: 43  KRGAVNCGVNAGLPGFANKDANGNWSGFDVDICRAVAAAVFDDATKVNFIPLDTNQRFKE 102

Query: 92  LQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASICVQ 151
           LQ++++DILSRN+ W++ RE+   L F  ++Y+DG+GF++ + + + S  +L G  +CVQ
Sbjct: 103 LQNRKVDILSRNSTWSMSREVDYDLTFAAVSYYDGEGFMVRRSRNVDSALELGGTRVCVQ 162

Query: 152 AGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTNDRP 211
           + TTT+L LADYFK +N+ Y  + F  V ++  AY A +CD  T D S LYA +    +P
Sbjct: 163 SDTTTQLNLADYFKVNNITYDEMKFGNVSDMLKAYEAGKCDVLTTDTSQLYAYRQNLAKP 222

Query: 212 SEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTTNP 271
            +HVIL DIISK PLAP + Q D +W  IV W  YAM+ AEELG+T KNI++  K +  P
Sbjct: 223 DDHVILADIISKEPLAPVVRQRDDQWMLIVKWAVYAMLNAEELGVTSKNIDEALK-SKKP 281

Query: 272 DVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNALWS 331
           DV R +G +   N GE LGLTKDW  RIIRH+GNYGE+++RN+G  S+L IPRG N LW+
Sbjct: 282 DVMRLVGTE--GNYGEELGLTKDWAARIIRHVGNYGEVYERNVGLGSKLGIPRGLNQLWN 339

Query: 332 KGGLMYAPPIR 342
            GG+ YAPPIR
Sbjct: 340 AGGIQYAPPIR 350


>gi|261752067|ref|ZP_05995776.1| cationic amino acid ABC transporter [Brucella suis bv. 5 str. 513]
 gi|261741820|gb|EEY29746.1| cationic amino acid ABC transporter [Brucella suis bv. 5 str. 513]
          Length = 277

 Score =  337 bits (864), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 155/273 (56%), Positives = 206/273 (75%), Gaps = 3/273 (1%)

Query: 72  FDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIM 131
           F DP+K+++ PLNAKERF ALQS ++D+L RNT WT+ R+ SLGL F  I Y+DGQGF++
Sbjct: 6   FGDPTKVKFTPLNAKERFTALQSGEVDVLIRNTTWTISRDTSLGLDFAGINYYDGQGFMI 65

Query: 132 HKKK--GISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAH 189
           + KK  GI+S  QLSGASICVQAGTTTEL +ADYF+A+ M+Y+P+VFE++EE +AAY + 
Sbjct: 66  NSKKLAGINSALQLSGASICVQAGTTTELNMADYFRANKMEYNPVVFEKIEEANAAYDSG 125

Query: 190 RCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMV 249
           RCDAYT D S+LY ++L    P +HVILP+IISK P    + QGD  W ++V WTH A++
Sbjct: 126 RCDAYTTDQSSLYGVRLALANPDDHVILPEIISKEPFGLTVRQGDARWADVVRWTHNALL 185

Query: 250 TAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEM 309
            AEE GITQ N+ ++ K + NPD++R LG +  + IG  LGL KDW  +II+ +GNYGE+
Sbjct: 186 NAEEYGITQANVEEMKK-SDNPDIKRLLGAEADTKIGTDLGLDKDWVVKIIKGVGNYGEI 244

Query: 310 FDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           F+RN+G+ S LKI RG NA W+KGGL Y  P+R
Sbjct: 245 FERNIGSGSPLKIARGLNAQWNKGGLQYGIPVR 277


>gi|332098837|gb|EGJ03794.1| general L-amino acid-binding periplasmic protein aapJ [Shigella
           boydii 3594-74]
          Length = 357

 Score =  336 bits (861), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 154/335 (45%), Positives = 226/335 (67%), Gaps = 18/335 (5%)

Query: 24  ASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDF----------------CRAL 67
            + L  ++K+GF++CGI+ GL+GF+   A+G + G DVD                 CR++
Sbjct: 25  GATLDAVQKKGFVQCGISDGLLGFSYADADGKFSGIDVDVDVDVDVDVDVDVDVDVCRSV 84

Query: 68  SSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQ 127
           ++A+F D +K++Y PL AKERF ALQS ++D+LSRNT WT  R+  +G+AF  +TY+DG 
Sbjct: 85  AAAVFGDDTKVKYTPLTAKERFTALQSGEVDLLSRNTTWTSSRDAGMGMAFTGVTYYDGI 144

Query: 128 GFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYR 187
           GF+ H K G+ S  +L GA++C+QAGT TEL +ADYFKA+NMKY P+ F+R +E   A  
Sbjct: 145 GFLTHDKAGLKSAKELDGATVCIQAGTDTELNVADYFKANNMKYTPVTFDRSDESAKALE 204

Query: 188 AHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYA 247
           + RCD    D S LYAL++    P+E ++LP++ISK PL P + +GD EW++IV WT +A
Sbjct: 205 SGRCDTLASDQSQLYALRIKLSNPAEWIVLPEVISKEPLGPVVRRGDDEWFSIVRWTLFA 264

Query: 248 MVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYG 307
           M+ AEE+GI  +N+++ + +   PD+   LG  K  + G+ L L   W Y II+ +GNY 
Sbjct: 265 MLNAEEMGINSQNVDEKAANPATPDMAHLLG--KEGDYGKDLKLDNKWAYNIIKQVGNYS 322

Query: 308 EMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           E+F+RN+G++S LKI RG N LW+ GG+ YAPP+R
Sbjct: 323 EIFERNVGSESPLKIKRGQNNLWNNGGIQYAPPVR 357


>gi|160899043|ref|YP_001564625.1| extracellular solute-binding protein [Delftia acidovorans SPH-1]
 gi|160364627|gb|ABX36240.1| extracellular solute-binding protein family 3 [Delftia acidovorans
           SPH-1]
          Length = 345

 Score =  336 bits (861), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 156/318 (49%), Positives = 224/318 (70%), Gaps = 7/318 (2%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           L  IK+RG + CG++TG  GFA    +G+W G DVD CRA+++A   D SK++++P + +
Sbjct: 31  LDGIKQRGAVACGVHTGRAGFALADGSGNWSGLDVDLCRAVAAATLGDASKVKFIPTSGQ 90

Query: 87  ERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGA 146
            R  ALQS +ID+L+RNT WT  R+  LGL +  I + DGQGF+  KK G++SV QLSGA
Sbjct: 91  TRITALQSGEIDLLARNTTWTFTRDNGLGLMWAGINFHDGQGFMARKKPGLNSVKQLSGA 150

Query: 147 SICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALK- 205
           +ICV +G+TTE TL++YF+AH + Y  +VF+  E    A+ + RC AYTGD+ AL  L+ 
Sbjct: 151 TICVISGSTTEKTLSEYFRAHKLNYKAVVFDNPEAALQAFSSGRCQAYTGDLGALAVLRG 210

Query: 206 --LTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQ 263
             L N  P ++VILP++ISK P  PA+ +GD EW+ +V WT  AM+ AEELGITQ N ++
Sbjct: 211 KELAN--PDDYVILPEVISKEPAGPAVRRGDDEWFAVVRWTLNAMIEAEELGITQANADE 268

Query: 264 VSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIP 323
           +   + +  V+RFLG  +S ++G+ LGL K+W  RI++ +GNYGE ++RNLG +S L +P
Sbjct: 269 LKTRSDSIQVKRFLG--QSDDLGKQLGLDKEWALRIVKAVGNYGESYERNLGAKSGLNVP 326

Query: 324 RGYNALWSKGGLMYAPPI 341
           RG NAL++KGGLM +PP+
Sbjct: 327 RGKNALFTKGGLMMSPPM 344


>gi|187479528|ref|YP_787553.1| L-amino acid ABC transporter substrate-binding protein [Bordetella
           avium 197N]
 gi|115424115|emb|CAJ50668.1| L-amino acid ABC transporter, substrate-binding protein [Bordetella
           avium 197N]
          Length = 338

 Score =  335 bits (860), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 148/314 (47%), Positives = 224/314 (71%), Gaps = 3/314 (0%)

Query: 29  DIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKER 88
           ++KK+GF++CG++TG+ GF+   + G+WKG DVD CRA+++A+F D SK +  PLN ++R
Sbjct: 28  NVKKKGFVQCGVSTGIPGFSIADSKGEWKGLDVDLCRAVAAAMFGDASKFKVTPLNTQQR 87

Query: 89  FLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASI 148
           F ALQS ++D+L+RNT  TL R+ +LGLA   + Y+D QG ++ K  G+ S  +L GA++
Sbjct: 88  FTALQSGEVDVLTRNTTLTLSRDTTLGLADVAVNYYDSQGVMVSKDLGVKSAKELGGATV 147

Query: 149 CVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTN 208
           CVQ GTTTEL LAD+F+++N+++ P+V ++ +EI  A+ A RCDA+T D S L + + T 
Sbjct: 148 CVQPGTTTELNLADWFRSNNIEFKPVVIDKYDEIVRAFSAGRCDAFTTDKSQLASTRTTL 207

Query: 209 DRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDT 268
           ++P  +VILP+  SK PL P + QGD +W+N++ WT  AM+ AEE GIT KN+ +++K +
Sbjct: 208 EKPDNYVILPEDFSKEPLGPMVRQGDEQWFNMIRWTLTAMIEAEEYGITSKNVEEMTK-S 266

Query: 269 TNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNA 328
            NP++QR LG+  +  +G+ LG+   W Y I++ +GNYGE F+ NLG  S +K+ RG NA
Sbjct: 267 GNPNIQRILGV--TPGMGKNLGVDDKWAYNIVKQVGNYGESFEANLGKNSPMKLERGMNA 324

Query: 329 LWSKGGLMYAPPIR 342
            +  GGLMY  PIR
Sbjct: 325 SYKHGGLMYGWPIR 338


>gi|260757721|ref|ZP_05870069.1| cationic amino acid ABC transporter [Brucella abortus bv. 4 str.
           292]
 gi|260761546|ref|ZP_05873889.1| cationic amino acid ABC transporter [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260668039|gb|EEX54979.1| cationic amino acid ABC transporter [Brucella abortus bv. 4 str.
           292]
 gi|260671978|gb|EEX58799.1| cationic amino acid ABC transporter [Brucella abortus bv. 2 str.
           86/8/59]
          Length = 277

 Score =  335 bits (860), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 154/273 (56%), Positives = 205/273 (75%), Gaps = 3/273 (1%)

Query: 72  FDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIM 131
           F DP+K+++ PLNAKERF A QS ++D+L RNT WT+ R+ SLGL F  I Y+DGQGF++
Sbjct: 6   FGDPTKVKFTPLNAKERFTAFQSGEVDVLIRNTTWTISRDTSLGLDFAGINYYDGQGFMI 65

Query: 132 HKKK--GISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAH 189
           + KK  GI+S  QLSGASICVQAGTTTEL +ADYF+A+ M+Y+P+VFE++EE +AAY + 
Sbjct: 66  NSKKLAGINSALQLSGASICVQAGTTTELNMADYFRANKMEYNPVVFEKIEEANAAYDSG 125

Query: 190 RCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMV 249
           RCDAYT D S+LY ++L    P +HVILP+IISK P    + QGD  W ++V WTH A++
Sbjct: 126 RCDAYTTDQSSLYGVRLALANPDDHVILPEIISKEPFGLTVRQGDARWADVVRWTHNALL 185

Query: 250 TAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEM 309
            AEE GITQ N+ ++ K + NPD++R LG +  + IG  LGL KDW  +II+ +GNYGE+
Sbjct: 186 NAEEYGITQANVEEMKK-SDNPDIKRLLGAEADTKIGTDLGLDKDWVVKIIKGVGNYGEI 244

Query: 310 FDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           F+RN+G+ S LKI RG NA W+KGGL Y  P+R
Sbjct: 245 FERNIGSGSPLKIARGLNAQWNKGGLQYGIPVR 277


>gi|294084021|ref|YP_003550778.1| glutamate/glutamine/aspartate/asparagine ABC transporter
           periplasmic substrate-binding protein [Candidatus
           Puniceispirillum marinum IMCC1322]
 gi|292663593|gb|ADE38694.1| glutamate/glutamine/aspartate/asparagine ABC transporter,
           periplasmic substrate-binding protein [Candidatus
           Puniceispirillum marinum IMCC1322]
          Length = 338

 Score =  335 bits (859), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 156/322 (48%), Positives = 210/322 (65%), Gaps = 2/322 (0%)

Query: 21  STNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQY 80
           +  AS L D+K RG +KC  +TGL GFA     G+W GFDVDFCRA ++A+  D  KI  
Sbjct: 19  TAQASTLEDVKSRGEVKCVFSTGLAGFAFPDDKGNWTGFDVDFCRATAAAVLGDAQKIGP 78

Query: 81  LPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSV 140
           +P   + RF  L + + D+L RNT  T  R++ + L F  + Y+DGQGF+  K  GISS 
Sbjct: 79  VPATTQNRFTVLNAGEADVLWRNTTITFSRDVGVKLTFLGVNYYDGQGFMAKKSLGISSA 138

Query: 141 SQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISA 200
            +L GAS+C+Q GTTTEL LADYF+++NM Y  +      E    Y + R D  T D SA
Sbjct: 139 LELDGASVCIQTGTTTELNLADYFRSNNMTYEAVPVADSAEARECYNSGRGDVLTTDASA 198

Query: 201 LYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKN 260
           L + +   + P +H++LP+IISK PL PA+ QGD EW +IV W  YA +TAEELGITQ N
Sbjct: 199 LSSQRAAMENPDDHMVLPEIISKEPLGPAVRQGDDEWADIVRWVLYATITAEELGITQAN 258

Query: 261 INQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSEL 320
           +N +   T NP+++RFLG++  +N+G  LGL+ DW   II  +GNYGE+F+RN+G  + L
Sbjct: 259 VNTIGATTNNPEIKRFLGLE--ANLGPELGLSNDWAKNIIAQVGNYGEIFERNIGVNTPL 316

Query: 321 KIPRGYNALWSKGGLMYAPPIR 342
            I RG NALW+ GGL Y+PP R
Sbjct: 317 GIGRGVNALWTDGGLQYSPPFR 338


>gi|75906963|ref|YP_321259.1| extracellular solute-binding protein [Anabaena variabilis ATCC
           29413]
 gi|75700688|gb|ABA20364.1| L-glutamate-binding protein / L-aspartate-binding protein / neutral
           amino acid-binding protein [Anabaena variabilis ATCC
           29413]
          Length = 356

 Score =  335 bits (859), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 152/313 (48%), Positives = 218/313 (69%), Gaps = 3/313 (0%)

Query: 30  IKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERF 89
           IK RG L CG++  + GF+ V  NG++ G DVD CRA+++A+FD+P  +++  L+AKERF
Sbjct: 47  IKNRGQLICGVSGEVPGFSFVGTNGEYSGIDVDVCRAIAAALFDNPDAVEFRNLSAKERF 106

Query: 90  LALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASIC 149
            ALQ+ ++DILSRNT WTL R  S+GL F P+ ++DGQ  ++ K   I S++ L   +IC
Sbjct: 107 TALQTGEVDILSRNTTWTLSRATSVGLEFAPVVFYDGQAIMVRKNSAIKSLADLKDKAIC 166

Query: 150 VQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTND 209
           VQ GTTTE  LAD  +  N+ Y P+VFE V    A Y   RCDA T D SAL + + T  
Sbjct: 167 VQTGTTTEQNLADQMRKRNITYKPVVFEDVNVTFATYAEGRCDAITADRSALVSRRTTLP 226

Query: 210 RPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTT 269
           +P ++V+L ++IS  PLAPA+ +GD +W + V+W  YA++  EELGI  +N+ Q +  + 
Sbjct: 227 KPEDNVVLDEVISSEPLAPAVAKGDAKWSDTVNWVVYALIKGEELGINSQNLGQFTT-SN 285

Query: 270 NPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNAL 329
           +PDV+RFLG +   ++G+ LGLT D+  RII+H+GNYGE++DRNLG +++L + RG N L
Sbjct: 286 DPDVKRFLGTE--GDLGQGLGLTNDFAARIIKHVGNYGELYDRNLGPKTKLNLARGQNQL 343

Query: 330 WSKGGLMYAPPIR 342
           WSKGGL+Y+PP R
Sbjct: 344 WSKGGLLYSPPFR 356


>gi|77457200|ref|YP_346705.1| extracellular solute-binding protein [Pseudomonas fluorescens
           Pf0-1]
 gi|77381203|gb|ABA72716.1| amino acid ABC transporter substrate-binding protein, PAAT family
           [Pseudomonas fluorescens Pf0-1]
          Length = 343

 Score =  335 bits (859), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 156/343 (45%), Positives = 222/343 (64%), Gaps = 3/343 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           M K     +    +L  + F+   + L  +KK+GF++CG++ GL GF+   + G   G D
Sbjct: 3   MLKSTLAIVTAAAVLGVSGFAQAGATLDAVKKKGFVQCGVSDGLPGFSVPDSTGKIVGID 62

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
            D CRA+++A+F D +K+++  LNAKERF ALQS +IDILSRNT  T  R+  +GL F  
Sbjct: 63  ADVCRAVAAAVFGDATKVKFSQLNAKERFTALQSGEIDILSRNTTMTSSRDAGMGLKFPG 122

Query: 121 -ITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERV 179
            ITY+DG GF+++ K G+ S  +L GA+IC+QAGTTTEL ++DYF+ + +KY PI F+  
Sbjct: 123 FITYYDGIGFLVNNKLGVKSAKELDGATICIQAGTTTELNVSDYFRGNGLKYTPITFDTS 182

Query: 180 EEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYN 239
           +E   +  + RCD  T D S L+A +     P ++V+LP+ ISK PL P +  GD EW  
Sbjct: 183 DESAKSLESGRCDVLTSDKSQLFAQRSKLASPKDYVVLPETISKEPLGPVVRNGDDEWLA 242

Query: 240 IVSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRI 299
           IV W  YA++  EE GI+ KN+   +K T NPDV R LG D     G+ L L KDW  +I
Sbjct: 243 IVRWVGYALLNTEEAGISSKNVEAEAKSTKNPDVARMLGAD--GEYGKDLKLPKDWVVQI 300

Query: 300 IRHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           ++ +GNYGE+F++NLG  + L+I RG NALW+ GG+ YAPP+R
Sbjct: 301 VKQVGNYGEIFEKNLGKSTPLEIDRGLNALWNNGGIQYAPPVR 343


>gi|84515667|ref|ZP_01003028.1| glutamate/glutamine/aspartate/asparagine ABC transporter,
           periplasmic substrate-binding protein [Loktanella
           vestfoldensis SKA53]
 gi|84510109|gb|EAQ06565.1| glutamate/glutamine/aspartate/asparagine ABC transporter,
           periplasmic substrate-binding protein [Loktanella
           vestfoldensis SKA53]
          Length = 339

 Score =  335 bits (858), Expect = 7e-90,   Method: Compositional matrix adjust.
 Identities = 152/343 (44%), Positives = 220/343 (64%), Gaps = 5/343 (1%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           M K  F+  L +  L  T+   +A+ L D+K RG LKCG N GL GFA   ANG+W+GFD
Sbjct: 1   MTKTVFIGALAVAGL--TAGIASAATLDDVKARGSLKCGSNEGLAGFAAPDANGNWEGFD 58

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
           V  CRA+++A+  D   ++++PL ++ RF AL + ++D+L RN+ WT  R+  L L F  
Sbjct: 59  VSLCRAIAAAVLGDGQAVEFVPLTSQTRFTALAAGEVDVLVRNSTWTFTRDTDLALDFPA 118

Query: 121 ITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVE 180
           I Y+DGQGF++ +  G+SS ++L GA++C+Q GTTTEL LADYF+A+ + Y P+      
Sbjct: 119 INYYDGQGFMVPRALGVSSAAELDGATVCIQTGTTTELNLADYFRANGISYEPVPVATNA 178

Query: 181 EIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNI 240
           E    Y A  CD YT DIS L A + T + P +HVILP+++SK PL PA+  GD  W +I
Sbjct: 179 EGQQQYLAGACDVYTTDISGLAATRATFEAPGDHVILPEVVSKEPLGPAVRHGDNAWGDI 238

Query: 241 VSWTHYAMVTAEELGITQKNINQV-SKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRI 299
           V WT +A+V AEE G+T+ N+ ++ +  T NP+V R LG +    +G  +GL  DW  ++
Sbjct: 239 VRWTTHALVAAEEYGVTKANVAELAAAPTDNPEVNRLLGTE--GELGAMIGLDADWAVKV 296

Query: 300 IRHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           +   GNYGE+F+ N+G  + + + RG NA W+ GGLMY  P R
Sbjct: 297 LSVAGNYGEIFEANIGESTAVGLARGLNAQWTDGGLMYGGPFR 339


>gi|237807991|ref|YP_002892431.1| extracellular solute-binding protein family 3 [Tolumonas auensis
           DSM 9187]
 gi|237500252|gb|ACQ92845.1| extracellular solute-binding protein family 3 [Tolumonas auensis
           DSM 9187]
          Length = 342

 Score =  334 bits (856), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 159/340 (46%), Positives = 232/340 (68%), Gaps = 5/340 (1%)

Query: 5   FFVSILCLIILFFTSFSTNAS--ILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVD 62
           +   +   + L     +  AS   L ++KK+G+++CG+N GL GF+   A G W+G DVD
Sbjct: 6   YLTGVASAVALLVAGNAQAASGDTLANVKKKGYVQCGVNDGLPGFSSPNAKGAWEGMDVD 65

Query: 63  FCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPIT 122
            CRA+++A+F D SK++Y+PL  KERF ALQS ++DILSRNT WT+ R+ +LGL     T
Sbjct: 66  VCRAVAAAVFADASKVKYIPLGGKERFTALQSGEVDILSRNTTWTMTRDATLGLKSTATT 125

Query: 123 YFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEI 182
           Y+DGQGF+++K  G+ S  +L GA+IC + GTTTE+ +ADYF A+ MKY P+VF+  ++ 
Sbjct: 126 YYDGQGFMVNKSLGVKSAKELDGATICTEGGTTTEMNMADYFNANKMKYTPVVFDNSDQT 185

Query: 183 DAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVS 242
              + + RCD  T D S L+A+++   +P +  +LP+IISK PL P + QGD  W  +V 
Sbjct: 186 VKGFESGRCDVLTSDKSQLFAVRVKLAKPDDVAVLPEIISKEPLGPMVRQGDESWELLVK 245

Query: 243 WTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRH 302
           WT +AM+ AEELG++ KN+++++K + +PDV+R LG D     G  LG  KDW Y+I++ 
Sbjct: 246 WTVFAMINAEELGVSSKNVDEMAK-SGSPDVKRMLGYDAPD--GTTLGAVKDWGYQIVKQ 302

Query: 303 MGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           +GNY E+FDRN+G  S LKI R  N LW+KGG +YAPP+R
Sbjct: 303 VGNYAEVFDRNVGKDSPLKIVRTENNLWNKGGFLYAPPVR 342


>gi|126736638|ref|ZP_01752378.1| glutamate/glutamine/aspartate/asparagine ABC transporter,
           periplasmic substrate-binding protein [Roseobacter sp.
           CCS2]
 gi|126713951|gb|EBA10822.1| glutamate/glutamine/aspartate/asparagine ABC transporter,
           periplasmic substrate-binding protein [Roseobacter sp.
           CCS2]
          Length = 339

 Score =  333 bits (855), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 149/333 (44%), Positives = 214/333 (64%), Gaps = 3/333 (0%)

Query: 11  CLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSA 70
            L +  F +   +A+ L D+K+RG L CG+ TGLVGFA   ANG W GFDV  CRA+++A
Sbjct: 9   ALTVAGFAASMASAATLDDVKERGVLNCGVTTGLVGFASPDANGVWDGFDVGVCRAVAAA 68

Query: 71  IFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFI 130
           +  D   ++++P   K RF AL S +ID+L+RNT WT  R++ L   F  I Y+DGQGF+
Sbjct: 69  VLGDSDAVEFVPTTGKTRFTALASGEIDMLARNTTWTFSRDVDLKFEFVGINYYDGQGFL 128

Query: 131 MHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHR 190
           + +  G+SS  +L GA++C+Q GTTTEL LADYF+++N+ Y P+  E   E    Y A  
Sbjct: 129 VPRDLGVSSAKELDGATVCIQTGTTTELNLADYFRSNNISYEPVPIETNAEGQQQYLAGA 188

Query: 191 CDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVT 250
           CD YT D S L A +   + P++HV+LP+I+SK PL P +  GD +W ++V W+  A++ 
Sbjct: 189 CDVYTTDASGLAATRAAFENPADHVVLPEIVSKEPLGPLVRHGDNDWADVVRWSLNALIA 248

Query: 251 AEELGITQKNINQV-SKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEM 309
           AEELG+T  NI ++ +  T NP+V R LG +    +G  LGL  DW    I   GNYGE+
Sbjct: 249 AEELGVTSANIEELAAAPTGNPEVNRLLGTE--GELGAMLGLEADWAKNAIAAGGNYGEL 306

Query: 310 FDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           F++N+G  + + + RG NA W+ GGL+Y+PP R
Sbjct: 307 FEKNIGENTPIGLARGLNAQWTDGGLLYSPPFR 339


>gi|254486168|ref|ZP_05099373.1| glutamate/glutamine/aspartate/asparagine-binding protein
           [Roseobacter sp. GAI101]
 gi|214043037|gb|EEB83675.1| glutamate/glutamine/aspartate/asparagine-binding protein
           [Roseobacter sp. GAI101]
          Length = 338

 Score =  333 bits (855), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 157/342 (45%), Positives = 224/342 (65%), Gaps = 4/342 (1%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           M K  F   + +  L   + ++ A+ L D+K+RG L CG+ TGLVGFA   ANG+W+GFD
Sbjct: 1   MNKSVFFGAMTVAGL--VAGASAAATLDDVKERGKLNCGVTTGLVGFAAPNANGEWEGFD 58

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
           V  CRA+++A+F DP+ ++++P   K RF AL S +ID L+RNT WT  R++ L   F  
Sbjct: 59  VAVCRAVAAAVFGDPTAVEFIPTTGKTRFTALASGEIDFLARNTTWTFSRDVDLKFDFIG 118

Query: 121 ITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVE 180
           + Y+DGQGF++ K  G+SS   L GA++C+Q GTTTEL LAD+F+A+N+ Y P+  E   
Sbjct: 119 VNYYDGQGFMVPKALGVSSAKDLDGATVCIQTGTTTELNLADFFRANNISYEPVPIETNA 178

Query: 181 EIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNI 240
           E    Y A  CD YT D S L + + T + P +H+ILP+IISK PL P +  GD +W ++
Sbjct: 179 EGQQQYLAGACDTYTTDASGLASTRATFETPGDHIILPEIISKEPLGPLVRHGDNDWGDL 238

Query: 241 VSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRII 300
             W  YA++ AEELG+T  N+ +++  TTNP+V R LG + +  +GE LGL+ DW    I
Sbjct: 239 TRWVLYALIAAEELGVTSANVEEMATSTTNPEVARLLGAEGT--LGEMLGLSADWAKNAI 296

Query: 301 RHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
              GNYGE+F +N+G ++ + + RG NA W+ GGLMYAPP R
Sbjct: 297 ASQGNYGEIFAKNIGEETPIGLARGLNAQWTDGGLMYAPPFR 338


>gi|282897630|ref|ZP_06305630.1| extracellular solute-binding protein, family 3 [Raphidiopsis
           brookii D9]
 gi|281197553|gb|EFA72449.1| extracellular solute-binding protein, family 3 [Raphidiopsis
           brookii D9]
          Length = 351

 Score =  333 bits (855), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 149/307 (48%), Positives = 221/307 (71%), Gaps = 3/307 (0%)

Query: 36  LKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSK 95
           L CG++  L GF+ V+ +G + G DVD CRA+++A+FD+P K+++  L+AKERF ALQ+ 
Sbjct: 48  LVCGVSGELPGFSFVQTDGKYAGIDVDVCRAVAAALFDNPDKVEFRNLSAKERFTALQTG 107

Query: 96  QIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTT 155
           +ID+LSRNT WT  R+ S+GL F P+  +DGQG ++ K  GI+S++ L   +IC Q GTT
Sbjct: 108 EIDLLSRNTTWTFSRDTSMGLYFSPVVLYDGQGIMIRKNSGINSLADLKNKAICTQTGTT 167

Query: 156 TELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHV 215
           TE  LAD  +   + Y P+VFE +    A Y   RCDA T D SAL + + T  +P +++
Sbjct: 168 TEQNLADQMRKRGISYKPVVFEDINVTFATYSEGRCDAVTADRSALISRRTTLPKPEDNI 227

Query: 216 ILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQR 275
           IL +++S  PLAPA+ QGD +W NIV W+ YA++ AEELGI  +NI+Q + ++ +P+++R
Sbjct: 228 ILNELLSSEPLAPAVAQGDPQWNNIVKWSVYALIKAEELGINSQNISQFA-NSKDPEIKR 286

Query: 276 FLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGL 335
           FLG +   N+G+ +GLT D+  RII+H+GNYGE++DRNLG++++L +PRG N L+SKGGL
Sbjct: 287 FLGTE--GNLGKGIGLTNDFAARIIKHVGNYGEIYDRNLGSKTKLNLPRGQNELYSKGGL 344

Query: 336 MYAPPIR 342
           +Y+PP R
Sbjct: 345 LYSPPFR 351


>gi|113475659|ref|YP_721720.1| extracellular solute-binding protein [Trichodesmium erythraeum
           IMS101]
 gi|110166707|gb|ABG51247.1| extracellular solute-binding protein, family 3 [Trichodesmium
           erythraeum IMS101]
          Length = 343

 Score =  333 bits (854), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 143/313 (45%), Positives = 217/313 (69%), Gaps = 2/313 (0%)

Query: 30  IKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERF 89
           +K RG L CG+  G+ GF+ V  NG++ G DVD C+A+++A+F+DP+ ++Y  L++ ERF
Sbjct: 33  VKNRGKLICGVEGGIPGFSFVDKNGNYSGIDVDICKAVAAALFNDPNLVEYRNLDSTERF 92

Query: 90  LALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASIC 149
            AL   ++D+LSRNT WT+ R+ ++GL F P T++DGQG ++    G+ S+  L G SIC
Sbjct: 93  TALNGGEVDMLSRNTTWTVSRDTTVGLEFAPTTFYDGQGMMVRANSGVESLEDLQGKSIC 152

Query: 150 VQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTND 209
           V+AGTTTEL L D  +  N+    + F++ +   AAY   RCD  T D S L + + T  
Sbjct: 153 VEAGTTTELNLTDNLRQRNVTAETLTFQQADPAYAAYAEGRCDGMTSDKSQLLSRRSTLP 212

Query: 210 RPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTT 269
            P++HVIL   +SK PL P     D+ W+++V W  YA++ AEELGITQ+N++ + +++ 
Sbjct: 213 SPNDHVILQVTMSKEPLGPVTKNNDSAWFDVVKWVTYALIEAEELGITQENVDDLKQNSD 272

Query: 270 NPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNAL 329
           NP ++RFLG+D   ++GE LGL+ D+ YR+I+++GNY E++DRNLG +S+ K+PRG N L
Sbjct: 273 NPTIRRFLGVD--GDLGEGLGLSNDFAYRVIKNVGNYAEVYDRNLGEESQFKLPRGMNNL 330

Query: 330 WSKGGLMYAPPIR 342
           W+KGGL+Y+PP R
Sbjct: 331 WTKGGLLYSPPFR 343


>gi|84685382|ref|ZP_01013280.1| glutamate/glutamine/aspartate/asparagine ABC transporter,
           periplasmic substrate-binding protein [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84666539|gb|EAQ13011.1| glutamate/glutamine/aspartate/asparagine ABC transporter,
           periplasmic substrate-binding protein [Rhodobacterales
           bacterium HTCC2654]
          Length = 338

 Score =  333 bits (854), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 160/342 (46%), Positives = 219/342 (64%), Gaps = 4/342 (1%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           M K  F+    L +  F + S +A+ L D++ RG LKCG N+GL GFA   ANG W+GFD
Sbjct: 1   MKKSVFLG--ALTVAGFVAGSASAATLDDVQARGSLKCGSNSGLTGFAAPDANGHWEGFD 58

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
           V  CRA+++A+  DP  ++++P   K RF AL S ++DIL RNT WTL R++ L   F  
Sbjct: 59  VAVCRAVAAAVLGDPEAVEFVPTTPKTRFTALASGEVDILVRNTTWTLTRDVDLKFTFTG 118

Query: 121 ITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVE 180
           + Y+DGQGFI+ K  G+SS  +L GA++C+Q GTTTEL LAD+F+ +N+ Y P+  E   
Sbjct: 119 VNYYDGQGFIVPKALGVSSAKELDGATVCIQTGTTTELNLADFFRTNNISYEPVPIETNA 178

Query: 181 EIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNI 240
           E    Y A  CD YT D S L A + + + P++H ILP+IISK PL P +  GD EW +I
Sbjct: 179 EAQQQYLAGACDTYTTDASGLAATRASFENPADHAILPEIISKEPLGPLVRHGDDEWADI 238

Query: 241 VSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRII 300
           V WT  A+V AEE GIT  NI +++  T NP++ R LG + +  +GE LGL  DW  + I
Sbjct: 239 VRWTLNALVAAEEFGITSTNIEELASGTDNPEINRILGTEGT--MGEMLGLEADWAMKAI 296

Query: 301 RHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
              GNYGE+F++N+G  + + + RG NA W  GGL YAPP R
Sbjct: 297 AAGGNYGEIFEKNIGESTPIGLARGLNAQWKDGGLQYAPPFR 338


>gi|309791172|ref|ZP_07685704.1| extracellular solute-binding protein family 3 [Oscillochloris
           trichoides DG6]
 gi|308226734|gb|EFO80430.1| extracellular solute-binding protein family 3 [Oscillochloris
           trichoides DG6]
          Length = 380

 Score =  333 bits (853), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 147/313 (46%), Positives = 219/313 (69%), Gaps = 3/313 (0%)

Query: 30  IKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERF 89
           I  RG L CG+N+ L GF  V + G++ GFDV+FCRA+++A+FDDP+K+++ PLNA+ERF
Sbjct: 71  IISRGNLICGVNSVLPGFGNVDSTGNFSGFDVEFCRAIAAALFDDPTKVEFRPLNAQERF 130

Query: 90  LALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASIC 149
            ALQS ++D+LSRNT  TL R+ S+GL F P+T++DGQG ++ K  GI S+  + GA IC
Sbjct: 131 TALQSGEVDVLSRNTTATLTRDGSVGLDFAPVTFYDGQGMMVRKDSGIESLEDMEGARIC 190

Query: 150 VQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTND 209
           VQ+GTTTEL LAD F++ N+ +  ++F+  +    AY + +CD +T D S L + +    
Sbjct: 191 VQSGTTTELNLADQFRSRNINFEAVIFQEADPTFQAYDSGQCDGFTTDKSGLVSYQTKAT 250

Query: 210 RPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTT 269
            P +H+IL   +SK PLAPA++QGD +W + V W  YA + AEELGIT  NI   +  T 
Sbjct: 251 NPDDHMILDVTMSKEPLAPAVLQGDAQWADAVRWVVYATIEAEELGITSANIGDFAA-TE 309

Query: 270 NPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNAL 329
           +P+++RFLG++    +G  +GL  D+  R+I+H+GNY E+++RNLG  +   +PRG N L
Sbjct: 310 DPNIRRFLGVE--GELGAGIGLPNDFAARVIKHVGNYQEIYNRNLGPDTPFNLPRGLNTL 367

Query: 330 WSKGGLMYAPPIR 342
           +++GGL+Y+PP R
Sbjct: 368 YTEGGLLYSPPFR 380


>gi|303256337|ref|ZP_07342353.1| general amino acid ABC transporter, periplasmic binding protein
           [Burkholderiales bacterium 1_1_47]
 gi|302861066|gb|EFL84141.1| general amino acid ABC transporter, periplasmic binding protein
           [Burkholderiales bacterium 1_1_47]
          Length = 340

 Score =  333 bits (853), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 149/342 (43%), Positives = 227/342 (66%), Gaps = 2/342 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           M +      L  + L   + +    +L  +K    + CG+NT   GF+   + G+W G D
Sbjct: 1   MNQTILAGALSAVSLSLAAPAFAGPVLDKVKANDVVVCGVNTAAPGFSNADSKGNWTGLD 60

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
           VD+CRAL++A+  D +K++++PLN+ +RF ALQ+ ++D+L+RNT W L R+ SLG  F  
Sbjct: 61  VDYCRALAAAVLADANKVKFVPLNSPQRFSALQAGEVDVLARNTTWNLTRDASLGAVFVG 120

Query: 121 ITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVE 180
             Y+DGQGF++ KK  + S  QL+GA+ICVQ+GT++E ++ADYFK+H MKY  ++F+  E
Sbjct: 121 TNYYDGQGFLVPKKLNVKSAKQLNGATICVQSGTSSEPSVADYFKSHGMKYKAVLFDTTE 180

Query: 181 EIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNI 240
               A+ + RC  YT D+S L   +     P ++VILP++ISK PL P++ +GD EW+ I
Sbjct: 181 ATQGAFLSGRCQVYTTDMSDLAGARTKAANPDDYVILPEVISKEPLGPSVRRGDNEWFQI 240

Query: 241 VSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRII 300
             W   A + AEE GITQ N +++ K +T+P+V+R LG     ++G+ LGL KDW+YRI+
Sbjct: 241 ARWVLNAFIEAEEKGITQANADELRKTSTDPNVKRLLG--SGEDMGKLLGLDKDWSYRIV 298

Query: 301 RHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           + +GNYGE F+RNLG ++ L +PRG N  W+ GG++YAPP+R
Sbjct: 299 KQVGNYGESFERNLGPKTPLALPRGINNQWTNGGILYAPPVR 340


>gi|149203333|ref|ZP_01880303.1| glutamate/glutamine/aspartate/asparagine ABC transporter,
           periplasmic substrate-binding protein [Roseovarius sp.
           TM1035]
 gi|149143166|gb|EDM31205.1| glutamate/glutamine/aspartate/asparagine ABC transporter,
           periplasmic substrate-binding protein [Roseovarius sp.
           TM1035]
          Length = 339

 Score =  332 bits (852), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 151/317 (47%), Positives = 209/317 (65%), Gaps = 3/317 (0%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           L D+K RG L CG+ TGLVGFA   ANG W+GFDV  CRA+++A+  D + ++++P   K
Sbjct: 25  LDDVKARGKLNCGVTTGLVGFAAPDANGVWEGFDVAICRAVAAAVLGDGNAVEFVPTTGK 84

Query: 87  ERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGA 146
            RF AL S +ID+L+RNT WT  R+  L   F  + Y+DGQGF++ K  G+SS  +L GA
Sbjct: 85  TRFTALASGEIDLLARNTTWTFSRDTDLKFDFVGVNYYDGQGFLVPKSLGVSSAKELDGA 144

Query: 147 SICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKL 206
           ++C+Q GTTTEL LAD+F+A+N+ Y P+  E   E    Y A  CD YT D S L + + 
Sbjct: 145 TVCIQTGTTTELNLADFFRANNISYEPVPIETNAEGQQQYLAGACDTYTTDASGLASTRA 204

Query: 207 TNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSK 266
             + P +HVILP+IISK PL P +  GD +W +IV WT YA+V AEE+GIT  NI ++S 
Sbjct: 205 AFENPGDHVILPEIISKEPLGPLVRHGDNDWGDIVRWTFYALVAAEEMGITSANIGELSA 264

Query: 267 DT-TNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRG 325
               NP++ R LG +    +G  +GL  DW  R I   GNYGE+F++N+G ++ + + RG
Sbjct: 265 AAGANPEINRILGTE--GELGAMIGLDNDWAKRAISVGGNYGEIFEKNIGEKTPIGLARG 322

Query: 326 YNALWSKGGLMYAPPIR 342
            NA W++GG+MYAPP R
Sbjct: 323 LNAQWTQGGIMYAPPFR 339


>gi|296537351|ref|ZP_06899216.1| ABC superfamily ATP binding cassette transporter, amino acid
           binding protein [Roseomonas cervicalis ATCC 49957]
 gi|296262324|gb|EFH09084.1| ABC superfamily ATP binding cassette transporter, amino acid
           binding protein [Roseomonas cervicalis ATCC 49957]
          Length = 344

 Score =  332 bits (852), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 152/316 (48%), Positives = 220/316 (69%), Gaps = 6/316 (1%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           +G I+ RG L CG+     GF+   + G  +G D D CRA+++AIF D SK++++   ++
Sbjct: 35  VGAIRARGALICGVTGTTAGFSLPDSQGVMRGIDADTCRAVAAAIFGDASKVRFVNTTSQ 94

Query: 87  ERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGA 146
            RF ALQS ++D+L+RNT WTL RE SLG  F  I ++DGQGF++     ++S   L GA
Sbjct: 95  NRFTALQSGEVDMLARNTTWTLSREASLGFEFASINFYDGQGFMVKTSLNVTSAKALDGA 154

Query: 147 SICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKL 206
           +ICVQ GTTTEL LADYF+ + M++ P+V E VEEI  A+ + RCDAYT D S+L A + 
Sbjct: 155 TICVQPGTTTELNLADYFRTNRMRFTPVVIESVEEIRTAFNSGRCDAYTNDASSLAAFRA 214

Query: 207 TNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSK 266
           T   P+E+++LP+IISK PL   + +GD ++++IV W H+A VTAEELGIT +N+   + 
Sbjct: 215 TQANPAEYLLLPEIISKEPLGAVVRKGDWKFFDIVRWAHFAQVTAEELGITSQNLASFA- 273

Query: 267 DTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGY 326
           D+ NPDVQRF+G  KS ++G  LG+  DW  +I+R +GN+GE+++RN+   + L + RG 
Sbjct: 274 DSPNPDVQRFMG--KSGDLGRMLGVQADWAVQIVRQVGNFGEVWERNI---TPLGVQRGI 328

Query: 327 NALWSKGGLMYAPPIR 342
           N LW++GGL YAPP+R
Sbjct: 329 NRLWTQGGLQYAPPMR 344


>gi|319779135|ref|YP_004130048.1| Glutamate Aspartate periplasmic binding protein precursor GltI
           [Taylorella equigenitalis MCE9]
 gi|317109159|gb|ADU91905.1| Glutamate Aspartate periplasmic binding protein precursor GltI
           [Taylorella equigenitalis MCE9]
          Length = 336

 Score =  332 bits (851), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 152/336 (45%), Positives = 229/336 (68%), Gaps = 6/336 (1%)

Query: 10  LCLII--LFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRAL 67
           L L+I  L   S    A  L  +K RG + CG  TG  GF+     G+W+G DVD C+++
Sbjct: 4   LSLLIAGLVLASTQVQADTLETVKSRGHVVCGTTTGFAGFSAPNDKGEWEGLDVDLCKSI 63

Query: 68  SSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQ 127
           ++A+F D SK + +PLN+++RF ALQS +IDIL+RNT  T  R+ ++GL    + ++DGQ
Sbjct: 64  AAAVFGDASKFKTVPLNSQQRFTALQSGEIDILTRNTTVTQQRDTAIGLMSPGVNFYDGQ 123

Query: 128 GFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYR 187
           GF++ K  G+ S  +L GA++C+Q GT+ E T+AD+ +A+ + Y P+VF++  E+  A+ 
Sbjct: 124 GFLIKKDLGVKSAKELDGATVCMQTGTSNENTMADWARANKITYKPVVFDQFNEVVNAFA 183

Query: 188 AHRCDAYTGDISALYALKLTN-DRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHY 246
           + RCD +T D S L +++++    P ++V+LP+IISK PL P + Q D +W+NIV W  +
Sbjct: 184 SGRCDVFTTDASGLASIRISKLSNPDDYVVLPEIISKEPLGPFVRQSDDKWFNIVKWVMH 243

Query: 247 AMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNY 306
           A   AEELGIT KN+++  K++TNP+VQR LG+ + S  G+ LGL++DW Y++I+ +GNY
Sbjct: 244 AQWNAEELGITSKNVDE-QKNSTNPNVQRLLGVTEGS--GKNLGLSEDWAYQVIKQVGNY 300

Query: 307 GEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           GE FDRN+G  S LK+PRG N L++ GGL Y  PIR
Sbjct: 301 GESFDRNVGKDSVLKVPRGLNKLYTDGGLHYGLPIR 336


>gi|282899899|ref|ZP_06307860.1| extracellular solute-binding protein, family 3 [Cylindrospermopsis
           raciborskii CS-505]
 gi|281195169|gb|EFA70105.1| extracellular solute-binding protein, family 3 [Cylindrospermopsis
           raciborskii CS-505]
          Length = 378

 Score =  332 bits (851), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 148/315 (46%), Positives = 224/315 (71%), Gaps = 3/315 (0%)

Query: 28  GDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKE 87
           G +K    L CG++  L GF+ V+ +  + G DVD CRA+S+A+FD+P K+++  L+AKE
Sbjct: 67  GKVKTNLRLVCGVSGELPGFSFVQTDSKYAGIDVDVCRAVSAALFDNPDKVEFRNLSAKE 126

Query: 88  RFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGAS 147
           RF ALQ+ ++D+LSRNT WT  R+ S+GL F P+  +DGQG ++ K  GI+S++ L   +
Sbjct: 127 RFTALQTGEVDLLSRNTTWTFSRDTSMGLYFSPVVLYDGQGIMIRKNSGINSLADLKNKA 186

Query: 148 ICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLT 207
           IC Q GTTTE  LAD  +   + Y P+VFE +    A Y   RCDA T D SAL + + T
Sbjct: 187 ICTQTGTTTEQNLADQMRRRGISYKPVVFEDINVTFATYSEGRCDAITADRSALISRRTT 246

Query: 208 NDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKD 267
             +P ++++L +++S  PLAPA+ QGD +W+NIV W+ YA++ AEELGI  +NI+Q + +
Sbjct: 247 LPKPEDNIVLNELLSSEPLAPAVAQGDPQWHNIVKWSVYALIKAEELGINSQNISQFA-N 305

Query: 268 TTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYN 327
           + +P+++RFLG +   N+G+ +GLT D+  RII+H+GNYGE++DR+LG++++L +PRG N
Sbjct: 306 SKDPEIKRFLGTE--GNLGQGIGLTNDFAARIIKHVGNYGEIYDRSLGSKTKLNLPRGQN 363

Query: 328 ALWSKGGLMYAPPIR 342
            L+SKGGL+Y+PP R
Sbjct: 364 ELYSKGGLLYSPPFR 378


>gi|89053118|ref|YP_508569.1| lysine-arginine-ornithine-binding periplasmic protein [Jannaschia
           sp. CCS1]
 gi|88862667|gb|ABD53544.1| L-glutamine-binding protein / L-glutamate-binding protein /
           L-asparagine-binding protein / L-aspartate-binding
           protein [Jannaschia sp. CCS1]
          Length = 338

 Score =  332 bits (851), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 152/342 (44%), Positives = 222/342 (64%), Gaps = 4/342 (1%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           M K  F+  L +  L  ++   +A  LG++++RG L CG++TGL GF+   ANG+W+GFD
Sbjct: 1   MKKSVFLGTLAVAGL--SAGFVSAQTLGEVQERGTLNCGVSTGLTGFSAPDANGEWQGFD 58

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
           V  CRA+++A+  D   ++++P   + RF AL S +ID+L+RNT WT  R++ L   F  
Sbjct: 59  VSVCRAVAAAVLGDAGAVEFVPTTGQTRFTALSSGEIDMLARNTTWTFSRDVDLAFEFVG 118

Query: 121 ITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVE 180
           + Y+DGQGF++ ++ G+SS  +L GA++C+Q GTTTEL LADYF ++NM Y P+  E   
Sbjct: 119 VNYYDGQGFMVPRELGVSSALELDGATVCIQTGTTTELNLADYFSSNNMSYEPVPIETNA 178

Query: 181 EIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNI 240
           E    Y A  CD YT D S L A + T + PS HV+LP+I+SK PL P +  GD E+ ++
Sbjct: 179 EAQQQYLAGACDVYTTDASGLAATRATFEDPSAHVVLPEIVSKEPLGPLVRHGDNEFGDV 238

Query: 241 VSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRII 300
           V WT  A++ AEELG+T  N+ ++   T NP+++R LG +   N+GE LGL   W    I
Sbjct: 239 VRWTLNALIAAEELGVTSANVGEIGGTTENPEIRRLLGTE--GNLGEMLGLDAGWAAAAI 296

Query: 301 RHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
              GNYGE+FDR++G  + + + RG NA W+ GGL+YAPP R
Sbjct: 297 GAGGNYGEIFDRHIGESTPIGLARGLNAQWTDGGLLYAPPFR 338


>gi|304391889|ref|ZP_07373831.1| general L-amino acid-binding periplasmic protein AapJ [Ahrensia sp.
           R2A130]
 gi|303296118|gb|EFL90476.1| general L-amino acid-binding periplasmic protein AapJ [Ahrensia sp.
           R2A130]
          Length = 342

 Score =  332 bits (850), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 154/327 (47%), Positives = 214/327 (65%), Gaps = 2/327 (0%)

Query: 17  FTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIF-DDP 75
            T    +A+ L D+K +GFL+CG++TG  GFA     G+W+GFD   CRA+++AIF  D 
Sbjct: 17  MTGTVASAATLDDVKAKGFLQCGVSTGFPGFAFTDDAGNWQGFDPALCRAMAAAIFAGDS 76

Query: 76  SKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKK 135
           + +++ P   K RF AL S ++D+L+RNT  T  R++ L   F P+ Y+DGQGF++ K  
Sbjct: 77  NAVKFTPTTGKTRFTALASGEVDVLARNTTETFSRDVDLKFTFGPVNYYDGQGFMVRKSL 136

Query: 136 GISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYT 195
           G++S   LSGA+ICVQ GTTTEL LADYF+A+NM Y P+  E   E    Y A+ CDAYT
Sbjct: 137 GVTSALNLSGATICVQTGTTTELNLADYFRANNMTYEPVPIETNAEAQEKYLANACDAYT 196

Query: 196 GDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELG 255
            D S L A +   + P++H+ILP+IISK PL P + QGD +W +I+ WT  A++TAEE G
Sbjct: 197 TDASGLSATRSAFEAPNDHMILPEIISKEPLGPLVRQGDDQWADILKWTLLALITAEEKG 256

Query: 256 ITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLG 315
           +T  N +++   +T+PD+QR LG  +    G  LGL  DW    I+  GNYGE+F + LG
Sbjct: 257 VTAANADEMKASSTDPDIQRLLGATEDG-FGAMLGLDNDWALNAIKAGGNYGEIFAKYLG 315

Query: 316 NQSELKIPRGYNALWSKGGLMYAPPIR 342
             + + I RG NAL++ GGLMYA PIR
Sbjct: 316 TDTAVGIERGLNALYTDGGLMYAAPIR 342


>gi|146278537|ref|YP_001168696.1| cationic amino acid ABC transporter, periplasmic binding protein
           [Rhodobacter sphaeroides ATCC 17025]
 gi|145556778|gb|ABP71391.1| cationic amino acid ABC transporter, periplasmic binding protein
           [Rhodobacter sphaeroides ATCC 17025]
          Length = 338

 Score =  331 bits (849), Expect = 9e-89,   Method: Compositional matrix adjust.
 Identities = 150/342 (43%), Positives = 221/342 (64%), Gaps = 4/342 (1%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           M K  F+  L +  L   +   +A+ L D+K RG L CG++TGL GF+   ANG+W GFD
Sbjct: 1   MKKSVFLGTLTVAGL--AAGLGSAATLDDVKARGELNCGVSTGLTGFSLPDANGNWTGFD 58

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
           V  CRA+++A+  D +K++++P   + RF AL S ++D+L+RN+ WT  R+  L L F  
Sbjct: 59  VALCRAVAAAVLGDGTKVKFVPTTGQTRFTALASGEVDMLARNSTWTFSRDTDLKLDFVG 118

Query: 121 ITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVE 180
           + Y+DGQGF++ K  G++S  +L GA++C+Q GTTTEL LAD+FK +N+ Y P+  E   
Sbjct: 119 VNYYDGQGFMVRKDLGVTSAKELDGATVCIQTGTTTELNLADWFKVNNLSYTPVAVETNA 178

Query: 181 EIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNI 240
           E +  Y A  CDAYT D S L A +     P  HVILP+IISK PL PA+  GD EW ++
Sbjct: 179 EGEQQYAAGACDAYTTDASGLAATRAAFADPENHVILPEIISKEPLGPAVRHGDNEWADV 238

Query: 241 VSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRII 300
           V WT  A++ AEE G+T  N+ +++ ++ NP+++R LG++   ++G  + L KDW  R I
Sbjct: 239 VGWTLNALIAAEEYGVTSTNMEELAANSPNPEIRRLLGVE--GDLGPMIRLDKDWAKRAI 296

Query: 301 RHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
              GNYGE+F   +G  + + + RG NA W++GGL+YAPP R
Sbjct: 297 SVGGNYGEIFAATIGEATPIGLARGLNAQWTQGGLLYAPPFR 338


>gi|17231656|ref|NP_488204.1| periplasmic amino acid-binding protein of amino acid ABC
           transporter [Nostoc sp. PCC 7120]
 gi|17133299|dbj|BAB75863.1| periplasmic amino acid-binding protein of amino acid ABC
           transporter [Nostoc sp. PCC 7120]
          Length = 369

 Score =  331 bits (849), Expect = 9e-89,   Method: Compositional matrix adjust.
 Identities = 151/313 (48%), Positives = 216/313 (69%), Gaps = 3/313 (0%)

Query: 30  IKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERF 89
           IK RG L CG++  + GF+ V  +G++ G DVD CRA+++A+FD+P  +++  L+AKERF
Sbjct: 60  IKNRGQLICGVSGEVPGFSFVGTDGEYSGIDVDVCRAIAAALFDNPDAVEFRNLSAKERF 119

Query: 90  LALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASIC 149
            ALQ+ ++DILSRNT WTL R  S+GL F P+ ++DGQ  ++ K   I S++ L   +IC
Sbjct: 120 TALQTGEVDILSRNTTWTLSRATSVGLEFAPVVFYDGQAIMVRKNSAIKSLADLKDKAIC 179

Query: 150 VQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTND 209
           VQ GTTTE  LAD  +  N+ Y P+VFE V    A Y   RCDA T D SAL + + T  
Sbjct: 180 VQTGTTTEQNLADQMRKRNITYKPVVFEDVNVTFATYAEGRCDAITADRSALVSRRTTLP 239

Query: 210 RPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTT 269
            P ++V+L ++IS  PLAPA+ +GD +W N V+W  YA++  EELGI  +N+ Q +  + 
Sbjct: 240 TPEDNVVLDEVISSEPLAPAVARGDAKWSNTVNWVVYALIKGEELGINAQNLGQFTT-SN 298

Query: 270 NPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNAL 329
           +PDV+RFLG +   ++G+ LGLT D+  RII+H+GNY E++DRNLG +++L + RG N L
Sbjct: 299 DPDVKRFLGTE--GDLGQGLGLTNDFAARIIKHVGNYAEVYDRNLGPKTKLNLARGQNQL 356

Query: 330 WSKGGLMYAPPIR 342
           WSKGGL+Y+PP R
Sbjct: 357 WSKGGLLYSPPFR 369


>gi|293602040|ref|ZP_06684495.1| amino acid ABC superfamily ATP binding cassette transporter,
           binding protein [Achromobacter piechaudii ATCC 43553]
 gi|292819570|gb|EFF78596.1| amino acid ABC superfamily ATP binding cassette transporter,
           binding protein [Achromobacter piechaudii ATCC 43553]
          Length = 361

 Score =  330 bits (846), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 151/329 (45%), Positives = 227/329 (68%), Gaps = 4/329 (1%)

Query: 15  LFFTSFSTNASILGD-IKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFD 73
           LF +S++  A +  D +K +GF++CG++TG+ GF+   + G W G DVD CRAL+  +F 
Sbjct: 36  LFLSSWAATAGVTFDSVKNKGFVQCGVSTGVAGFSVNDSKGGWIGLDVDLCRALAITMFG 95

Query: 74  DPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHK 133
           DP+K + + ++A +RF ALQS ++D+L RNT  +L R+ +LGL    + Y+D QG +++K
Sbjct: 96  DPAKSKIMAVSAVQRFTALQSGEVDVLPRNTTLSLTRDTTLGLIGVGVNYYDSQGIMVNK 155

Query: 134 KKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDA 193
              + S  +L GA++CVQ GTTTEL LAD+F++ N+ + P+V ER++EI  A+   RCDA
Sbjct: 156 SLNVKSAKELDGATVCVQPGTTTELNLADWFRSQNIVFKPVVVERLDEIIRAFAVGRCDA 215

Query: 194 YTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEE 253
           +TGD S L A +   + P ++ ILP+  SK PL P + QGD +W+N+V WT +AM+ AEE
Sbjct: 216 FTGDKSQLAAARSNLENPGQYDILPENFSKEPLGPMVRQGDEQWFNVVRWTMFAMLEAEE 275

Query: 254 LGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRN 313
            G+T KN++++ K +TNP+VQR LG+  +  +G+ LG+   W Y II+H+GNYGE F++N
Sbjct: 276 YGVTSKNVDEMLK-STNPNVQRLLGV--TPGMGKNLGVDDKWAYNIIKHIGNYGESFEKN 332

Query: 314 LGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           LG  S LK+ RG NA +  GGLMY  P+R
Sbjct: 333 LGPSSPLKLSRGLNASYRDGGLMYGWPVR 361


>gi|254463676|ref|ZP_05077087.1| glutamate/glutamine/aspartate/asparagine ABC transporter,
           periplasmic substrate-binding protein [Rhodobacterales
           bacterium Y4I]
 gi|206684584|gb|EDZ45066.1| glutamate/glutamine/aspartate/asparagine ABC transporter,
           periplasmic substrate-binding protein [Rhodobacterales
           bacterium Y4I]
          Length = 338

 Score =  330 bits (846), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 154/316 (48%), Positives = 213/316 (67%), Gaps = 2/316 (0%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           L D+K RG L CG+ TGLVGFA   ANG+W+GFDV  CRA+++A+  D + ++++P   K
Sbjct: 25  LDDVKARGKLNCGVTTGLVGFAAPNANGEWEGFDVAVCRAVAAAVLGDSTAVEFVPTTGK 84

Query: 87  ERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGA 146
            RF AL S +ID+L+RNT WT  R++ L   F  + Y+DGQGF++ K+ G+SS  +L GA
Sbjct: 85  TRFTALASGEIDMLARNTTWTFSRDVDLKFEFVGVNYYDGQGFMVPKELGVSSAKELDGA 144

Query: 147 SICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKL 206
           ++C+Q GTTTEL LAD+F+++N+ Y P+  E   E    Y A  CD YT D S L A + 
Sbjct: 145 TVCIQTGTTTELNLADFFRSNNISYEPVPIETNAEAQQQYLAGSCDVYTTDASGLAATRA 204

Query: 207 TNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSK 266
           T D PS HVILP+IISK PL P +  GD EW ++V W+  A++ AEELGIT  NIN+++ 
Sbjct: 205 TFDDPSGHVILPEIISKEPLGPLVRHGDHEWGDVVRWSLMALIAAEELGITSANINEMAA 264

Query: 267 DTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGY 326
            T NP++ R LG     N+GE LGL  DW  + +   GNYGE+F +N+G  + + + RG 
Sbjct: 265 GTENPEINRLLG--SEGNLGEMLGLNADWAMKAVAAGGNYGEIFAKNIGEDTPVGLARGL 322

Query: 327 NALWSKGGLMYAPPIR 342
           NA W++GGL+YAPP R
Sbjct: 323 NAQWTEGGLLYAPPFR 338


>gi|83854941|ref|ZP_00948471.1| glutamate/glutamine/aspartate/asparagine ABC transporter,
           periplasmic substrate-binding protein [Sulfitobacter sp.
           NAS-14.1]
 gi|83941464|ref|ZP_00953926.1| glutamate/glutamine/aspartate/asparagine ABC transporter,
           periplasmic substrate-binding protein [Sulfitobacter sp.
           EE-36]
 gi|83842784|gb|EAP81951.1| glutamate/glutamine/aspartate/asparagine ABC transporter,
           periplasmic substrate-binding protein [Sulfitobacter sp.
           NAS-14.1]
 gi|83847284|gb|EAP85159.1| glutamate/glutamine/aspartate/asparagine ABC transporter,
           periplasmic substrate-binding protein [Sulfitobacter sp.
           EE-36]
          Length = 347

 Score =  330 bits (846), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 152/318 (47%), Positives = 212/318 (66%), Gaps = 2/318 (0%)

Query: 25  SILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLN 84
           S L D+K RG L CG+ TGL GFA   ANG+W+GFDV  CRA+++A+  DP+ ++++P  
Sbjct: 32  STLDDVKARGKLNCGVTTGLAGFAAPNANGEWEGFDVAVCRAVAAAVLGDPAAVEFIPTT 91

Query: 85  AKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLS 144
            K RF AL S +ID L+RNT WT  R++ L   F  + Y+DGQGF++ K+ G+SS   L 
Sbjct: 92  GKTRFTALASGEIDFLARNTTWTFSRDVDLKFDFIGVNYYDGQGFMVPKELGVSSAKDLD 151

Query: 145 GASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYAL 204
           GA++C+Q GTTTEL LAD+F+ +N+ Y P+  E   E    Y A  CD YT D S L A 
Sbjct: 152 GATVCIQTGTTTELNLADFFRNNNISYEPVPVETNAEGQQQYLAGACDTYTTDASGLAAT 211

Query: 205 KLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQV 264
           + T + P EH+ILP+IISK PL P +  GD +W ++  W  YA++ AEELG+T  N+ ++
Sbjct: 212 RATFENPGEHIILPEIISKEPLGPLVRHGDNDWGDVTRWVLYALIAAEELGVTSANVEEM 271

Query: 265 SKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPR 324
           + +TTNP+V R LG + +  +GE LGL  DW  + I   GNYGE+F +N+G ++ + + R
Sbjct: 272 TTNTTNPEVARLLGTEGT--LGEMLGLEADWAKKAIASQGNYGEIFAKNIGEETPIGLAR 329

Query: 325 GYNALWSKGGLMYAPPIR 342
           G NA W+ GGLMYAPP R
Sbjct: 330 GLNAQWTDGGLMYAPPFR 347


>gi|259415913|ref|ZP_05739833.1| glutamate/glutamine/aspartate/asparagine-binding protein
           bztAprecursor [Silicibacter sp. TrichCH4B]
 gi|259347352|gb|EEW59129.1| glutamate/glutamine/aspartate/asparagine-binding protein
           bztAprecursor [Silicibacter sp. TrichCH4B]
          Length = 378

 Score =  330 bits (845), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 154/316 (48%), Positives = 212/316 (67%), Gaps = 2/316 (0%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           L D+K R  L CG++TGLVGF+   ANG+W+GFD+  CRA+++A+  DPSK++Y+P   K
Sbjct: 65  LDDVKARDKLNCGVSTGLVGFSAPNANGEWEGFDIAVCRAVAAAVLGDPSKVEYVPTTGK 124

Query: 87  ERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGA 146
            RF AL S ++D+L+RNT WT  R++ L   F  + Y+DGQGF++ K+ G+SS  +L GA
Sbjct: 125 TRFTALASGEVDVLARNTTWTFSRDVDLKFEFIGVNYYDGQGFMIPKELGVSSAKELDGA 184

Query: 147 SICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKL 206
           ++C+Q GTTTEL LAD+F+A+N+ Y P+  E   E    Y A  CD YT D S L A + 
Sbjct: 185 TVCIQTGTTTELNLADFFRANNISYEPVPIETNAEARQQYLAGACDVYTTDASGLAATRA 244

Query: 207 TNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSK 266
           T D PS HVILP+IISK PL P +  GD EW ++V WT  A+V AEELGIT  N+++ + 
Sbjct: 245 TFDDPSNHVILPEIISKEPLGPLVRHGDNEWGDVVRWTLNALVAAEELGITSANMSEKAA 304

Query: 267 DTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGY 326
            T NP++ R LG     N+GE LGL  DW  + +   GNYGE+F + +G  + + + RG 
Sbjct: 305 GTDNPEINRLLG--SEGNLGEMLGLDADWAQKALAAGGNYGEIFAKTIGEDTPVGLARGL 362

Query: 327 NALWSKGGLMYAPPIR 342
           NA W+ GGL+YAPP R
Sbjct: 363 NAQWTDGGLLYAPPFR 378


>gi|163859070|ref|YP_001633368.1| putative extracellular solute-binding protein [Bordetella petrii
           DSM 12804]
 gi|163262798|emb|CAP45101.1| putative extracellular solute-binding protein [Bordetella petrii]
          Length = 338

 Score =  330 bits (845), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 151/336 (44%), Positives = 226/336 (67%), Gaps = 4/336 (1%)

Query: 8   SILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRAL 67
           S++   +L        A+ L  ++KRG L+CG  TG  GF+   A G W+G DVD CRA+
Sbjct: 6   SLIGATLLLGAMAGAQAATLDVVQKRGELRCGTTTGFAGFSAPDAQGVWRGLDVDLCRAV 65

Query: 68  SSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQ 127
           ++A+F D +KI+ +PLN+++RF ALQS +ID+L+RNT  T  R+ +LG+    I ++DGQ
Sbjct: 66  AAAVFGDANKIKIVPLNSQQRFTALQSGEIDVLTRNTTVTQQRDTALGIIHAGINFYDGQ 125

Query: 128 GFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYR 187
           GF++ K  G+ S ++L+GA+IC+Q GT+ E TLAD+ +AHN+ Y P+V E   E+  A+ 
Sbjct: 126 GFLVPKSLGVQSATELNGATICLQTGTSNENTLADWARAHNVSYKPVVIETFNEVVNAFA 185

Query: 188 AHRCDAYTGDISALYALKLTN-DRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHY 246
           + RCD ++ D S L +++++    P ++++LP+IISK PL P + QGD  W N+V W+  
Sbjct: 186 SGRCDVFSTDASGLASIRISKLQNPDDYLVLPEIISKEPLGPFVRQGDDAWLNVVHWSLS 245

Query: 247 AMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNY 306
           AM+ AEE GIT  N++Q    + NP+++R LG+   +  G  +GL + W Y II+ +GNY
Sbjct: 246 AMIEAEEYGITSANVDQ-QLQSANPNIRRMLGVTPGA--GANMGLDEKWAYNIIKQVGNY 302

Query: 307 GEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           GE F+RN+G  S LKI RG NA W++GGLMYA PIR
Sbjct: 303 GESFERNVGAGSPLKIKRGLNAQWTQGGLMYALPIR 338


>gi|298491367|ref|YP_003721544.1| family 1 extracellular solute-binding protein ['Nostoc azollae'
           0708]
 gi|298233285|gb|ADI64421.1| extracellular solute-binding protein family 3 ['Nostoc azollae'
           0708]
          Length = 355

 Score =  330 bits (845), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 149/313 (47%), Positives = 217/313 (69%), Gaps = 3/313 (0%)

Query: 30  IKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERF 89
           +K RG L CG++  L GF+ V  +  + G DVD CRA+++A+FD+P  +++  LN KERF
Sbjct: 46  VKNRGKLICGVSGELPGFSFVGTDAKYSGIDVDVCRAVTAALFDNPDAVEFRNLNTKERF 105

Query: 90  LALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASIC 149
            ALQ+ +ID+LSRNT WT+ RE S+GL F P+ ++DGQ  ++ K  GI S++ L   +IC
Sbjct: 106 TALQTGEIDLLSRNTTWTMSRETSVGLQFAPVIFYDGQAIMVSKNSGIKSLADLKNKAIC 165

Query: 150 VQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTND 209
            Q GTTTE  LAD  +  ++ Y P+VFE V    A Y   RCD  T D SAL + + T  
Sbjct: 166 TQTGTTTEQNLADQMRKRSITYKPVVFEDVNITFATYAEGRCDGVTTDRSALISRRTTLP 225

Query: 210 RPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTT 269
           +P +++IL +++S  PLAPA+ +GD +W +IV W  Y++V AEELGI  +NI Q++ ++ 
Sbjct: 226 KPEDNIILDELLSSEPLAPAVAKGDPQWNDIVKWVVYSLVKAEELGINSQNIAQLT-NSN 284

Query: 270 NPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNAL 329
           +PD++RFLG +   N+GE LGLT D+  RI++H+GNYGE++DRNLG +++L +PRG N L
Sbjct: 285 DPDIKRFLGTE--GNLGEGLGLTNDFAARIVKHVGNYGEVYDRNLGGKTKLNLPRGQNQL 342

Query: 330 WSKGGLMYAPPIR 342
             KGGL+Y+PP R
Sbjct: 343 AIKGGLLYSPPFR 355


>gi|154245585|ref|YP_001416543.1| extracellular solute-binding protein [Xanthobacter autotrophicus
           Py2]
 gi|154159670|gb|ABS66886.1| extracellular solute-binding protein family 3 [Xanthobacter
           autotrophicus Py2]
          Length = 337

 Score =  329 bits (844), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 148/313 (47%), Positives = 210/313 (67%), Gaps = 3/313 (0%)

Query: 30  IKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERF 89
           +K RG L CG++ GL GF+   A+G W GFDVD CR L++AIF+DP+K++++PL+A ERF
Sbjct: 28  VKDRGELVCGVSKGLPGFSAPDASGKWTGFDVDVCRGLAAAIFNDPNKVKFVPLSADERF 87

Query: 90  LALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASIC 149
            AL    +D+LSRN+ WTL RE  LGL F  I Y+DGQGF++   + ++S  +L  + +C
Sbjct: 88  PALTKGDVDMLSRNSTWTLEREAKLGLLFTAINYYDGQGFLVRDARKVTSALELDKSKVC 147

Query: 150 VQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTND 209
           VQAGTT E    DYF A+ M    +      ++  AY   +CD  T D+S LYAL+LT  
Sbjct: 148 VQAGTTAEDNTKDYFAANGMTLELVTLPTSTDLVKAYEEGKCDTLTTDVSQLYALRLTMA 207

Query: 210 RPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTT 269
           +P +H++LPD+ISK PL P + QGD +W+N+V WT + M+ AEELG++   I+  +  + 
Sbjct: 208 KPGDHIVLPDVISKEPLGPVVRQGDDQWFNLVKWTIFGMINAEELGVSTTTID-AALASK 266

Query: 270 NPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNAL 329
            P+V R +G D     GE LG++ D+  RI++ +GNYGE F+RN+G  S+L IPRG N L
Sbjct: 267 KPEVIRLVGND--GKFGEQLGVSNDFVVRIVKAVGNYGESFERNVGAASKLGIPRGINQL 324

Query: 330 WSKGGLMYAPPIR 342
           WS GG+ YAPP+R
Sbjct: 325 WSMGGIQYAPPVR 337


>gi|197105093|ref|YP_002130470.1| lysine-arginine-ornithine-binding periplasmic protein
           [Phenylobacterium zucineum HLK1]
 gi|196478513|gb|ACG78041.1| lysine-arginine-ornithine-binding periplasmic protein
           [Phenylobacterium zucineum HLK1]
          Length = 337

 Score =  328 bits (842), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 146/324 (45%), Positives = 221/324 (68%), Gaps = 4/324 (1%)

Query: 21  STNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQY 80
           +T +  L  +++RG + CG++ GL GFA   A G W+GFDVD CRA+++A+F D  ++++
Sbjct: 16  ATPSPTLEAVRRRGRVTCGVHPGLPGFAMRDARGIWRGFDVDVCRAVAAAVFGDAERVRF 75

Query: 81  LPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSV 140
           +P++  +RF  L++++IDILSRNT  TL R+  LGL F   TY+DGQGF++ +  G++S 
Sbjct: 76  VPIDGSDRFRELRAERIDILSRNTSLTLSRDAGLGLTFPATTYYDGQGFLVARALGVASA 135

Query: 141 SQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISA 200
            +L GA +CVQAGT +E  LAD+F+A  + Y P++ +  E+    Y +  CD ++ DIS 
Sbjct: 136 EELGGARVCVQAGTASETNLADFFRARGLDYQPVLAKSEEDARRLYESDGCDVFSADISG 195

Query: 201 LYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKN 260
           L A +     P+ HVILP++ISK PL P + Q D  W +IV+WT +A+V AEELG++ + 
Sbjct: 196 LAASRSLLSNPNGHVILPNVISKEPLGPVVRQDDPAWADIVAWTVHAIVLAEELGLSSRT 255

Query: 261 INQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSEL 320
           + Q  +  T+P+ +R LG++   N+GE LG+ +DW Y++IR +G Y E+F R+LG  S L
Sbjct: 256 VEQARETATDPETRRLLGVE--GNLGELLGVRRDWAYQVIRQVGAYHEIFRRDLGADSAL 313

Query: 321 KIPRGYNALWS--KGGLMYAPPIR 342
           K+ RG NALW+  K GLMYAPP+R
Sbjct: 314 KLERGLNALWTAPKPGLMYAPPVR 337


>gi|148658095|ref|YP_001278300.1| extracellular solute-binding protein [Roseiflexus sp. RS-1]
 gi|148570205|gb|ABQ92350.1| extracellular solute-binding protein, family 3 [Roseiflexus sp.
           RS-1]
          Length = 389

 Score =  328 bits (842), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 152/316 (48%), Positives = 210/316 (66%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           L  I+ RG L CG+N+ + GF  V   G + GFD+D+C+AL++AIF+D SK++Y PL A+
Sbjct: 74  LKAIQARGKLICGVNSQVPGFGFVDPTGAFSGFDIDYCKALAAAIFNDVSKVEYRPLTAE 133

Query: 87  ERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGA 146
           +RF ALQS +ID+L RNT WTL R+   G  F   T++DGQG ++ K   I+ +  L+GA
Sbjct: 134 QRFAALQSGEIDVLIRNTTWTLTRDTDNGGNFVATTFYDGQGIMVPKASNITKLEDLNGA 193

Query: 147 SICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKL 206
           +ICVQ GTTTEL LAD   A  ++Y P VFE      AAY   RCDA T D S L + + 
Sbjct: 194 TICVQKGTTTELNLADQMAARKLQYTPAVFEDANSTFAAYAEERCDAVTTDKSGLVSRRS 253

Query: 207 TNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSK 266
               P +HVIL   +SK PL P + QGD +W++IV WT +A   AEE GIT +N++Q  +
Sbjct: 254 VLPNPDDHVILDVTLSKEPLGPMVRQGDDQWFDIVQWTVFATFAAEEFGITSRNVDQAKE 313

Query: 267 DTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGY 326
             T P+V+R LG D + ++G  LGL+KDW   +I+ +GNY E++DRNLG  ++  IPRG 
Sbjct: 314 SDTRPEVRRLLGADPNVDLGAKLGLSKDWAANVIKSVGNYAEIYDRNLGPNTKTAIPRGI 373

Query: 327 NALWSKGGLMYAPPIR 342
           N L+++GGL+YAPP R
Sbjct: 374 NNLYTQGGLLYAPPFR 389


>gi|317401305|gb|EFV81945.1| amino acid-binding periplasmic protein [Achromobacter xylosoxidans
           C54]
          Length = 338

 Score =  328 bits (841), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 147/330 (44%), Positives = 225/330 (68%), Gaps = 4/330 (1%)

Query: 14  ILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFD 73
           +L   +    A+ L  +++RG + CG  TG  GF+   A G W+G DVD CRA+++A+F 
Sbjct: 12  LLLAVAQGAQAATLDVVRQRGAVACGTTTGFAGFSAPDAQGKWQGLDVDLCRAIAAAVFG 71

Query: 74  DPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHK 133
           D +KI+ +PLN+++RF ALQS ++D+L+RNT  T  R+ +LG+    I ++DGQGF++ K
Sbjct: 72  DANKIKVVPLNSQQRFTALQSGEVDVLTRNTTVTQQRDTALGIIHAGINFYDGQGFLVPK 131

Query: 134 KKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDA 193
             G+ S  +++GA+IC+Q GT+ E TLAD+ +A+N+ Y P+V E   E+  A+ A RCD 
Sbjct: 132 SLGVKSAKEINGATICLQTGTSNENTLADWARANNVTYKPVVIETFNEVVNAFAAGRCDV 191

Query: 194 YTGDISALYALKLTN-DRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAE 252
           ++ D S L +++++    P ++V+LP+IISK PL P + QGD  W NIV W+  AM+ AE
Sbjct: 192 FSTDASGLASIRISKLQNPDDYVVLPEIISKEPLGPFVRQGDDAWLNIVRWSLSAMIEAE 251

Query: 253 ELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDR 312
           E G+T +N+++ +K ++NP+++R LG+      G  LGL + W Y I++ +GNYGE F+R
Sbjct: 252 EYGVTSRNVDEQAK-SSNPNIKRILGVTPGG--GANLGLDEKWAYNIVKQVGNYGESFER 308

Query: 313 NLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           N+G  S LKI RG NA W++GGLMYA PIR
Sbjct: 309 NVGQGSPLKIKRGLNAQWTQGGLMYALPIR 338


>gi|156741438|ref|YP_001431567.1| extracellular solute-binding protein [Roseiflexus castenholzii DSM
           13941]
 gi|156232766|gb|ABU57549.1| extracellular solute-binding protein family 3 [Roseiflexus
           castenholzii DSM 13941]
          Length = 389

 Score =  328 bits (841), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 152/313 (48%), Positives = 209/313 (66%)

Query: 30  IKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERF 89
           I+ RG L CG+N+ + GF  V   G + GFD+D+C+AL++AIF+D SKI+Y PL A++RF
Sbjct: 77  IQARGKLICGVNSQVPGFGFVDPTGAFSGFDIDYCKALAAAIFNDVSKIEYRPLTAEQRF 136

Query: 90  LALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASIC 149
            ALQS +ID+L RNT WTL R+   G  F   T++DGQG ++ K   I+ +  L+GA+IC
Sbjct: 137 AALQSGEIDVLIRNTTWTLTRDTDNGGNFVATTFYDGQGIMVPKASNITKLEDLNGATIC 196

Query: 150 VQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTND 209
           VQ GTTTEL LAD   A N+ Y P  FE      AAY   RCDA T D S L + +    
Sbjct: 197 VQKGTTTELNLADQMNARNLAYTPATFEDANSTFAAYAEERCDAVTTDKSGLVSRRSVLP 256

Query: 210 RPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTT 269
            P +HVIL   +SK PL P + QGD +W++IV W  +A   AEE GIT +N++Q+ +  T
Sbjct: 257 NPDDHVILDVTLSKEPLGPMVRQGDDQWFDIVQWAVFATFAAEEFGITSQNVDQLKETDT 316

Query: 270 NPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNAL 329
            P+V+R LG D + ++G  LGL+KDW   +I+ +GNYGE++DRNLG  ++  IPRG N L
Sbjct: 317 RPEVRRLLGADPNVDLGAKLGLSKDWAANVIKAVGNYGEIYDRNLGPNTKTAIPRGINNL 376

Query: 330 WSKGGLMYAPPIR 342
           +++GGL+YAPP R
Sbjct: 377 YTQGGLLYAPPFR 389


>gi|126737042|ref|ZP_01752777.1| glutamate/glutamine/aspartate/asparagine ABC transporter,
           periplasmic substrate-binding protein [Roseobacter sp.
           SK209-2-6]
 gi|126721627|gb|EBA18330.1| glutamate/glutamine/aspartate/asparagine ABC transporter,
           periplasmic substrate-binding protein [Roseobacter sp.
           SK209-2-6]
          Length = 338

 Score =  328 bits (841), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 151/316 (47%), Positives = 215/316 (68%), Gaps = 2/316 (0%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           L D+K RG L CG+ TGLVGFA   ANG+W+GFDV  CRA+++A   D + ++++P   K
Sbjct: 25  LDDVKARGKLNCGVTTGLVGFAAPNANGEWEGFDVAVCRAVAAAALGDSTAVEFVPTTGK 84

Query: 87  ERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGA 146
            RF AL S +ID+L+RNT WT  R++ L   F  + Y+DGQGF++ K+ G+SS  +L GA
Sbjct: 85  TRFTALASGEIDMLARNTTWTFSRDVDLKFEFTGVNYYDGQGFMVPKELGVSSAKELDGA 144

Query: 147 SICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKL 206
           ++C+Q GTTTEL LAD+F+++N+ Y P+  E   E    Y A  CD YT D S L A + 
Sbjct: 145 TVCIQTGTTTELNLADFFRSNNISYEPVPIETNAEAQQQYLAGACDVYTTDASGLAATRA 204

Query: 207 TNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSK 266
           T D P++HV+LP+IISK PL P +  GD EW ++V WT  A++TAEELG+T  NI ++S 
Sbjct: 205 TFDAPADHVLLPEIISKEPLGPLVRHGDHEWGDVVRWTLNALITAEELGVTSANIAEMSA 264

Query: 267 DTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGY 326
            T+NP++ R LG + +  +GE LGL+ DW    +   GNYGE+F +N+G  + + + RG 
Sbjct: 265 GTSNPEINRLLGTEGT--LGEMLGLSADWGKNAVAAGGNYGEVFAKNIGEDTPIGLARGL 322

Query: 327 NALWSKGGLMYAPPIR 342
           NA W++GGL+Y+PP R
Sbjct: 323 NAQWTEGGLLYSPPFR 338


>gi|77462291|ref|YP_351795.1| ABC glutamate/glutamine/aspartate/asparagine transporter,
           periplasmic substrate-binding protein [Rhodobacter
           sphaeroides 2.4.1]
 gi|221638145|ref|YP_002524407.1| Cationic amino acid ABC transporter periplasmic binding protein
           [Rhodobacter sphaeroides KD131]
 gi|77386709|gb|ABA77894.1| ABC glutamate/glutamine/aspartate/asparagine transporter,
           periplasmic substrate-binding protein [Rhodobacter
           sphaeroides 2.4.1]
 gi|221158926|gb|ACL99905.1| Cationic amino acid ABC transporter, periplasmic binding protein
           precursor [Rhodobacter sphaeroides KD131]
          Length = 338

 Score =  327 bits (839), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 149/342 (43%), Positives = 219/342 (64%), Gaps = 4/342 (1%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           M K  F+  L   +    +   +A+ L D+K RG L CG++TGL GF+   ANG+W GFD
Sbjct: 1   MTKSVFLGTLT--VAGLAAGLASAATLDDVKARGELNCGVSTGLTGFSLPDANGNWTGFD 58

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
           V  CRA+++A+  D +K++++P   + RF AL S ++D+L+RN+ WT  R+  L L F  
Sbjct: 59  VSLCRAVAAAVLGDGTKVKFVPTTGQTRFTALASGEVDMLARNSTWTFSRDTDLKLDFVG 118

Query: 121 ITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVE 180
           + Y+DGQGF++ K  G++S  +L GA++C+Q GTTTEL LAD+FK +N+ Y P+  E   
Sbjct: 119 VNYYDGQGFMVRKDLGVTSAKELDGATVCIQTGTTTELNLADWFKVNNLSYTPVAVETNA 178

Query: 181 EIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNI 240
           E +  Y A  CDAYT D S L A +     P  H+ILP+IISK PL PA+  GD EW +I
Sbjct: 179 EGEQQYAAGACDAYTTDASGLAATRAAFADPENHIILPEIISKEPLGPAVRHGDNEWADI 238

Query: 241 VSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRII 300
           V WT  A++ AEE G+T  N+ +++ ++ NP++QR LG+    ++G+ + L  DW  R I
Sbjct: 239 VRWTLNALIAAEEYGVTSANMEELAANSPNPEIQRLLGV--QGDLGKMIRLDNDWAKRAI 296

Query: 301 RHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
              GNYGE+F   +G  + + + RG NA W++GGL+YAPP R
Sbjct: 297 AVGGNYGEIFAATIGEATPIGLARGLNAQWTQGGLLYAPPFR 338


>gi|89070522|ref|ZP_01157811.1| glutamate/glutamine/aspartate/asparagine ABC transporter,
           periplasmic substrate-binding protein [Oceanicola
           granulosus HTCC2516]
 gi|89043829|gb|EAR50027.1| glutamate/glutamine/aspartate/asparagine ABC transporter,
           periplasmic substrate-binding protein [Oceanicola
           granulosus HTCC2516]
          Length = 339

 Score =  327 bits (839), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 150/317 (47%), Positives = 208/317 (65%), Gaps = 3/317 (0%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           L D+K RG L CG++TGL GF+   ANG W+GFDV FCRAL++A+  DP+ ++++P   +
Sbjct: 25  LDDVKARGTLNCGVSTGLTGFSAPDANGVWQGFDVAFCRALAAAVLGDPNAVEFVPTTGQ 84

Query: 87  ERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGA 146
            RF AL S +ID+L+RNT WT  R+  L   F  + Y+DGQGFI+ ++ G++S  +L GA
Sbjct: 85  TRFTALSSNEIDVLARNTTWTFSRDNDLKFEFAGVNYYDGQGFIVPRELGVASAMELDGA 144

Query: 147 SICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKL 206
           ++C+Q GTTTEL LAD+F+ ++M+Y P+  E   E    Y A  CDAYT D S L A + 
Sbjct: 145 TVCIQTGTTTELNLADFFRVNDMEYEPVPIETNAEAQQQYLAGACDAYTTDASGLAATRA 204

Query: 207 TNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSK 266
           T + P +HVILP+IISK PL P +  GD EW +IV WT  A++ AEE G+T  NI Q++ 
Sbjct: 205 TFENPEDHVILPEIISKEPLGPLVRHGDPEWGDIVRWTLQALIAAEEYGVTSANIEQMAS 264

Query: 267 DT-TNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRG 325
           +   N +V R LG +    +G  +GL  DW  R I   GNYGE+F+ N+G  S + + RG
Sbjct: 265 EAGDNAEVNRLLGTE--GELGAMIGLDSDWAQRAIAAGGNYGEIFENNIGESSPVGLARG 322

Query: 326 YNALWSKGGLMYAPPIR 342
            NA +S GGL+YA P R
Sbjct: 323 LNAQYSNGGLIYALPFR 339


>gi|260577146|ref|ZP_05845123.1| cationic amino acid ABC transporter, periplasmic binding protein
           [Rhodobacter sp. SW2]
 gi|259020620|gb|EEW23939.1| cationic amino acid ABC transporter, periplasmic binding protein
           [Rhodobacter sp. SW2]
          Length = 339

 Score =  327 bits (839), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 157/342 (45%), Positives = 217/342 (63%), Gaps = 3/342 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           M K  F+  L +  L   +    A  L D+K RG L CG N GL GFA   ANG+++GFD
Sbjct: 1   MKKSVFLGTLAVSGLL--AGMAAAGTLDDVKARGILNCGSNNGLTGFAAPDANGNYQGFD 58

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
              C+A+++A+  D SK++++PL  + RF AL S ++D+L RN+ WT  R+  L   F  
Sbjct: 59  AALCKAIAAAVLGDASKVKFVPLTGETRFTALASGEVDVLIRNSTWTFSRDTDLKFDFVA 118

Query: 121 ITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVE 180
           + Y+DGQGF++ K+ G+SS  +L GA++C+Q GTTTEL LAD+FK++NM Y P+      
Sbjct: 119 VNYYDGQGFMVKKELGVSSAKELDGATVCIQTGTTTELNLADFFKSNNMSYTPVTIADDS 178

Query: 181 EIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNI 240
           E    Y A  CDAYT D S L A++ T      H+ILP+IISK PL P +  GD  W +I
Sbjct: 179 EGQRQYVAGACDAYTTDASGLAAVRATLPDAENHIILPEIISKEPLGPVVRHGDNNWGDI 238

Query: 241 VSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRII 300
           V WT+YA+V+AEE GIT  N+ + +  TTNP+++R LG     N+G  +GL K+W  R I
Sbjct: 239 VRWTYYALVSAEENGITAANVEETASTTTNPEIKRLLGA-SDDNLGAMMGLDKEWAKRAI 297

Query: 301 RHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
              GNYGE+F  NLG  + + + RG NALW++GGL YAPP R
Sbjct: 298 AAQGNYGEIFAANLGESTSIGLARGLNALWTQGGLQYAPPFR 339


>gi|126461167|ref|YP_001042281.1| cationic amino acid ABC transporter, periplasmic binding protein
           [Rhodobacter sphaeroides ATCC 17029]
 gi|126102831|gb|ABN75509.1| cationic amino acid ABC transporter, periplasmic binding protein
           [Rhodobacter sphaeroides ATCC 17029]
          Length = 338

 Score =  327 bits (838), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 149/342 (43%), Positives = 219/342 (64%), Gaps = 4/342 (1%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           M K  F+  L   +    +   +A+ L D+K RG L CG++TGL GF+   ANG+W GFD
Sbjct: 1   MTKSVFLGTLT--VAGLAAGLASAATLDDVKARGELNCGVSTGLTGFSLPDANGNWTGFD 58

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
           V  CRA+++A+  D +K++++P   + RF AL S ++D+L+RN+ WT  R+  L L F  
Sbjct: 59  VSLCRAVAAAVLGDGTKVKFVPTTGQTRFTALASGEVDMLARNSTWTFSRDTDLKLDFVG 118

Query: 121 ITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVE 180
           + Y+DGQGF++ K  G++S  +L GA++C+Q GTTTEL LAD+FK +N+ Y P+  E   
Sbjct: 119 VNYYDGQGFMVRKDLGVTSAKELDGATVCIQTGTTTELNLADWFKVNNLSYTPVAVETNA 178

Query: 181 EIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNI 240
           E +  Y A  CDAYT D S L A +     P  H+ILP+IISK PL PA+  GD EW +I
Sbjct: 179 EGEQQYAAGACDAYTTDASGLAATRAAFADPENHIILPEIISKEPLGPAVRHGDNEWADI 238

Query: 241 VSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRII 300
           V WT  A++ AEE G+T  N+ +++ ++ NP++QR LG+    ++G+ + L  DW  R I
Sbjct: 239 VRWTLNALIAAEEYGVTSANMEELAANSPNPEIQRVLGV--QGDLGKMIRLDNDWAKRAI 296

Query: 301 RHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
              GNYGE+F   +G  + + + RG NA W++GGL+YAPP R
Sbjct: 297 AVGGNYGEIFAATIGEATPIGLARGLNAQWTQGGLLYAPPFR 338


>gi|82545639|ref|YP_409586.1| periplasmic binding transport protein [Shigella boydii Sb227]
 gi|81247050|gb|ABB67758.1| putative periplasmic binding transport protein [Shigella boydii
           Sb227]
          Length = 321

 Score =  327 bits (837), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 150/323 (46%), Positives = 218/323 (67%), Gaps = 18/323 (5%)

Query: 36  LKCGINTGLVGFAEVKANGDWKGFDVDF----------------CRALSSAIFDDPSKIQ 79
           ++CGI+ GL+GF+   A+G + G DVD                 CR++++A+F D +K++
Sbjct: 1   MQCGISDGLLGFSYADADGKFSGIDVDVDVDVDVDVDVDVDVDVCRSVAAAVFGDDTKVK 60

Query: 80  YLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISS 139
           Y PL AKERF ALQS ++D+LSRNT WT  R+  +G+AF  +TY+DG GF+ H K G+ S
Sbjct: 61  YTPLTAKERFTALQSGEVDLLSRNTTWTSSRDAGMGMAFTGVTYYDGIGFLTHDKAGLKS 120

Query: 140 VSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDIS 199
             +L GA++C+QAGT TEL +ADYFKA+NMKY P+ F+R +E   A  + RCD    D S
Sbjct: 121 AKELDGATVCIQAGTDTELNVADYFKANNMKYTPVTFDRSDESAKALESGRCDTLASDQS 180

Query: 200 ALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQK 259
            LYAL++    P+E ++LP++ISK PL P + +GD EW++IV WT +AM+ AEE+GI  +
Sbjct: 181 QLYALRIKLSNPAEWIVLPEVISKEPLGPVVRRGDDEWFSIVRWTLFAMLNAEEMGINSQ 240

Query: 260 NINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSE 319
           N+++ + +   PD+   LG  K  + G+ L L   W Y II+ +GNY E+F+RN+G++S 
Sbjct: 241 NVDEKAANPATPDMAHLLG--KEGDYGKDLKLDNKWAYNIIKQVGNYSEIFERNVGSESP 298

Query: 320 LKIPRGYNALWSKGGLMYAPPIR 342
           LKI RG N LW+ GG+ YAPP+R
Sbjct: 299 LKIKRGQNNLWNNGGIQYAPPVR 321


>gi|302339786|ref|YP_003804992.1| extracellular solute-binding protein family 3 [Spirochaeta
           smaragdinae DSM 11293]
 gi|301636971|gb|ADK82398.1| extracellular solute-binding protein family 3 [Spirochaeta
           smaragdinae DSM 11293]
          Length = 365

 Score =  326 bits (836), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 153/321 (47%), Positives = 215/321 (66%), Gaps = 2/321 (0%)

Query: 22  TNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYL 81
           T  S L  +K+RG +  G+  G+ G++   + G W+GFDVD  RA+++A+  DP  I+  
Sbjct: 47  TGKSTLELVKERGKVIVGVTAGVPGYSAPDSEGIWQGFDVDLGRAVAAAVLGDPDAIECR 106

Query: 82  PLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVS 141
           PL+AKERF ALQS +ID+L R T WT  R+  LG+ F  + Y+DGQGF++ K  GI+S++
Sbjct: 107 PLSAKERFTALQSGEIDVLVRVTTWTATRDSQLGVNFAGVNYYDGQGFMVAKDSGITSLA 166

Query: 142 QLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISAL 201
            L GA++ VQ+GTTTEL L+DYF+ +NM +  I FE+ ++  AA  A R DA T D S L
Sbjct: 167 DLDGATVAVQSGTTTELNLSDYFRKNNMDFELITFEKNDQASAALEAGRADAVTSDQSQL 226

Query: 202 YALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNI 261
           YAL+     P   ++LP++ISK PL P + QGD EW+NIV WT +AM+ AEE GIT  N+
Sbjct: 227 YALRTKFKEPENFIMLPELISKEPLGPVVRQGDDEWFNIVKWTLFAMLNAEEYGITSDNV 286

Query: 262 NQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELK 321
           +++ + + NP+V+R LG      + E  GL  +  Y II+++GNYGE F+RNLG+ S L 
Sbjct: 287 DEMKETSDNPNVKRLLG--SEGGVWEGFGLESNAGYNIIKYIGNYGESFERNLGSGSPLN 344

Query: 322 IPRGYNALWSKGGLMYAPPIR 342
           I RG NALW+KGG+ Y  PIR
Sbjct: 345 ISRGLNALWTKGGIQYGMPIR 365


>gi|187476710|ref|YP_784733.1| amino acid-binding periplasmic protein [Bordetella avium 197N]
 gi|115421296|emb|CAJ47801.1| amino acid-binding periplasmic protein [Bordetella avium 197N]
          Length = 338

 Score =  326 bits (836), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 153/339 (45%), Positives = 226/339 (66%), Gaps = 5/339 (1%)

Query: 6   FVSILCLIILFFTSF-STNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFC 64
             S++ L  L  T   S  A  L  +K R  + CG  TG  GF+   A G W+G DVD C
Sbjct: 3   IASLVALAALSLTGLQSAQAGTLDVVKNRDAVVCGTTTGFAGFSAPDAQGVWRGLDVDLC 62

Query: 65  RALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYF 124
           RA+++A+  D +KI+ +PLN+++RF ALQS ++D+L+RNT  T  R+ +LG+    I ++
Sbjct: 63  RAVAAAVLGDANKIKIVPLNSQQRFTALQSGEVDVLTRNTSVTQQRDTALGIIHAGINFY 122

Query: 125 DGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDA 184
           DGQGF++ KK G+ S  +L+GA+IC+Q GT+ E TLAD+ +A+N++Y P+V E   E+  
Sbjct: 123 DGQGFLVPKKLGVKSAKELNGATICLQQGTSNENTLADWARANNVQYTPVVIETFNEVVN 182

Query: 185 AYRAHRCDAYTGDISALYALKLTN-DRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSW 243
           A+ A RCD ++ D S L +++++  ++P ++++LP++ISK PL P + QGD  W NIV W
Sbjct: 183 AFAAGRCDVFSTDASGLASIRISKLEKPDDYIVLPEVISKEPLGPFVRQGDDNWLNIVYW 242

Query: 244 THYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHM 303
           T  AM+ AEE G+T  N+++  K + NP+V+R LG+   +  G  +GL   W Y I++ +
Sbjct: 243 TLTAMIEAEEYGLTSANVDEQLK-SENPNVRRILGVVPGA--GPNMGLNDKWAYNIVKQV 299

Query: 304 GNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           GNYGE FDRN+G  S LKI RG NA W+KGGLMYA PIR
Sbjct: 300 GNYGESFDRNVGKGSPLKIDRGLNAQWTKGGLMYALPIR 338


>gi|260545549|ref|ZP_05821290.1| cationic amino acid ABC transporter [Brucella abortus NCTC 8038]
 gi|260096956|gb|EEW80831.1| cationic amino acid ABC transporter [Brucella abortus NCTC 8038]
          Length = 266

 Score =  325 bits (834), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 150/267 (56%), Positives = 200/267 (74%), Gaps = 3/267 (1%)

Query: 78  IQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKK-- 135
           +++ PLNAKERF A QS ++D+L RNT WT+ R+ SLGL F  I Y+DGQGF+++ KK  
Sbjct: 1   MKFTPLNAKERFTAFQSGEVDVLIRNTTWTISRDTSLGLDFAGINYYDGQGFMINSKKLA 60

Query: 136 GISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYT 195
           GI+S  QLSGASICVQAGTTTEL +ADYF+A+ M+Y+P+VFE++EE +AAY + RCDAYT
Sbjct: 61  GINSALQLSGASICVQAGTTTELNMADYFRANKMEYNPVVFEKIEEANAAYDSGRCDAYT 120

Query: 196 GDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELG 255
            D S+LY ++L    P +HVILP+IISK P    + QGD  W ++V WTH A++ AEE G
Sbjct: 121 TDQSSLYGVRLALANPDDHVILPEIISKEPFGLTVRQGDARWADVVRWTHNALLNAEEYG 180

Query: 256 ITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLG 315
           ITQ N+ ++ K + NPD++R LG +  + IG  LGL KDW  +II+ +GNYGE+F+RN+G
Sbjct: 181 ITQANVEEMKK-SDNPDIKRLLGAEADTKIGTDLGLDKDWVVKIIKGVGNYGEIFERNIG 239

Query: 316 NQSELKIPRGYNALWSKGGLMYAPPIR 342
           + S LKI RG NA W+KGGL Y  P+R
Sbjct: 240 SGSPLKIARGLNAQWNKGGLQYGIPVR 266


>gi|110678761|ref|YP_681768.1| glutamate/glutamine/aspartate/asparagine-binding protein
           [Roseobacter denitrificans OCh 114]
 gi|109454877|gb|ABG31082.1| glutamate/glutamine/aspartate/asparagine-binding protein
           [Roseobacter denitrificans OCh 114]
          Length = 338

 Score =  325 bits (834), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 150/316 (47%), Positives = 214/316 (67%), Gaps = 2/316 (0%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           L D+K RG L CG+ TGLVGFA   A+G+W GFDV  CRA+++A+  D + ++++P   K
Sbjct: 25  LDDVKARGTLNCGVTTGLVGFAAPNADGEWNGFDVAVCRAVAAAVLGDATAVEFVPTTGK 84

Query: 87  ERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGA 146
            RF AL S +ID+L+RNT WT  R++ L   F  I Y+DGQGF++ K  G++S  +L GA
Sbjct: 85  TRFTALASGEIDMLARNTTWTFSRDVDLKFTFVGINYYDGQGFMVPKSLGVTSAKELDGA 144

Query: 147 SICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKL 206
           ++C+Q GTTTEL LAD+F+A+N+ Y P+  E   E    Y A  CD YT D S L A + 
Sbjct: 145 TVCIQTGTTTELNLADFFRANNISYEPVPIETNAEGQQQYLAGACDTYTTDASGLAATRA 204

Query: 207 TNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSK 266
           + + PS+HV+LP+IISK PL P +  GD EW ++V WT  A++TAEELG+T  N+++++ 
Sbjct: 205 SFENPSDHVLLPEIISKEPLGPLVRHGDDEWGDVVRWTLNALITAEELGVTSANVSEMAT 264

Query: 267 DTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGY 326
            + NP+V+R LG + +  +GE LGL  DW  R I   GNYGE+F +N+G  + + + RG 
Sbjct: 265 GSNNPEVKRLLGTEGT--LGEMLGLDADWAMRAIASQGNYGEIFAKNIGEDTPIALSRGL 322

Query: 327 NALWSKGGLMYAPPIR 342
           NA W+ GGL+Y+PP R
Sbjct: 323 NAQWTNGGLIYSPPFR 338


>gi|293602358|ref|ZP_06684804.1| ABC superfamily ATP binding cassette transporter, binding protein
           [Achromobacter piechaudii ATCC 43553]
 gi|292819120|gb|EFF78155.1| ABC superfamily ATP binding cassette transporter, binding protein
           [Achromobacter piechaudii ATCC 43553]
          Length = 358

 Score =  325 bits (833), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 145/314 (46%), Positives = 218/314 (69%), Gaps = 4/314 (1%)

Query: 30  IKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERF 89
           +++RG + CG  TG  GF+   A G W+G DVD CRA+++A+F D +KI+ +PLN+++RF
Sbjct: 48  VRQRGAVACGTTTGFAGFSAPDAQGKWQGLDVDLCRAIAAAVFGDANKIKVVPLNSQQRF 107

Query: 90  LALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASIC 149
            ALQS ++D+L+RNT  T  R+ +LG+    I ++DGQGF++ K  G+ S  +++GA+IC
Sbjct: 108 TALQSGEVDVLTRNTTVTQQRDTALGIIHAGINFYDGQGFLVPKSLGVKSAKEINGATIC 167

Query: 150 VQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTN- 208
           +Q GT+ E TLAD+ +A+N+ Y P+V E   E+  A+ A RCD ++ D S L +++++  
Sbjct: 168 LQTGTSNENTLADWARANNVTYKPVVIETFNEVVNAFAAGRCDVFSTDASGLASIRISKL 227

Query: 209 DRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDT 268
             P ++V+LP+IISK PL P + QGD +W NIV W+  AM+ AEE G+T KN+++   ++
Sbjct: 228 QNPDDYVVLPEIISKEPLGPFVRQGDDKWLNIVRWSLSAMIEAEEYGVTSKNVDE-QLNS 286

Query: 269 TNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNA 328
            NP+++R LG+      G  LGL + W Y I++ +GNYGE FDRN+G  S LKI RG NA
Sbjct: 287 ANPNIKRILGVTPGG--GANLGLDEKWAYNIVKQVGNYGESFDRNVGEGSPLKIKRGLNA 344

Query: 329 LWSKGGLMYAPPIR 342
            W++GGLMYA PIR
Sbjct: 345 QWTQGGLMYALPIR 358


>gi|323136410|ref|ZP_08071492.1| extracellular solute-binding protein family 3 [Methylocystis sp.
           ATCC 49242]
 gi|322398484|gb|EFY01004.1| extracellular solute-binding protein family 3 [Methylocystis sp.
           ATCC 49242]
          Length = 345

 Score =  325 bits (833), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 152/316 (48%), Positives = 209/316 (66%), Gaps = 4/316 (1%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           L +I KRGF+ CG+ T   GFAE     +W+GFDVD CRAL+SAIFDDP+K+ Y  L AK
Sbjct: 34  LSEILKRGFVICGM-TEADGFAEPLDGNEWRGFDVDICRALASAIFDDPTKVMYSALPAK 92

Query: 87  ERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGA 146
           ER  +LQ   +D+L+    WT  R+    + +  ++ +DGQ F++ +++  +S   LSG 
Sbjct: 93  ERAASLQGNWVDLLASGAPWTQSRDTGQRIIYAGVSLYDGQTFLVRRQRSFASARDLSGV 152

Query: 147 SICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKL 206
           S+CVQ GT+ ELTLAD+F      Y P  FE  EE  A Y A +CDA T D S LYA + 
Sbjct: 153 SVCVQRGTSYELTLADFFNVRKAPYEPRAFETFEEAAAGYEAGKCDALTADASMLYAARA 212

Query: 207 TNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSK 266
               P++H +LPD++SK+P  P + QGD +W NIV WT YAM+ AEEL ++  N +   K
Sbjct: 213 KFASPADHAVLPDMLSKAPRGPVVRQGDDQWLNIVRWTLYAMINAEELQVSILNADLALK 272

Query: 267 DTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGY 326
            + NPD++R +G+D   ++G  LGL K+W +RII+H+GNYG+MFDRNLG  + + + R  
Sbjct: 273 -SENPDIRRLVGVD--GDLGAGLGLAKNWAFRIIKHIGNYGDMFDRNLGPATPMAMDRRI 329

Query: 327 NALWSKGGLMYAPPIR 342
           NALWS GGLMYAPP+R
Sbjct: 330 NALWSNGGLMYAPPVR 345


>gi|163739481|ref|ZP_02146891.1| glutamate/glutamine/aspartate/asparagine ABC transporter,
           periplasmic substrate-binding protein [Phaeobacter
           gallaeciensis BS107]
 gi|161387234|gb|EDQ11593.1| glutamate/glutamine/aspartate/asparagine-binding protein BztA
           precursor [Phaeobacter gallaeciensis BS107]
          Length = 338

 Score =  325 bits (833), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 152/316 (48%), Positives = 213/316 (67%), Gaps = 2/316 (0%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           L D+K RG L CG+ TGLVGFA   ANG+W+GFDV  CRA+++A+  D + ++++P   K
Sbjct: 25  LDDVKARGKLNCGVTTGLVGFAAPNANGEWEGFDVAVCRAVAAAVLGDSTAVEFVPTTGK 84

Query: 87  ERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGA 146
            RF AL S +ID+L+RNT WT  R++ L   F  + Y+DGQGF++ K+ G+SS  +L GA
Sbjct: 85  TRFTALASGEIDMLARNTTWTFSRDVDLKFEFVGVNYYDGQGFMVPKELGVSSAKELDGA 144

Query: 147 SICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKL 206
           ++C+Q GTTTEL LAD+F+++N+ Y P+  E   E    Y A  CD YT D S L A + 
Sbjct: 145 TVCIQTGTTTELNLADFFRSNNISYEPVPIETNAEAQQQYLAGACDVYTTDASGLAATRA 204

Query: 207 TNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSK 266
           T D PS HV+LP+IISK PL P +  GD EW ++V W+  A+V AEELG+T  NI +++ 
Sbjct: 205 TFDDPSAHVLLPEIISKEPLGPLVRHGDHEWGDVVRWSLNALVAAEELGVTSANIGEMAA 264

Query: 267 DTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGY 326
            T NP++ R LG + +  +GE LGL+ DW    I   GNYGE+F +N+G  + + + RG 
Sbjct: 265 GTENPEINRLLGTEGT--LGEMLGLSADWAKNAIGAGGNYGEVFAKNIGEDTPIGLARGL 322

Query: 327 NALWSKGGLMYAPPIR 342
           NA W++GGL+YAPP R
Sbjct: 323 NAQWTEGGLLYAPPFR 338


>gi|163740274|ref|ZP_02147668.1| predicted amino-acid transporter subunit [Phaeobacter gallaeciensis
           2.10]
 gi|161386132|gb|EDQ10507.1| predicted amino-acid transporter subunit [Phaeobacter gallaeciensis
           2.10]
          Length = 338

 Score =  325 bits (833), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 152/316 (48%), Positives = 213/316 (67%), Gaps = 2/316 (0%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           L D+K RG L CG+ TGLVGFA   ANG+W+GFDV  CRA+++A+  D + ++++P   K
Sbjct: 25  LDDVKARGKLNCGVTTGLVGFAAPNANGEWEGFDVAVCRAVAAAVLGDSTAVEFVPTTGK 84

Query: 87  ERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGA 146
            RF AL S +ID+L+RNT WT  R++ L   F  + Y+DGQGF++ K+ G+SS  +L GA
Sbjct: 85  TRFTALASGEIDMLARNTTWTFSRDVDLKFEFVGVNYYDGQGFMVPKELGVSSAKELDGA 144

Query: 147 SICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKL 206
           ++C+Q GTTTEL LAD+F+++N+ Y P+  E   E    Y A  CD YT D S L A + 
Sbjct: 145 TVCIQTGTTTELNLADFFRSNNISYEPVPIETNAEAQQQYLAGACDVYTTDASGLAATRA 204

Query: 207 TNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSK 266
           T D PS HV+LP+IISK PL P +  GD EW ++V W+  A+V AEELG+T  NI +++ 
Sbjct: 205 TFDDPSAHVLLPEIISKEPLGPLVRHGDHEWGDVVRWSLNALVAAEELGVTSANIGEMAA 264

Query: 267 DTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGY 326
            T NP++ R LG + +  +GE LGL+ DW    I   GNYGE+F +N+G  + + + RG 
Sbjct: 265 GTENPEINRLLGTEGT--LGEMLGLSADWAKNAIGAGGNYGEVFAKNIGEDTPIGLARGL 322

Query: 327 NALWSKGGLMYAPPIR 342
           NA W++GGL+YAPP R
Sbjct: 323 NAQWTEGGLLYAPPFR 338


>gi|159042874|ref|YP_001531668.1| glutamate/glutamine/aspartate/asparagine ABC transporter
           [Dinoroseobacter shibae DFL 12]
 gi|157910634|gb|ABV92067.1| glutamate/glutamine/aspartate/asparagine ABC transporter
           [Dinoroseobacter shibae DFL 12]
          Length = 338

 Score =  325 bits (833), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 148/314 (47%), Positives = 215/314 (68%), Gaps = 2/314 (0%)

Query: 29  DIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKER 88
           +++ RG + CGI+TGLVGFA   ANG+W+GFDV  CRA+++A+F DP+ + + P+  + R
Sbjct: 27  EVQARGAVNCGISTGLVGFASQDANGEWQGFDVAVCRAVAAAVFGDPTAVNFNPVTNQVR 86

Query: 89  FLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASI 148
           F  L S +ID+L+RNT WT  R++ L L F  I Y+DGQGF++ K  G+SS ++L GA++
Sbjct: 87  FEVLNSGEIDMLARNTTWTFSRDVDLKLEFTGINYYDGQGFMVPKALGVSSATELDGATV 146

Query: 149 CVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTN 208
           C+Q GTTTEL LAD+F+A+N+ + P+      E    Y A  CD YT D S L A + + 
Sbjct: 147 CIQKGTTTELNLADFFRANNISFEPVPISTASEAQQQYLAGACDVYTTDASGLAATRASF 206

Query: 209 DRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDT 268
           + P EHV+LP+IISK PL P +  GD EW +IV WT  A++ AEELG+T  N+ +++  T
Sbjct: 207 ESPDEHVVLPEIISKEPLGPLVRHGDNEWGDIVRWTLNALIAAEELGVTSANVAELAAGT 266

Query: 269 TNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNA 328
            NP++ R LG +   N+GE LGL+ DW   +I+  GNYGE+F+ ++G  + + + RG NA
Sbjct: 267 DNPEINRLLGTE--GNLGEQLGLSADWAVNVIKAGGNYGEIFETHIGENTPIGLARGLNA 324

Query: 329 LWSKGGLMYAPPIR 342
            W++GGL+YAPP R
Sbjct: 325 QWTEGGLLYAPPFR 338


>gi|330814052|ref|YP_004358291.1| glutamate Aspartate periplasmic binding protein precursor GltI
           [Candidatus Pelagibacter sp. IMCC9063]
 gi|327487147|gb|AEA81552.1| glutamate Aspartate periplasmic binding protein precursor GltI
           [Candidatus Pelagibacter sp. IMCC9063]
          Length = 343

 Score =  325 bits (833), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 149/341 (43%), Positives = 222/341 (65%), Gaps = 6/341 (1%)

Query: 5   FFVSILCLIILFF--TSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVD 62
           F VSI  +++L       +   S L   K +GF+KCG++ GL GF+   A+G+W G DVD
Sbjct: 6   FAVSIFAVLLLAACGNESAKKTSTLDTTKSQGFVKCGVSQGLPGFSNADASGNWAGMDVD 65

Query: 63  FCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPIT 122
            CRA+++A+  D +K++Y PL+AKERF ALQ+  ID+LSRNT WTL R+ ++GL F  + 
Sbjct: 66  VCRAVAAAVLGDATKVKYTPLSAKERFTALQAGDIDVLSRNTTWTLERDAAIGLEFVGVN 125

Query: 123 YFDGQGFIMHKKKGISSVSQL-SGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEE 181
           ++DGQGF++ KK GI SV    +G  +C   GTTTEL +AD+FKA  + Y P+VFE+ +E
Sbjct: 126 FYDGQGFMVRKKSGIKSVKDFQNGTKVCTNTGTTTELNMADFFKAAGVSYEPVVFEKADE 185

Query: 182 IDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIV 241
           +  AY + RCD YT D S L + +     P +H++LP+ ISK PL P + +GD  W ++V
Sbjct: 186 VVQAYDSGRCDTYTTDKSGLASQRTKLTAPDDHIVLPETISKEPLGPVVREGDATWADVV 245

Query: 242 SWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIR 301
            W+    + AEE G+  +NI+ +  D+ NP +QR +G + + N G AL L + W+Y +I+
Sbjct: 246 RWSLNVWIEAEEYGVNSENIDSM-MDSKNPAIQRIVGAEGTKN-GAALNLDQKWSYNLIK 303

Query: 302 HMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
            +GNY E + RNL + + +   RG NALW+ GG++Y PP+R
Sbjct: 304 QVGNYAESYKRNLAD-TGIMPDRGPNALWTNGGILYVPPVR 343


>gi|254477415|ref|ZP_05090801.1| glutamate/glutamine/aspartate/asparagine ABC transporter,
           periplasmic substrate-binding protein [Ruegeria sp. R11]
 gi|214031658|gb|EEB72493.1| glutamate/glutamine/aspartate/asparagine ABC transporter,
           periplasmic substrate-binding protein [Ruegeria sp. R11]
          Length = 338

 Score =  325 bits (832), Expect = 7e-87,   Method: Compositional matrix adjust.
 Identities = 151/316 (47%), Positives = 213/316 (67%), Gaps = 2/316 (0%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           L D+K RG L CG+ TGLVGFA   ANG+W+GFDV  CRA+++A+  D + ++++P   K
Sbjct: 25  LDDVKARGKLNCGVTTGLVGFAAPNANGEWEGFDVAVCRAVAAAVLGDSTAVEFVPTTGK 84

Query: 87  ERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGA 146
            RF AL S +ID+L+RNT WT  R++ L   F  I Y+DGQGF++ K  G+SS  +L GA
Sbjct: 85  TRFTALASGEIDMLARNTTWTFSRDVDLKFEFVGINYYDGQGFMVPKDLGVSSAKELDGA 144

Query: 147 SICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKL 206
           ++C+Q GTTTEL LAD+F+++N+ Y P+  E   E    Y A  CD YT D S L A + 
Sbjct: 145 TVCIQTGTTTELNLADFFRSNNISYEPVPIETNAEAQQQYLAGACDVYTTDASGLAATRA 204

Query: 207 TNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSK 266
           T D P+ HV+LP+IISK PL P +  GD EW ++V W+  A++ AEELG+T  NIN+++ 
Sbjct: 205 TFDDPAGHVLLPEIISKEPLGPLVRHGDHEWGDVVRWSLNALIAAEELGVTSANINEMAA 264

Query: 267 DTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGY 326
            T NP++ R LG + +  +GE LGL+ DW    +   GNYGE+F +N+G  + + + RG 
Sbjct: 265 GTENPEINRLLGTEGT--LGEMLGLSADWAKNAVAAGGNYGEVFAKNIGEDTPIGLARGL 322

Query: 327 NALWSKGGLMYAPPIR 342
           NA W++GGL+YAPP R
Sbjct: 323 NAQWTEGGLLYAPPFR 338


>gi|311109014|ref|YP_003981867.1| general L-amino acid-binding periplasmic protein AapJ 3
           [Achromobacter xylosoxidans A8]
 gi|310763703|gb|ADP19152.1| general L-amino acid-binding periplasmic protein AapJ 3
           [Achromobacter xylosoxidans A8]
          Length = 338

 Score =  325 bits (832), Expect = 9e-87,   Method: Compositional matrix adjust.
 Identities = 150/329 (45%), Positives = 225/329 (68%), Gaps = 4/329 (1%)

Query: 15  LFFTSFSTNA-SILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFD 73
           L  +S + +A +    +K +GF++CG++TG+ GF+   + G W G DVD CRAL+  +F 
Sbjct: 13  LLISSLTAHAGATFEAVKSKGFVQCGVSTGVAGFSVNDSKGGWIGLDVDLCRALAITMFG 72

Query: 74  DPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHK 133
           D SK + + ++A +RF ALQS ++D+L RNT  +L R+ +LGL    + Y+D QG +++K
Sbjct: 73  DASKAKIMAVSALQRFTALQSGEVDVLPRNTTLSLTRDTTLGLIGVAVNYYDSQGIMVNK 132

Query: 134 KKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDA 193
              + S  +L GA++CVQ GTTTEL LAD+F++ N+ + P+V ER++EI  A+   RCDA
Sbjct: 133 SLNVKSAKELDGATVCVQPGTTTELNLADWFRSQNIVFKPVVVERLDEIIRAFAVGRCDA 192

Query: 194 YTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEE 253
           +TGD S L A +   + P ++ ILP+  SK PL P + QGD +W+N+V WT +AM+ AEE
Sbjct: 193 FTGDKSQLAAARSNLENPEKYDILPENFSKEPLGPMVRQGDEQWFNVVRWTLFAMLEAEE 252

Query: 254 LGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRN 313
            GIT KN++++ K +TNP+VQR LG+  +  +G+ LG+   W Y II+++GNYGE F++N
Sbjct: 253 YGITSKNVDEMLK-STNPNVQRLLGV--TPGMGKNLGVDDKWAYNIIKNIGNYGESFEKN 309

Query: 314 LGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           LG  S LK+PRG NA +  GGLMY  P+R
Sbjct: 310 LGPSSPLKLPRGLNASYRDGGLMYGWPVR 338


>gi|254462559|ref|ZP_05075975.1| glutamate/glutamine/aspartate/asparagine ABC transporter,
           periplasmic substrate-binding protein [Rhodobacterales
           bacterium HTCC2083]
 gi|206679148|gb|EDZ43635.1| glutamate/glutamine/aspartate/asparagine ABC transporter,
           periplasmic substrate-binding protein [Rhodobacteraceae
           bacterium HTCC2083]
          Length = 347

 Score =  324 bits (831), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 148/317 (46%), Positives = 207/317 (65%), Gaps = 3/317 (0%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           L D+K RG L CG+ TGLVGFA   ANG+W+GFDV  CRA+++A   DPS ++++P   K
Sbjct: 33  LDDVKARGKLNCGVTTGLVGFAAPDANGEWQGFDVGVCRAVAAAALGDPSAVEFVPTTGK 92

Query: 87  ERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGA 146
            RF AL S +ID+L+RNT WT  R++ L   F  + Y+DGQGF++ K  G+SS  +L GA
Sbjct: 93  TRFTALASGEIDMLARNTTWTFSRDVDLKFEFVGVNYYDGQGFMVPKALGVSSAKELDGA 152

Query: 147 SICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKL 206
           ++C+Q GTTTEL LADYF+ +N+ Y P+  E   E    Y    CD YT D S L A + 
Sbjct: 153 TVCIQTGTTTELNLADYFRTNNISYEPVPIETNAEAQPLYLEGACDVYTTDASGLAATRA 212

Query: 207 TNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSK 266
             + P +HV+LP+IISK PL P +  GD+EW ++V W+  A++ AEELG+T  NI  ++ 
Sbjct: 213 AFENPGDHVVLPEIISKEPLGPLVRHGDSEWGDVVRWSLNALIAAEELGVTSANIADMAA 272

Query: 267 DT-TNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRG 325
               NP++ R LG + +  +GE LGL  DW  + I   GNYGE+F++N+G  + + + RG
Sbjct: 273 AAGDNPEINRLLGTEGT--LGEMLGLDADWAKKAIMAGGNYGEIFEKNIGENTPIGLGRG 330

Query: 326 YNALWSKGGLMYAPPIR 342
            NA W+ GGL+Y PP R
Sbjct: 331 LNAQWTDGGLLYVPPFR 347


>gi|260432480|ref|ZP_05786451.1| glutamate/glutamine/aspartate/asparagine-binding protein
           bztAprecursor [Silicibacter lacuscaerulensis ITI-1157]
 gi|260416308|gb|EEX09567.1| glutamate/glutamine/aspartate/asparagine-binding protein
           bztAprecursor [Silicibacter lacuscaerulensis ITI-1157]
          Length = 356

 Score =  324 bits (830), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 149/314 (47%), Positives = 213/314 (67%), Gaps = 2/314 (0%)

Query: 29  DIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKER 88
           D+K RG L CG+ TGLVGFA   ANG+W+GFDV  CRA+++A+  D + ++++P   K R
Sbjct: 45  DVKARGKLNCGVTTGLVGFAAPDANGEWQGFDVAVCRAVAAAVLGDANAVEFVPTTGKTR 104

Query: 89  FLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASI 148
           F AL S ++D+L+RNT WT  R++ L   F  + Y+DGQGF++ K  G+SS  +L GA++
Sbjct: 105 FTALASGEVDMLARNTTWTFSRDVDLKFDFVGVNYYDGQGFMVPKALGVSSAKELDGATV 164

Query: 149 CVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTN 208
           C+Q GTTTEL LAD+F+++N+ Y P+  E   E    Y A  CD YT D S L A + T 
Sbjct: 165 CIQTGTTTELNLADFFRSNNISYEPVPIETNAEAQQQYLAGACDVYTTDASGLAATRATF 224

Query: 209 DRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDT 268
           + P +HV+LP+IISK PL P +  GD EW ++V WT  A++TAEELGIT  NI++++  T
Sbjct: 225 ENPGDHVLLPEIISKEPLGPLVRHGDNEWGDVVRWTLNALITAEELGITSANIDEMASGT 284

Query: 269 TNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNA 328
            NP++ R LG + +  +GE LGL   W  R I+  GNYGE+F +N+G ++ + + RG NA
Sbjct: 285 ENPEINRLLGSEGT--LGEMLGLDAQWALRAIKAGGNYGEVFAKNIGEETPIGLARGLNA 342

Query: 329 LWSKGGLMYAPPIR 342
            W+ GGL+Y+PP R
Sbjct: 343 QWTDGGLLYSPPFR 356


>gi|317403931|gb|EFV84400.1| L-amino acid ABC transporter [Achromobacter xylosoxidans C54]
          Length = 338

 Score =  323 bits (829), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 146/325 (44%), Positives = 218/325 (67%), Gaps = 3/325 (0%)

Query: 18  TSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSK 77
           T  +     L  +KKRG+++CG++TG+ GF+   + G+W+G DVD CRA+++ IF+D SK
Sbjct: 17  TGLAHAGPTLDTVKKRGYVQCGVSTGIQGFSSPDSKGNWQGLDVDMCRAIAATIFNDASK 76

Query: 78  IQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGI 137
            +  PL  + RF ALQS ++D+L+RN   T+ R+ +LGL    + Y+D QG ++  + G+
Sbjct: 77  FRLTPLTTQARFTALQSGEVDVLTRNVTPTMARDTTLGLISTGVNYYDSQGVMVSARLGV 136

Query: 138 SSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGD 197
             + +L GA+ICVQ GT TEL LAD+F+A+ +K+ P+V ++ +EI  A+ A RCDA+T D
Sbjct: 137 RKLKELDGATICVQPGTVTELDLADWFRANGLKFKPVVIDKYDEIVRAFSAGRCDAFTSD 196

Query: 198 ISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGIT 257
            S L A + T + P  +VIL + I+KSPL P + QGD  W+N+V WT  AM+ AEE G+T
Sbjct: 197 KSQLAASRTTLEHPDNYVILDENIAKSPLGPMVRQGDDNWFNVVRWTLNAMLEAEEFGVT 256

Query: 258 QKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQ 317
             N++   K +TNP+VQR LG+  +  +G+ LG+   W Y I++ +GNYGE ++RNLG  
Sbjct: 257 SANVDSQLK-STNPNVQRILGV--TPGMGKNLGVDDKWAYNIVKQVGNYGESYERNLGMA 313

Query: 318 SELKIPRGYNALWSKGGLMYAPPIR 342
           S +K+PRG NA W  GG MY  P+R
Sbjct: 314 SAMKLPRGLNAQWRDGGQMYGWPVR 338


>gi|311108222|ref|YP_003981075.1| general L-amino acid-binding periplasmic protein AapJ 1
           [Achromobacter xylosoxidans A8]
 gi|310762911|gb|ADP18360.1| general L-amino acid-binding periplasmic protein AapJ 1
           [Achromobacter xylosoxidans A8]
          Length = 340

 Score =  323 bits (829), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 145/317 (45%), Positives = 222/317 (70%), Gaps = 4/317 (1%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           L  +KK+GF++CG+  G+ GF+   + G+W+G DVD CRA+++A+F DP+K +  PL+ +
Sbjct: 27  LDAVKKKGFVQCGLTDGVSGFSATNSKGEWEGMDVDICRAVAAAVFGDPTKFKGTPLSTQ 86

Query: 87  ERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGA 146
           +RF ALQS ++D+L R    T  R+ SLGLA    +++DGQG +++KK G+ S  +L+GA
Sbjct: 87  QRFTALQSGEVDVLLRTVTLTQTRDTSLGLAAVAASFYDGQGILVNKKLGVKSAKELNGA 146

Query: 147 SICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKL 206
           ++CVQ GTTTEL LAD+F+ +N+++ P+V ++V E+  A+ + RCDA+T D S L A++ 
Sbjct: 147 TVCVQPGTTTELNLADWFRTNNIEFKPVVIDKVTEVVRAFESGRCDAFTDDSSQLAAVRA 206

Query: 207 TN-DRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVS 265
           T   +P ++ ILP+  SK PL P + QGD  W  IV WT +A++ AEE GITQKN++++ 
Sbjct: 207 TQVAKPDDYEILPERFSKEPLGPMVRQGDENWLGIVRWTLFALMEAEEYGITQKNVDEML 266

Query: 266 KDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRG 325
           K + NP++ R LG+  +   G+ +GL + W Y  I+ +GNY E+F+RN+G  S+L + RG
Sbjct: 267 K-SNNPNIARILGV--TPGAGKNMGLDEKWAYNAIKAVGNYSEVFERNVGKDSKLGLQRG 323

Query: 326 YNALWSKGGLMYAPPIR 342
            NALW+KGG MY  PIR
Sbjct: 324 TNALWNKGGAMYPWPIR 340


>gi|254456453|ref|ZP_05069882.1| ABC transporter [Candidatus Pelagibacter sp. HTCC7211]
 gi|207083455|gb|EDZ60881.1| ABC transporter [Candidatus Pelagibacter sp. HTCC7211]
          Length = 346

 Score =  323 bits (828), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 153/348 (43%), Positives = 223/348 (64%), Gaps = 12/348 (3%)

Query: 2   YKDFFVSILCLIILFFTSFSTN------ASILGDIKKRGFLKCGINTGLVGFAEVKANGD 55
           Y     S++ ++ + FT F+T       +  L + +K+GF++CG++ GL GF+   A G+
Sbjct: 4   YLKQLTSLVAMVAVLFT-FTTETMAAKKSKTLKNTQKKGFVRCGVSQGLPGFSNADAAGN 62

Query: 56  WKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLG 115
           W G DVD CRA+++A+  D +K+++ PL+AKERF AL S +IDILSRNT WTL R+  +G
Sbjct: 63  WTGVDVDVCRAVAAAVLGDANKVKFTPLSAKERFTALTSNEIDILSRNTTWTLSRDADIG 122

Query: 116 LAFRPITYFDGQGFIMHKKKGISSVSQL-SGASICVQAGTTTELTLADYFKAHNMKYHPI 174
           L F  + ++DGQGF++ K  G SSV+   +G S C   GTTTEL + D+F +  + Y P+
Sbjct: 123 LTFVGVNFYDGQGFMVRKNSGYSSVNDFKNGISACTNLGTTTELNMRDFFNSKGISYEPV 182

Query: 175 VFERVEEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGD 234
            FE+ +E+ AAY A RCD YT D S L A ++    P +HV+LP+ ISK PL P + QGD
Sbjct: 183 TFEKADEVVAAYDAGRCDTYTTDKSGLAAQRIKLSSPDDHVVLPETISKEPLGPVVRQGD 242

Query: 235 TEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKD 294
           + W +IV W+   M+ AEE G+   N + + K + NP V+R +G +    +G ALGL  D
Sbjct: 243 SVWEDIVRWSLNVMIEAEEYGVNSANADSM-KTSDNPAVKRLVGAE--GELGAALGLDND 299

Query: 295 WTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           W+ RII+ +GNYGE + RN+ +   L   RG N LW+KGG++Y PP R
Sbjct: 300 WSLRIIKQVGNYGESYKRNIADTGILP-DRGPNELWTKGGILYVPPAR 346


>gi|171058819|ref|YP_001791168.1| extracellular solute-binding protein [Leptothrix cholodnii SP-6]
 gi|170776264|gb|ACB34403.1| extracellular solute-binding protein family 3 [Leptothrix cholodnii
           SP-6]
          Length = 339

 Score =  323 bits (828), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 144/317 (45%), Positives = 220/317 (69%), Gaps = 3/317 (0%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           L  IK+R  +  G++TG+ GF+   + G W G DVD  RA+++A+  D  K++++PL + 
Sbjct: 25  LDTIKQRDQILVGVSTGVAGFSAADSQGKWTGLDVDVGRAIAAAVLGDADKVKWVPLASP 84

Query: 87  ERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGA 146
           +RF A+QS ++D+LSRNT +TL R+ SLGL    + ++DGQGF++  K  + S  QL GA
Sbjct: 85  QRFTAIQSGEVDVLSRNTTFTLTRDASLGLHQTAVVFYDGQGFMVPAKTKVKSAKQLKGA 144

Query: 147 SICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKL 206
           ++CVQ+GTTTE  L D+ +A+ +   P+VF++++  +AAY + RC AYT D S L +++ 
Sbjct: 145 TVCVQSGTTTEKNLTDFSRANKLNLKPVVFDKLDAANAAYFSGRCQAYTTDASGLASIRS 204

Query: 207 TNDR-PSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVS 265
              + P +HVILP++ISK PL P + +GD EW+ IV W  Y ++ AEE GITQ N++Q+ 
Sbjct: 205 KEAKDPKDHVILPELISKEPLGPLVRRGDDEWFAIVKWVVYGLIEAEESGITQANVDQLK 264

Query: 266 KDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRG 325
            D+T+P VQR LG  K+ + G+ LGL ++W  R I+ +GNYGE+++RN+G ++ + +PRG
Sbjct: 265 ADSTDPVVQRLLG--KTEDTGKLLGLDREWLARAIKAVGNYGEIYERNVGEKTPVGLPRG 322

Query: 326 YNALWSKGGLMYAPPIR 342
            NALW+ GGL YA PIR
Sbjct: 323 KNALWTNGGLQYAMPIR 339


>gi|317405707|gb|EFV86003.1| L-amino acid ABC transporter [Achromobacter xylosoxidans C54]
          Length = 338

 Score =  323 bits (828), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 145/329 (44%), Positives = 223/329 (67%), Gaps = 4/329 (1%)

Query: 15  LFFTSFSTNASI-LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFD 73
           L  +S+  +A +    +K +GF++CG++TG+ GF+   + G W G DVD CRAL+  +F 
Sbjct: 13  LLLSSWGASAGVTFESVKNKGFVQCGVSTGVAGFSVNDSKGGWMGLDVDLCRALAVTMFG 72

Query: 74  DPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHK 133
           D SK + + ++A +RF ALQS ++D+L RNT  +L R+ +LGL    + Y+D QG +++K
Sbjct: 73  DASKAKIMAVSAVQRFTALQSGEVDVLPRNTTLSLTRDTTLGLIGVGVNYYDSQGIMVNK 132

Query: 134 KKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDA 193
              + S  +L GA++CVQ GTTTEL L+D+F++ N+ + P+V ER++EI  A+   RCDA
Sbjct: 133 SLNVKSAKELDGATVCVQPGTTTELNLSDWFRSQNIAFKPVVVERLDEIIRAFAVGRCDA 192

Query: 194 YTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEE 253
           +TGD S L A +   + P ++ ILP+  SK PL P + QGD +W+N+V WT +AM+ AEE
Sbjct: 193 FTGDKSQLAAARTNLENPEKYDILPENFSKEPLGPMVRQGDEQWFNVVRWTMFAMLEAEE 252

Query: 254 LGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRN 313
            G+T KN++++ K +TNP+VQR LG+  +  +G+ LG+   W Y +I+ +GNYGE F++N
Sbjct: 253 YGVTSKNVDEMLK-STNPNVQRLLGV--TPGMGKNLGVDDKWAYNVIKQIGNYGESFEKN 309

Query: 314 LGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           LG  S +K+ RG NA +  GGLMY  P+R
Sbjct: 310 LGATSPMKLSRGLNASYRNGGLMYGWPVR 338


>gi|33591762|ref|NP_879406.1| amino acid-binding periplasmic protein [Bordetella pertussis Tohama
           I]
 gi|33599230|ref|NP_886790.1| amino acid-binding periplasmic protein [Bordetella bronchiseptica
           RB50]
 gi|33571405|emb|CAE44886.1| amino acid-binding periplasmic protein [Bordetella pertussis Tohama
           I]
 gi|33575276|emb|CAE30739.1| amino acid-binding periplasmic protein [Bordetella bronchiseptica
           RB50]
          Length = 338

 Score =  323 bits (828), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 147/314 (46%), Positives = 217/314 (69%), Gaps = 4/314 (1%)

Query: 30  IKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERF 89
           +KKRG + CG  TG  GF+     G W+G DVD CRA+++A+F D SKI+ +PLN+++RF
Sbjct: 28  VKKRGTVVCGTTTGFAGFSAPDKQGTWRGLDVDLCRAVAAAVFGDASKIKVVPLNSQQRF 87

Query: 90  LALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASIC 149
            ALQS ++D+L+RNT  T  R+ +LG+    I ++DGQGF++ K  G+ S  +L+GA+IC
Sbjct: 88  TALQSGEVDVLTRNTTVTQQRDTALGIIHAGINFYDGQGFMVPKSLGVKSAKELNGATIC 147

Query: 150 VQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTN- 208
           +Q GT+ E TLAD+ +A+ + Y P+V E   E+  A+ + RCD ++ D S L +++++  
Sbjct: 148 LQTGTSNENTLADWARANQVSYKPVVIETFNEVVNAFASGRCDVFSTDASGLASIRISRL 207

Query: 209 DRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDT 268
           ++P ++V+LP+IISK PL P + QGD  W NIV W+  AM+ AEE G+T  N+++  K +
Sbjct: 208 EKPDDYVVLPEIISKEPLGPFVRQGDDAWLNIVRWSLSAMIEAEEYGVTTANVDEQLK-S 266

Query: 269 TNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNA 328
            NP+V+R LG+  +   G  LGL + W Y II+ +GNYGE F+RN+G  S LKI RG NA
Sbjct: 267 ENPNVRRILGV--TPGAGANLGLDEKWAYNIIKQVGNYGESFERNVGQGSPLKIQRGLNA 324

Query: 329 LWSKGGLMYAPPIR 342
            W++GGLMYA PIR
Sbjct: 325 QWTQGGLMYALPIR 338


>gi|71083646|ref|YP_266366.1| ABC transporter [Candidatus Pelagibacter ubique HTCC1062]
 gi|71062759|gb|AAZ21762.1| ABC transporter [Candidatus Pelagibacter ubique HTCC1062]
          Length = 346

 Score =  322 bits (826), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 152/348 (43%), Positives = 220/348 (63%), Gaps = 12/348 (3%)

Query: 2   YKDFFVSILCLIILFFTSFSTN------ASILGDIKKRGFLKCGINTGLVGFAEVKANGD 55
           Y     S++ ++ + FT F+T       +  L + +K+GF++CG++ GL GF+   A G+
Sbjct: 4   YVKQLTSLVAMVAVLFT-FTTETMAAKKSKTLKNTQKKGFVRCGVSQGLPGFSNADAAGN 62

Query: 56  WKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLG 115
           W G DVD CRA+++A+  D +K+++ PL+AKERF AL S +IDILSRNT WTL R+  +G
Sbjct: 63  WTGVDVDVCRAVAAAVLGDANKVKFTPLSAKERFTALTSGEIDILSRNTTWTLSRDADIG 122

Query: 116 LAFRPITYFDGQGFIMHKKKGISSVSQL-SGASICVQAGTTTELTLADYFKAHNMKYHPI 174
           L F  + ++DGQGF++ K  GI+S SQ  +G S C   GTTTEL + D+F +  + Y P+
Sbjct: 123 LTFVGVNFYDGQGFMVRKDSGITSTSQFKNGISACTNIGTTTELNMRDFFNSKGISYEPV 182

Query: 175 VFERVEEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGD 234
            FE+ +E+ AAY + RCD YT D S L A +     P +HV+LP+ ISK PL P + QGD
Sbjct: 183 AFEKADEVVAAYDSGRCDTYTTDKSGLAAQRTKMTNPDDHVVLPETISKEPLGPVVRQGD 242

Query: 235 TEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKD 294
             W +IV W+   M+ AEE GI   N + + K + NP ++R +G      +G A GL  D
Sbjct: 243 AVWEDIVRWSLNVMIEAEEYGINSANADMM-KTSENPQIKRLVG--SEGELGAAFGLDND 299

Query: 295 WTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           W+ RII+ +GNYGE + RN+ +   L   RG N +W+KGGL+Y PP R
Sbjct: 300 WSLRIIKQVGNYGESYKRNIADTGILP-DRGPNQIWTKGGLLYVPPAR 346


>gi|311109272|ref|YP_003982125.1| general L-amino acid-binding periplasmic protein AapJ 5
           [Achromobacter xylosoxidans A8]
 gi|310763961|gb|ADP19410.1| general L-amino acid-binding periplasmic protein AapJ 5
           [Achromobacter xylosoxidans A8]
          Length = 338

 Score =  322 bits (825), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 143/314 (45%), Positives = 217/314 (69%), Gaps = 4/314 (1%)

Query: 30  IKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERF 89
           +++RG + CG  TG  GF+   A G W+G DVD CRA+++A+F D +KI+ +PLN+++RF
Sbjct: 28  VRQRGAVACGTTTGFAGFSAPDAQGKWQGLDVDLCRAIAAAVFGDANKIKVVPLNSQQRF 87

Query: 90  LALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASIC 149
            ALQS ++D+L+RNT  T  R+ +LG+    I ++DGQGF++ K  G+ S  +++GA+IC
Sbjct: 88  TALQSGEVDVLTRNTTVTQQRDTALGIIHAGINFYDGQGFLVPKSLGVKSAKEINGATIC 147

Query: 150 VQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTN- 208
           +Q GT+ E TLAD+ +A+N+ Y P+V E   E+  A+ A RCD ++ D S L +++++  
Sbjct: 148 LQTGTSNENTLADWARANNVSYKPVVIETFNEVVNAFAAGRCDVFSTDASGLASIRISKL 207

Query: 209 DRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDT 268
             P ++V+LP+IISK PL P + QGD  W NIV W+  AM+ AEE G++  N+++ +K +
Sbjct: 208 QNPDDYVVLPEIISKEPLGPFVRQGDDAWLNIVRWSLSAMIEAEEYGVSSANVDEQAK-S 266

Query: 269 TNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNA 328
            NP+++R LG+      G  LGL + W Y I++ +GNYGE F+RN+G  S LKI RG NA
Sbjct: 267 ANPNIKRILGVTPGG--GANLGLDEKWAYNIVKQVGNYGESFERNVGQGSPLKIKRGLNA 324

Query: 329 LWSKGGLMYAPPIR 342
            W++GGLMYA PIR
Sbjct: 325 QWTQGGLMYALPIR 338


>gi|149925439|ref|ZP_01913703.1| probable amino acid-binding protein [Limnobacter sp. MED105]
 gi|149825556|gb|EDM84764.1| probable amino acid-binding protein [Limnobacter sp. MED105]
          Length = 343

 Score =  322 bits (824), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 153/336 (45%), Positives = 232/336 (69%), Gaps = 7/336 (2%)

Query: 8   SILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRAL 67
           ++ CL++    + +    +L  I KR  ++CG+++G+ GF+ + ++G W+G DV  CRA+
Sbjct: 14  TLFCLLV---ANTAQAGPVLDAIYKRDAVRCGVSSGVAGFSALGSDGQWRGLDVAVCRAV 70

Query: 68  SSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQ 127
           ++A+  D  K+Q+ PL++++RF ALQ+ QIDILSRNT WTL R+  L   F  ITY+DGQ
Sbjct: 71  AAAVLGDAQKVQFTPLSSQQRFAALQAGQIDILSRNTTWTLGRDAGLNAHFAAITYYDGQ 130

Query: 128 GFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYR 187
           G +MHK+ G+ S  +L GA ICVQ+GTT E  L+ Y  +  +    IV++  E    A+ 
Sbjct: 131 GILMHKRFGVKSAKELKGAEICVQSGTTNEKNLSTYLGSQGITAKAIVYDNFEAAYKAFF 190

Query: 188 AHRCDAYTGDISALYALKLTND-RPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHY 246
           + RC A++ D+SAL  LK +   RP ++V+LP++ SK PL PA+++GD E++ IV W  +
Sbjct: 191 SGRCQAFSTDVSALIGLKSSQSGRPDDYVVLPEVFSKEPLGPAVLRGDDEFFAIVKWVVF 250

Query: 247 AMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNY 306
           AM+ AEELG+ + NI Q + +++NP VQR LG   + N+G+ LGL +DW  +I++ +GNY
Sbjct: 251 AMIEAEELGVGKGNIEQ-ALNSSNPAVQRLLG--GAENLGKPLGLPRDWVVKILQQVGNY 307

Query: 307 GEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           GE+F+ NLG QS LK+ RG NALW++GGLMYAPP+R
Sbjct: 308 GEVFEENLGKQSPLKLERGLNALWTQGGLMYAPPLR 343


>gi|330938900|gb|EGH42413.1| extracellular solute-binding protein [Pseudomonas syringae pv. pisi
           str. 1704B]
          Length = 324

 Score =  322 bits (824), Expect = 8e-86,   Method: Compositional matrix adjust.
 Identities = 148/324 (45%), Positives = 212/324 (65%), Gaps = 2/324 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           M K     +  L        +   + L  IKK+GF++CG++ GL GF+   + G   G D
Sbjct: 3   MLKSTLAVVTALAAFGVIGAANAGTTLDAIKKKGFIQCGVSDGLPGFSVPDSTGKITGID 62

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
            D CRA+++A+F D +K+++  LNAKERF ALQS +IDILSRNT WT  R+  +GL F  
Sbjct: 63  ADVCRAVAAAVFGDATKVKFSQLNAKERFTALQSGEIDILSRNTTWTSSRDAGMGLVFTG 122

Query: 121 ITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVE 180
           +TY+DG GF+++ K G++S  +L GA+IC+QAGTTTEL ++DYF+++ +KY PI F+  +
Sbjct: 123 VTYYDGIGFLVNNKLGVNSAKELDGATICIQAGTTTELNVSDYFRSNGLKYTPITFDTSD 182

Query: 181 EIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNI 240
           E   +    RCD  T D S LYA +    +P ++++LP++ISK PL P + +GD EW++I
Sbjct: 183 ESAKSLEGGRCDVLTSDQSQLYAQRSKLAKPDDYIVLPEVISKEPLGPVVRKGDEEWFSI 242

Query: 241 VSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRII 300
           V WT +AM+ AEE  IT KN+   +K T NPDV R LG D     G+ L L KDW  +I+
Sbjct: 243 VRWTLFAMLNAEEAKITSKNVEAEAKSTKNPDVARMLGAD--GTYGQDLKLPKDWVVQIV 300

Query: 301 RHMGNYGEMFDRNLGNQSELKIPR 324
           + +GNYGE+F+RNLG  + LKI R
Sbjct: 301 KQVGNYGEVFERNLGEGTPLKIKR 324


>gi|317405857|gb|EFV86140.1| extracellular solute-binding protein [Achromobacter xylosoxidans
           C54]
          Length = 340

 Score =  322 bits (824), Expect = 8e-86,   Method: Compositional matrix adjust.
 Identities = 144/317 (45%), Positives = 222/317 (70%), Gaps = 4/317 (1%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           L  +KK+G+++CG+  G+ GF+   + G+W+G DVD CRA+++A+F DP+K +   L+ +
Sbjct: 27  LDAVKKKGYVQCGLTDGVSGFSATNSKGEWEGMDVDICRAVAAAVFGDPTKFKGTALSTQ 86

Query: 87  ERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGA 146
           +RF ALQS ++D+L R    T  R+ SLGL+    +++DGQG +++KK G+ S  +L+GA
Sbjct: 87  QRFTALQSGEVDVLLRTVTLTQTRDTSLGLSAVAASFYDGQGILVNKKLGVKSAKELNGA 146

Query: 147 SICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKL 206
           ++CVQ GTTTEL LAD+F+A+N+++ P+V ++V E+  A+ + RCDA+T D S L A++ 
Sbjct: 147 TVCVQPGTTTELNLADWFRANNIEFKPVVIDKVTEVVRAFESGRCDAFTDDASQLAAVRA 206

Query: 207 TN-DRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVS 265
           T   +P ++ ILP+  SK PL P + QGD  W  IV WT +A++ AEE GITQKN++++ 
Sbjct: 207 TQVAKPDDYEILPERFSKEPLGPMVRQGDENWLGIVRWTLFALLEAEEYGITQKNVDEML 266

Query: 266 KDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRG 325
           K + NP++ R LG+  +   G+ +GL + W Y  I+ +GNY E+F+RN+G  S+L + RG
Sbjct: 267 K-SNNPNISRILGV--TPGAGKNMGLDEKWAYNAIKAVGNYSEVFERNVGKDSKLGLQRG 323

Query: 326 YNALWSKGGLMYAPPIR 342
            NALWSKGG MY  PIR
Sbjct: 324 TNALWSKGGAMYPWPIR 340


>gi|99080135|ref|YP_612289.1| lysine-arginine-ornithine-binding periplasmic protein [Ruegeria sp.
           TM1040]
 gi|99036415|gb|ABF63027.1| Lysine-arginine-ornithine-binding periplasmic protein [Ruegeria sp.
           TM1040]
          Length = 338

 Score =  321 bits (823), Expect = 9e-86,   Method: Compositional matrix adjust.
 Identities = 151/316 (47%), Positives = 211/316 (66%), Gaps = 2/316 (0%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           L D+K R  L CG++TGLVGF+   ANG+W+GFD+  CRA+++A+  DPSK++Y+P   K
Sbjct: 25  LDDVKARDKLNCGVSTGLVGFSAPNANGEWEGFDIAVCRAVAAAVLGDPSKVEYVPTTGK 84

Query: 87  ERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGA 146
            RF AL S +ID+L+RNT WT  R++ L   F  + Y+DGQGF++ K+ G+SS  +L GA
Sbjct: 85  TRFTALASGEIDMLARNTTWTFSRDVDLKFEFVGVNYYDGQGFMVPKELGVSSAKELDGA 144

Query: 147 SICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKL 206
           ++C+Q GTTTEL LAD+F+A+N+ Y P+  E   E    Y A  CD YT D S L A + 
Sbjct: 145 TVCIQTGTTTELNLADFFRANNISYEPVPIETNAEARQQYLAGACDVYTTDASGLAATRA 204

Query: 207 TNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSK 266
           T D  + HVILP+IISK PL P +  GD EW ++V WT  AM+ AEELGIT  N+ + + 
Sbjct: 205 TFDDAANHVILPEIISKEPLGPLVRHGDNEWGDVVRWTLNAMIAAEELGITSANLAEKAA 264

Query: 267 DTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGY 326
            T NP++ R LG + +  +GE LGL  D+  + +   GNYGE+F + +G  + + + RG 
Sbjct: 265 GTDNPEINRLLGTEGT--LGEMLGLEADFAQKALAAGGNYGEIFAKTIGEDTPVGLARGL 322

Query: 327 NALWSKGGLMYAPPIR 342
           NA W+ GGL+YAPP R
Sbjct: 323 NAQWTDGGLLYAPPFR 338


>gi|33594953|ref|NP_882596.1| amino acid-binding periplasmic protein [Bordetella parapertussis
           12822]
 gi|33565029|emb|CAE39978.1| amino acid-binding periplasmic protein [Bordetella parapertussis]
          Length = 338

 Score =  321 bits (823), Expect = 9e-86,   Method: Compositional matrix adjust.
 Identities = 147/314 (46%), Positives = 216/314 (68%), Gaps = 4/314 (1%)

Query: 30  IKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERF 89
           +KKRG + CG  TG  GF+     G W+G DVD CRA+++A+F D SKI+ +PLN+++RF
Sbjct: 28  VKKRGTVVCGTTTGFAGFSAPDKQGTWRGLDVDLCRAVAAAVFGDASKIKVVPLNSQQRF 87

Query: 90  LALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASIC 149
            ALQS ++D+L+RNT  T  R+ +LG+    I ++DGQGF++ K  G+ S  +L+GA+IC
Sbjct: 88  TALQSGEVDVLTRNTTVTQQRDTALGIIHAGINFYDGQGFMVPKSLGVKSAKELNGATIC 147

Query: 150 VQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTN- 208
           +Q GT+ E TLAD+ +A+ + Y P+V E   E+  A+ + RCD ++ D S L +++++  
Sbjct: 148 LQTGTSNENTLADWARANQVSYKPVVIETFNEVVNAFASGRCDVFSTDASGLASIRISRL 207

Query: 209 DRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDT 268
           ++P ++V+LP+IISK PL P + QGD  W NIV W+  AM+ AEE G+T  N+++  K +
Sbjct: 208 EKPDDYVVLPEIISKEPLGPFVRQGDDAWLNIVRWSLSAMIEAEEYGVTTANVDEQLK-S 266

Query: 269 TNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNA 328
            NP+V+R LG+   +  G  LGL + W Y II+ +GNYGE F+RN+G  S LKI RG NA
Sbjct: 267 ENPNVRRILGVTPGA--GANLGLDEKWAYNIIKQVGNYGESFERNVGQGSPLKIQRGLNA 324

Query: 329 LWSKGGLMYAPPIR 342
            W +GGLMYA PIR
Sbjct: 325 QWIQGGLMYALPIR 338


>gi|291571845|dbj|BAI94117.1| putative ABC transporter substrate-binding protein [Arthrospira
           platensis NIES-39]
          Length = 343

 Score =  321 bits (822), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 137/321 (42%), Positives = 215/321 (66%), Gaps = 2/321 (0%)

Query: 22  TNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYL 81
           T  S L  +K RGFL CG++ G+ GF+ V  +G++ G DVD C+A+++A+FDDP+ +QY 
Sbjct: 25  TGQSRLNVVKNRGFLICGVDGGIPGFSFVDESGEYSGLDVDVCKAVAAALFDDPNAVQYR 84

Query: 82  PLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVS 141
            L++ ERF A++S ++D+LSRNT WTL R+ S+G+ F P T++DGQG ++    GI+++ 
Sbjct: 85  NLDSTERFEAMRSGEVDMLSRNTTWTLSRDTSVGMEFAPTTFYDGQGMMVRADSGITTLE 144

Query: 142 QLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISAL 201
                ++CV+AGTTTEL L D  +   + +  + F++ +   AAY   RC+  T D S L
Sbjct: 145 DFQDLAVCVEAGTTTELNLTDNMRERGITFETVTFQQADPAYAAYAEGRCEGMTSDKSQL 204

Query: 202 YALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNI 261
            A + T   P++H+IL   +SK PL P  +  D+ W++ V W  +A+  AEELGITQ N+
Sbjct: 205 LARRSTLPNPNDHIILDVTMSKEPLGPVTLNNDSAWFDTVKWVTFALFEAEELGITQANV 264

Query: 262 NQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELK 321
            Q+++ + NP ++RFLG++   ++G  +GLT D+  R+I+H+GNY E++DRNLG  S+  
Sbjct: 265 EQIAQTSENPTIRRFLGVE--GDLGTGMGLTNDFAARVIKHVGNYAEVYDRNLGTGSQFN 322

Query: 322 IPRGYNALWSKGGLMYAPPIR 342
           +PR  N LW+ GGL+++PP R
Sbjct: 323 LPRNENELWTNGGLLFSPPFR 343


>gi|300865204|ref|ZP_07110022.1| extracellular solute-binding protein [Oscillatoria sp. PCC 6506]
 gi|300336795|emb|CBN55172.1| extracellular solute-binding protein [Oscillatoria sp. PCC 6506]
          Length = 354

 Score =  320 bits (821), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 149/318 (46%), Positives = 210/318 (66%), Gaps = 2/318 (0%)

Query: 25  SILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLN 84
           S L  I  RG L CG++  L GF+ V   G + G DV+ CRA+++A+FDDP K++Y  LN
Sbjct: 39  SRLDKIISRGTLICGVSGQLPGFSFVDEKGKYSGLDVEICRAIAAALFDDPEKVEYRNLN 98

Query: 85  AKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLS 144
           AKERF ALQS +IDILSRNT WTL R+ S GL F P+ ++D Q  ++ K  GI ++   +
Sbjct: 99  AKERFTALQSGEIDILSRNTTWTLSRDGSTGLEFAPVVFYDSQSIMVKKDSGIQTLKDFA 158

Query: 145 GASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYAL 204
           G SICVQ GT+TE  L+D  +   +KY P+VFE V    A Y+  RC   T D S L + 
Sbjct: 159 GKSICVQTGTSTEQNLSDQMRKLGIKYTPVVFEDVNATFATYQEGRCQGVTADRSQLVSK 218

Query: 205 KLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQV 264
           +     P +H+IL +++SK PLAPA+  GD++W + V W  YA + AE+LG+  +NI+Q+
Sbjct: 219 RTILPTPDQHIILNEVMSKEPLAPAVSSGDSKWADAVRWIVYATIEAEDLGVNSQNIDQL 278

Query: 265 SKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPR 324
           +  TT+P+V+R +G +   ++G+ LGL  D+  R I+ +GNYGE++DRNLG  S LK+ R
Sbjct: 279 ATTTTDPNVKRLIGTE--GDLGKGLGLPNDFALRTIKKVGNYGEIYDRNLGPSSTLKLDR 336

Query: 325 GYNALWSKGGLMYAPPIR 342
           G N LW  GGL+Y+PP R
Sbjct: 337 GQNRLWKDGGLLYSPPFR 354


>gi|91763314|ref|ZP_01265278.1| ABC transporter [Candidatus Pelagibacter ubique HTCC1002]
 gi|91717727|gb|EAS84378.1| ABC transporter [Candidatus Pelagibacter ubique HTCC1002]
          Length = 346

 Score =  320 bits (821), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 149/347 (42%), Positives = 218/347 (62%), Gaps = 10/347 (2%)

Query: 2   YKDFFVSILCLIILFF-----TSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDW 56
           Y     S++ ++ + F     T  +  +  L + +K+GF++CG++ GL GF+   A G+W
Sbjct: 4   YVKQLTSLVAMVAVLFAFTTETMAAKKSKTLKNTQKKGFVRCGVSQGLPGFSNADAAGNW 63

Query: 57  KGFDVDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGL 116
            G DVD CRA+++A+  D +K+++ PL+AKERF AL S +IDILSRNT WTL R+  +GL
Sbjct: 64  TGVDVDVCRAVAAAVLGDANKVKFTPLSAKERFTALTSGEIDILSRNTTWTLSRDADIGL 123

Query: 117 AFRPITYFDGQGFIMHKKKGISSVSQL-SGASICVQAGTTTELTLADYFKAHNMKYHPIV 175
            F  + ++DGQGF++ K  GI+S SQ  +G S C   GTTTEL + D+F +  + Y P+ 
Sbjct: 124 TFVGVNFYDGQGFMVRKDSGITSTSQFKNGISACTNIGTTTELNMRDFFNSKGISYEPVA 183

Query: 176 FERVEEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDT 235
           FE+ +E+ AAY + RCD YT D S L A +     P +H++LP+ ISK PL P + QGD 
Sbjct: 184 FEKADEVVAAYDSGRCDTYTTDKSGLAAQRTKMTNPDDHIVLPETISKEPLGPVVRQGDA 243

Query: 236 EWYNIVSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDW 295
            W +IV W+   M+ AEE GI   N + + K + NP ++R +G      +G A GL  DW
Sbjct: 244 VWEDIVRWSLNVMIEAEEYGINSANADMM-KTSENPQIKRLVG--SEGELGAAFGLDNDW 300

Query: 296 TYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           + RII+ +GNYGE + RN+ +   L   RG N +W+KGGL+Y PP R
Sbjct: 301 SLRIIKQVGNYGESYKRNIADTGILP-DRGPNQIWTKGGLLYVPPAR 346


>gi|284052552|ref|ZP_06382762.1| extracellular solute-binding protein [Arthrospira platensis str.
           Paraca]
          Length = 355

 Score =  320 bits (821), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 137/321 (42%), Positives = 215/321 (66%), Gaps = 2/321 (0%)

Query: 22  TNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYL 81
           T  S L  +K RGFL CG++ G+ GF+ V  +G++ G DVD C+A+++A+FDDP+ +QY 
Sbjct: 37  TGQSRLNVVKNRGFLICGVDGGIPGFSFVDESGEYSGLDVDVCKAVAAALFDDPNAVQYR 96

Query: 82  PLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVS 141
            L++ ERF A++S ++D+LSRNT WTL R+ S+G+ F P T++DGQG ++    GI+++ 
Sbjct: 97  NLDSTERFEAMRSGEVDMLSRNTTWTLSRDTSVGMEFAPTTFYDGQGMMVRADSGITTLE 156

Query: 142 QLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISAL 201
                ++CV+AGTTTEL L D  +   + +  + F++ +   AAY   RC+  T D S L
Sbjct: 157 DFQDLAVCVEAGTTTELNLTDNMRERGITFETVTFQQADPAYAAYAEGRCEGMTSDKSQL 216

Query: 202 YALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNI 261
            A + T   P++H+IL   +SK PL P  +  D+ W++ V W  +A+  AEELGITQ N+
Sbjct: 217 LARRSTLPNPNDHIILDVTMSKEPLGPVTLNNDSAWFDTVKWVTFALFEAEELGITQANV 276

Query: 262 NQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELK 321
            Q+++ + NP ++RFLG++   ++G  +GLT D+  R+I+H+GNY E++DRNLG  S+  
Sbjct: 277 EQIAQTSENPTIRRFLGVE--GDLGTGMGLTNDFAARVIKHVGNYAEVYDRNLGTGSQFN 334

Query: 322 IPRGYNALWSKGGLMYAPPIR 342
           +PR  N LW+ GGL+++PP R
Sbjct: 335 LPRNENELWTNGGLLFSPPFR 355


>gi|317122275|ref|YP_004102278.1| amino acid ABC transporter substrate-binding protein, PAAT family
           [Thermaerobacter marianensis DSM 12885]
 gi|315592255|gb|ADU51551.1| amino acid ABC transporter substrate-binding protein, PAAT family
           [Thermaerobacter marianensis DSM 12885]
          Length = 366

 Score =  320 bits (821), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 140/313 (44%), Positives = 212/313 (67%), Gaps = 3/313 (0%)

Query: 30  IKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERF 89
           + +RG L CG+N  L GF+ +  NG   GFD DFCRA+++A+FDDP+ +++ PL+A+ERF
Sbjct: 57  VLQRGKLICGVNGQLPGFSYLDPNGQMTGFDADFCRAIAAALFDDPNAVEFRPLSAQERF 116

Query: 90  LALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASIC 149
            A+QS ++D+L RNT WTL R+   G+ F P T++DG G ++ K + + +++ L GA+IC
Sbjct: 117 TAVQSGEVDVLIRNTTWTLGRDTVNGMEFAPTTFYDGGGIMVRKDRNVKTLADLDGATIC 176

Query: 150 VQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTND 209
           V +GTT E+ L D  +A    + P  FE  +++ A Y +  CDA T D S L   +    
Sbjct: 177 VLSGTTNEMVLTDRMRALGASFTPKTFEDADQLYATYESGGCDAVTSDKSQLAGRRAVLS 236

Query: 210 RPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTT 269
            P  HVIL +++SK PL PA+   D+ W+++V W  YA + AEE GIT +N++Q  K++ 
Sbjct: 237 DPDNHVILDEMLSKEPLGPAVKNNDSAWFDVVKWVVYATIQAEEFGITSQNVDQF-KNSD 295

Query: 270 NPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNAL 329
           NPD++RFLG++    +G+ LG++ D+ YR+I+H+GNYGE++DRNLG  +  K+ RG N L
Sbjct: 296 NPDIRRFLGVE--GELGQGLGISNDFAYRVIKHVGNYGEIYDRNLGPNTPFKLERGLNEL 353

Query: 330 WSKGGLMYAPPIR 342
           W+ GGL+YAPP R
Sbjct: 354 WTNGGLLYAPPFR 366


>gi|269102822|ref|ZP_06155519.1| amino acid ABC transporter amino acid-binding protein
           [Photobacterium damselae subsp. damselae CIP 102761]
 gi|268162720|gb|EEZ41216.1| amino acid ABC transporter amino acid-binding protein
           [Photobacterium damselae subsp. damselae CIP 102761]
          Length = 342

 Score =  320 bits (820), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 146/333 (43%), Positives = 220/333 (66%), Gaps = 3/333 (0%)

Query: 10  LCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSS 69
           L L+ L F+  S  +S L  +KKRG++KCG++TGL+GF+E    G W GFDV+FCRA+++
Sbjct: 13  LVLVALLFSYASVASSTLETVKKRGYIKCGVSTGLLGFSEPNQKGIWHGFDVEFCRAVAA 72

Query: 70  AIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGF 129
           A+  D  +++++PL AKERF ALQ+  +D+L+RNT WTL R+ SL + F  ++Y+DGQGF
Sbjct: 73  AVLKDKGQVKFIPLTAKERFFALQNNDVDLLARNTSWTLHRDTSLNVLFTGVSYYDGQGF 132

Query: 130 IMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAH 189
           ++     I+ +++LS   IC Q GTTTEL L++YF      +  I F+   ++  A+   
Sbjct: 133 LVKTSANINKITELSNPRICFQTGTTTELNLSEYFAQIKQPFQSIPFDAKPQLVTAFEDD 192

Query: 190 RCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMV 249
           RCD  + D + LY++K +   P    IL  +ISK PL P +   D++W+NIV WT + ++
Sbjct: 193 RCDVISSDKAGLYSIKQSLKDPLSAHILVSVISKEPLGPVVRDNDSQWFNIVKWTLFTLL 252

Query: 250 TAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEM 309
            AEE  I+ +NI+ + KD++ P + RFL      N+ E L L  DW Y+II+ +GNYG++
Sbjct: 253 NAEENRISSENIDDL-KDSSIPHIARFLST--KDNLSEGLQLPLDWRYQIIKQVGNYGQI 309

Query: 310 FDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           ++R LG+ S+LK+ RG NALW  GG+ YAPPIR
Sbjct: 310 YERTLGHSSKLKMERGLNALWIDGGIQYAPPIR 342


>gi|296448618|ref|ZP_06890487.1| extracellular solute-binding protein family 3 [Methylosinus
           trichosporium OB3b]
 gi|296253868|gb|EFH01026.1| extracellular solute-binding protein family 3 [Methylosinus
           trichosporium OB3b]
          Length = 351

 Score =  320 bits (820), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 148/338 (43%), Positives = 210/338 (62%), Gaps = 3/338 (0%)

Query: 5   FFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFC 64
            F  +L L     +  +  A+ LG + +RG L CG+  G  GFA     G+W G DVDFC
Sbjct: 17  MFALLLPLAPARASGLAVRAATLGQVTERGRLLCGVGAGQPGFARQDEKGEWSGLDVDFC 76

Query: 65  RALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYF 124
           RA+++AIFDDPS+   + L  KER  ALQ+ ++D+L+    WTL R+   G+AF    +F
Sbjct: 77  RAVAAAIFDDPSRASIVALTPKERLKALQTGEVDLLAHGAAWTLARDAGQGVAFVATLFF 136

Query: 125 DGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDA 184
           DGQGF+  +K+   S   L+G SICVQ GT+ EL L D  +A +    P +F   EE   
Sbjct: 137 DGQGFLTARKRAAQSRRDLAGLSICVQQGTSFELDLVDGRRASDKPVEPRLFPSFEEAAE 196

Query: 185 AYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWT 244
           AY   +CDA T D+S L A +   + P  H IL ++I K PL P + QGD +W+++V WT
Sbjct: 197 AYAQGQCDALTADLSTLAAERARLEAPDRHAILAELIDKEPLGPIVRQGDAQWFDVVRWT 256

Query: 245 HYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMG 304
           ++AM+ AEELG+   N+++  K + +P  +R LG++      E  GL  DW YRI++H+G
Sbjct: 257 YFAMLDAEELGVASTNVDEALK-SADPRTRRLLGVEGGRV--EGFGLEPDWAYRIVKHVG 313

Query: 305 NYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           NYGE+F+RNLG+ S L + R  NALW++GGLMYAPP+R
Sbjct: 314 NYGEVFERNLGHGSPLGLDRRLNALWTEGGLMYAPPVR 351


>gi|302383029|ref|YP_003818852.1| extracellular solute-binding protein family 3 [Brevundimonas
           subvibrioides ATCC 15264]
 gi|302193657|gb|ADL01229.1| extracellular solute-binding protein family 3 [Brevundimonas
           subvibrioides ATCC 15264]
          Length = 370

 Score =  320 bits (819), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 143/315 (45%), Positives = 210/315 (66%), Gaps = 4/315 (1%)

Query: 30  IKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERF 89
           IK+RG L CG+N GLVGFA     G+W+GFDVDFCR L++A+  DP  ++++PL+A+ RF
Sbjct: 58  IKRRGRLNCGVNQGLVGFAYTDNRGEWRGFDVDFCRGLAAAVVGDPDAVRFVPLSAENRF 117

Query: 90  LALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASIC 149
            AL+  ++D+L RNT WT+ R+    L+F  I Y+DGQGF++ +   ++S ++L+GA IC
Sbjct: 118 QALEDGRVDVLWRNTSWTMERDTGGRLSFAGINYYDGQGFLVRRALNLNSAAELNGARIC 177

Query: 150 VQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTND 209
           +Q+G+T+ L + DYF++  ++Y  +V    E    AY    CDA++ D+SAL A + T  
Sbjct: 178 LQSGSTSALNVEDYFRSRGIEYRAVVLPTEEAARQAYGREDCDAFSADVSALAAARTTLG 237

Query: 210 RPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTT 269
             S+HVILPD+ISK PL P + +GD +W  IV WT  A+V AEELG+TQ N+   + +  
Sbjct: 238 DSSQHVILPDVISKEPLGPVVRRGDEQWTAIVRWTQNALVLAEELGVTQANVEDQAAEAR 297

Query: 270 NPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNAL 329
           +P V+R LG++     G  +GL+ DW    I  +GNYGE+F+RNLG+QS L + RG NA 
Sbjct: 298 DPQVRRLLGVE--GEFGSRMGLSDDWARDAIAGVGNYGEIFERNLGSQSALDLARGLNAQ 355

Query: 330 WS--KGGLMYAPPIR 342
           W+    GL+Y  P+R
Sbjct: 356 WNGRPAGLIYGLPVR 370


>gi|224371700|ref|YP_002605864.1| amino acid-binding periplasmic amino acid binding protein
           [Desulfobacterium autotrophicum HRM2]
 gi|223694417|gb|ACN17700.1| amino acid-binding periplasmic amino acid binding protein
           [Desulfobacterium autotrophicum HRM2]
          Length = 332

 Score =  319 bits (818), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 147/334 (44%), Positives = 220/334 (65%), Gaps = 5/334 (1%)

Query: 12  LIILFFTSFSTN---ASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALS 68
           +I +   +F      A  L D++ +  L CGI+ G+ GF+   + G W GFDVD  RA++
Sbjct: 1   MIFIMMGAFPCTGPWAGTLEDVRAKDVLTCGISEGIPGFSIPDSTGKWVGFDVDMARAVA 60

Query: 69  SAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQG 128
           +A+  DP KI+++PL +K++ +A+ S Q+D+ SR T WTL R+   G+ F  I ++DGQG
Sbjct: 61  AAVLSDPQKIKFVPLASKQKIIAVSSGQVDLTSRTTTWTLKRDGKQGVDFTKIVFYDGQG 120

Query: 129 FIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRA 188
           F++ K  G+ S +++ GA++CV AGTT+EL LAD+ +A+ +K   +VF+  +E   AY  
Sbjct: 121 FMVKKALGVDSATKIDGATVCVTAGTTSELNLADFARANGLKIEALVFDGKKEALNAYAT 180

Query: 189 HRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAM 248
            RCD +T D+S L +L+ T   P++H I+P++ISK PLAP +  GD +W +IV+W    +
Sbjct: 181 GRCDCFTTDVSQLASLRTTLPNPNDHEIMPEVISKEPLAPLVRHGDNQWKDIVTWVLNGL 240

Query: 249 VTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGE 308
           V AEE GIT  N+ ++ + + NP VQR LG  KS + G  +GL KDW  R+I+ +GNYGE
Sbjct: 241 VAAEEYGITSANVLEMKEKSENPVVQRMLG--KSGDTGSYIGLDKDWMVRVIQAVGNYGE 298

Query: 309 MFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           ++DR+ G  + L IPRG N LW+KGGL YA PIR
Sbjct: 299 IYDRHFGPATALNIPRGVNRLWTKGGLQYALPIR 332


>gi|293607066|ref|ZP_06689409.1| general amino acid ABC superfamily ATP binding cassette
           transporter, binding protein [Achromobacter piechaudii
           ATCC 43553]
 gi|292814556|gb|EFF73694.1| general amino acid ABC superfamily ATP binding cassette
           transporter, binding protein [Achromobacter piechaudii
           ATCC 43553]
          Length = 340

 Score =  319 bits (818), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 145/317 (45%), Positives = 220/317 (69%), Gaps = 4/317 (1%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           L  +KK+GF++CG+  G+ GF+   + G+W+G DVD CRA+++A+F DPSK +   L+ +
Sbjct: 27  LDAVKKKGFVQCGLTDGVSGFSATNSKGEWEGMDVDICRAVAAAVFGDPSKFKGTALSTQ 86

Query: 87  ERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGA 146
           +RF ALQS ++D+L R    T  R+ SLGL+    +++DGQG +++KK G+ S  +L+GA
Sbjct: 87  QRFTALQSGEVDVLLRTVTLTQTRDTSLGLSAVAASFYDGQGILVNKKLGVKSAKELNGA 146

Query: 147 SICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKL 206
           ++CVQ GTTTEL LAD+F+A+ +++ P+V ++V E+  A+ + RCDA+T D S L A++ 
Sbjct: 147 TVCVQPGTTTELNLADWFRANKIEFKPVVIDKVTEVVRAFESGRCDAFTDDSSQLAAVRA 206

Query: 207 TN-DRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVS 265
           T   +P ++ ILP+  SK PL P + QGD  W  IV WT +A++ AEE GITQKN++++ 
Sbjct: 207 TQVAKPDDYEILPERFSKEPLGPMVRQGDENWLGIVRWTLFALLEAEEYGITQKNVDEML 266

Query: 266 KDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRG 325
           K + NP+V R LG+  +   G+ +GL + W Y  I+ +GNY E+F+RN+G  S+L + RG
Sbjct: 267 K-SNNPNVLRILGV--TPGAGKNMGLDEKWAYNAIKAVGNYSEVFERNVGKDSKLGLARG 323

Query: 326 YNALWSKGGLMYAPPIR 342
            NALWS GG MY  PIR
Sbjct: 324 TNALWSNGGAMYPWPIR 340


>gi|330429782|gb|AEC21116.1| putative extracellular solute-binding protein [Pusillimonas sp.
           T7-7]
          Length = 338

 Score =  319 bits (817), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 148/330 (44%), Positives = 221/330 (66%), Gaps = 5/330 (1%)

Query: 15  LFFTSFST-NASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFD 73
           +   SFS  +A  L  +K+RG + CG+ TG  GF+   A G W+G DVD CRA+++A   
Sbjct: 12  VLAASFSAAHADTLDVVKERGVVHCGVTTGFAGFSAPDAKGVWQGLDVDLCRAVAAATLG 71

Query: 74  DPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHK 133
           D  K + +PL++++RF ALQS +ID+L+RNT  T  R+ +LG     + ++DGQGF++ K
Sbjct: 72  DAEKFKAVPLSSQQRFTALQSGEIDLLARNTTVTQQRDTALGAISAGVNFYDGQGFLVPK 131

Query: 134 KKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDA 193
             G+SS  +L GAS+C+Q GT+ E T+AD+ +A+N+ Y P+V E+  E+  A+ A RCD 
Sbjct: 132 SLGVSSAKELDGASVCMQTGTSNENTMADWARANNITYKPVVIEQFNEVVNAFAAGRCDV 191

Query: 194 YTGDISALYALKLTN-DRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAE 252
           +T D S L +++++    P ++ +LP+IISK PL P + QGD  W N+V W+  AM+ AE
Sbjct: 192 FTTDASGLASIRISKLSNPDDYQVLPEIISKEPLGPFVRQGDDRWLNVVKWSLQAMIGAE 251

Query: 253 ELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDR 312
           ELGIT  N+++  K + NP+V+R LG+ + +  G+ LG+ + W Y II+ +GNYGE FDR
Sbjct: 252 ELGITSANVDEQLK-SENPNVKRLLGVTEGA--GKNLGVDEKWAYNIIKQVGNYGESFDR 308

Query: 313 NLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           N+G  S L+I RG NA W+ GGLMY  P+R
Sbjct: 309 NVGKGSPLQIERGLNAQWTDGGLMYGLPVR 338


>gi|47114851|emb|CAE48356.1| unnamed protein product [Methylocystis sp. SC2]
          Length = 343

 Score =  319 bits (817), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 145/316 (45%), Positives = 215/316 (68%), Gaps = 4/316 (1%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           L  I KRG+L CG++    GFA+    G+W+GFDVDFCRA++SA+ DDP+K +++ L+ K
Sbjct: 32  LAQIMKRGYLTCGVSDA-PGFAQRDGAGEWRGFDVDFCRAVASAVLDDPNKARFVELSQK 90

Query: 87  ERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGA 146
           ER  ALQ+  +D+L   + WT  R+ S  L +  I   DGQGF++ +++  +SV  L GA
Sbjct: 91  ERAGALQAGAVDLLVSASPWTQARDTSHRLIYAAIFLHDGQGFLVRRQRKTASVQDLDGA 150

Query: 147 SICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKL 206
           SICV+ GT  EL +AD+F+A   KY P +F  +E+   AY   +CDA T D+S L+ +++
Sbjct: 151 SICVEQGTPYELAVADFFRARKEKYDPKLFPSLEDAAKAYDEEKCDALTADVSTLHGVRI 210

Query: 207 TNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSK 266
               P++H +LPDI+SKSP  P + QGD +W NIV WT +AM+ AEEL +++ N +  + 
Sbjct: 211 GLTAPADHAVLPDILSKSPRGPLVRQGDDQWLNIVRWTLFAMIDAEELEVSKANAD-AAL 269

Query: 267 DTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGY 326
            + NP ++R LG+D +   G+ LGL++DW YRI++H+GNY ++F+RNLG  +   + R  
Sbjct: 270 SSENPQIRRLLGVDGAH--GDDLGLSQDWAYRIVKHVGNYADVFERNLGRGAPYAMERRL 327

Query: 327 NALWSKGGLMYAPPIR 342
           NALW+KGGLMYAPP+R
Sbjct: 328 NALWNKGGLMYAPPVR 343


>gi|154253424|ref|YP_001414248.1| extracellular solute-binding protein [Parvibaculum lavamentivorans
           DS-1]
 gi|154157374|gb|ABS64591.1| extracellular solute-binding protein family 3 [Parvibaculum
           lavamentivorans DS-1]
          Length = 367

 Score =  319 bits (817), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 155/313 (49%), Positives = 214/313 (68%), Gaps = 3/313 (0%)

Query: 30  IKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERF 89
           +++RGF++CG++ GL GF+     G W G DVDFCRA+++AIF +P ++++ PL+AK+RF
Sbjct: 58  VRQRGFIQCGVSQGLPGFSNPDERGRWSGIDVDFCRAIAAAIFGNPDQVRFRPLSAKDRF 117

Query: 90  LALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASIC 149
            ALQS +IDILSRNT WT+ R+  LG  F  +TY+DGQ F++ K  GI + + L+GA+IC
Sbjct: 118 TALQSGEIDILSRNTTWTMSRDTQLGFNFVGVTYYDGQSFMVRKAAGIKTTADLAGATIC 177

Query: 150 VQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTND 209
            + GTTTEL LADYF++  + Y  + FE+ +E   AY   RCDAYT D S LYA +L   
Sbjct: 178 TETGTTTELNLADYFRSRGLSYRVLSFEKNDEAIVAYDRGRCDAYTTDASGLYATRLKLA 237

Query: 210 RPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTT 269
            P  + IL +IISK PL PA+ QGD +W +I  WT  A++ AEE GIT  NIN++  ++ 
Sbjct: 238 DPDANTILSEIISKEPLGPAVRQGDPQWEDIARWTLNALLEAEEFGITSANINEM-LESD 296

Query: 270 NPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNAL 329
           NP V+R LG  +    G ++GL  +W    IR +GNYGEMF+RN+G  + L I RG NA 
Sbjct: 297 NPRVKRLLG--REGAYGGSVGLDANWAANAIRAVGNYGEMFERNVGKNTPLGIERGLNAQ 354

Query: 330 WSKGGLMYAPPIR 342
           W+ GGL YAPP+R
Sbjct: 355 WTDGGLQYAPPVR 367


>gi|222526721|ref|YP_002571192.1| extracellular solute-binding protein family 3 protein [Chloroflexus
           sp. Y-400-fl]
 gi|222450600|gb|ACM54866.1| extracellular solute-binding protein family 3 [Chloroflexus sp.
           Y-400-fl]
          Length = 389

 Score =  319 bits (817), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 148/315 (46%), Positives = 217/315 (68%), Gaps = 6/315 (1%)

Query: 30  IKKRGFLKCGINTG-LVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKER 88
           I  RG L CG+N   L GFA V + G ++GFD+DFCRA+++A+FDDP+K+++ PL+A+ER
Sbjct: 79  ILSRGTLICGVNNNPLPGFASVDSAGVYRGFDIDFCRAVAAALFDDPTKVEFRPLSAQER 138

Query: 89  FLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASI 148
           F ALQS +ID+L RN+ WTL R+ +LGL + P T++DGQG ++ K  GI ++  + GA+I
Sbjct: 139 FTALQSGEIDVLIRNSTWTLGRDGTLGLDWAPTTFYDGQGMMVRKDSGIETLEDMDGATI 198

Query: 149 CVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTN 208
           CVQ GTTTEL LAD F+A  + + P+VF   +   AAY A +CD +T D S L +     
Sbjct: 199 CVQTGTTTELNLADQFRARGLTFTPVVFPDGDATRAAYDAGQCDGFTTDKSGLISSLTLL 258

Query: 209 DRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQ-VSKD 267
             P++H IL   +SK PL PA+ QGD +W++ V W  +A   AEE GIT +N++Q +  D
Sbjct: 259 TNPADHKILDVTMSKEPLGPAVRQGDPQWFDAVRWIVFATFQAEEYGITSQNLDQFLGSD 318

Query: 268 TTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYN 327
              P+++RFLGI+    +G  +GL  D+  R++RH+GNY E+++RNLG  +   +PRG N
Sbjct: 319 V--PEIRRFLGIE--GELGAGIGLPNDFAARVVRHVGNYAEIYNRNLGPDTPFNLPRGLN 374

Query: 328 ALWSKGGLMYAPPIR 342
           AL+++GGL+Y+PP R
Sbjct: 375 ALYTEGGLLYSPPFR 389


>gi|126724899|ref|ZP_01740742.1| glutamate/glutamine/aspartate/asparagine ABC transporter,
           periplasmic substrate-binding protein [Rhodobacterales
           bacterium HTCC2150]
 gi|126706063|gb|EBA05153.1| glutamate/glutamine/aspartate/asparagine ABC transporter,
           periplasmic substrate-binding protein [Rhodobacterales
           bacterium HTCC2150]
          Length = 338

 Score =  319 bits (817), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 149/316 (47%), Positives = 209/316 (66%), Gaps = 2/316 (0%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           L D+K RG L CG+ TGLVGFA   A+G W+GFDV  CRA++ A   D + ++++P   K
Sbjct: 25  LDDVKARGKLNCGVTTGLVGFAAPNADGRWEGFDVAVCRAVAVATLGDENAVEFVPTTGK 84

Query: 87  ERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGA 146
            RF AL S +ID+L+RNT WTL R+  L   F  + Y+DGQGF+  K  G++S   L GA
Sbjct: 85  TRFTALASGEIDMLARNTTWTLSRDADLKFTFVGVNYYDGQGFMAPKDLGVASAKDLDGA 144

Query: 147 SICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKL 206
           ++C+Q GTTTEL LAD+F+++N+ Y P+  E   E    Y A  CD +T D S L A + 
Sbjct: 145 TVCIQTGTTTELNLADFFRSNNISYEPVPIETNAEAQQQYLAGACDVFTTDASGLAATRA 204

Query: 207 TNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSK 266
           T + P++HV+LP+I+SK PL P +  GD+EW +IV W+  AM+TAEELGIT  N  ++S 
Sbjct: 205 TFENPADHVLLPEIVSKEPLGPLVRHGDSEWGDIVRWSLNAMITAEELGITSANAAEMSA 264

Query: 267 DTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGY 326
            T NP++ R LG + +  +GE LGL+ DW   II   GNYGE+F+ N+G  + + + RG 
Sbjct: 265 GTNNPEINRLLGSEGT--LGEMLGLSADWAKNIIMTQGNYGEVFENNIGENTAIGLSRGL 322

Query: 327 NALWSKGGLMYAPPIR 342
           N+ W+ GGL+Y+PP R
Sbjct: 323 NSQWTDGGLIYSPPFR 338


>gi|331005342|ref|ZP_08328727.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [gamma proteobacterium IMCC1989]
 gi|330420839|gb|EGG95120.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [gamma proteobacterium IMCC1989]
          Length = 336

 Score =  319 bits (817), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 144/328 (43%), Positives = 214/328 (65%), Gaps = 3/328 (0%)

Query: 14  ILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFD 73
           +LF  +    A  L D+++RGF+ CG++ GL GF++    G W G DVD CRA+++A+F 
Sbjct: 11  VLFLAALGVKAGTLEDVRERGFVSCGVSDGLTGFSQKNDKGVWSGLDVDVCRAVAAAVFS 70

Query: 74  DPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHK 133
           D  K+ Y PL AKERF+ALQS ++D+LSRNT WTL R++++GL F  I Y+DGQGF++ +
Sbjct: 71  DADKVAYKPLTAKERFVALQSNEVDLLSRNTTWTLTRDVAMGLKFAGINYYDGQGFLVSQ 130

Query: 134 KKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDA 193
           + G+SS  +L GAS CVQAG+T+E+ +  +F  +NM Y   +F++  ++        CD 
Sbjct: 131 ELGVSSAFELDGASFCVQAGSTSEVGIEIFFNNNNMTYKRRIFDKSSDVRDGLDKGMCDV 190

Query: 194 YTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEE 253
            + D S LY+ +     P   V+LP++ISK PL P + QGD  W+NIV W+  AM+ AE 
Sbjct: 191 ISSDQSQLYSFRTGLMNPESFVVLPEVISKEPLGPVVRQGDDTWFNIVRWSLVAMIEAEF 250

Query: 254 LGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRN 313
           LGIT  N++ + K +     +R LG +   +   +  L+ DW Y II+ +GNY E F+RN
Sbjct: 251 LGITSLNVDILRK-SGELGQKRLLGSEGELSTNSS--LSADWAYNIIKQVGNYSESFERN 307

Query: 314 LGNQSELKIPRGYNALWSKGGLMYAPPI 341
           +G++S LKI RG NA W+ GG++Y+PPI
Sbjct: 308 VGSESTLKIARGLNAQWNAGGILYSPPI 335


>gi|86135803|ref|ZP_01054382.1| glutamate/glutamine/aspartate/asparagine ABC transporter,
           periplasmic substrate-binding protein [Roseobacter sp.
           MED193]
 gi|85826677|gb|EAQ46873.1| glutamate/glutamine/aspartate/asparagine ABC transporter,
           periplasmic substrate-binding protein [Roseobacter sp.
           MED193]
          Length = 346

 Score =  318 bits (816), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 148/316 (46%), Positives = 211/316 (66%), Gaps = 2/316 (0%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           L D+K RG L CG+ TGLVGFA   A+G+W+GFDV  CRA+++A+  D + ++++P   K
Sbjct: 33  LDDVKARGKLNCGVTTGLVGFAAPNASGEWEGFDVAVCRAVAAAVLGDSNAVEFVPTTGK 92

Query: 87  ERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGA 146
            RF AL S +ID+L+RNT WT  R++ L   F  + Y+DGQGF++ K+ G+SS  +L GA
Sbjct: 93  TRFTALASGEIDMLARNTTWTFSRDVDLKFEFTGVNYYDGQGFMVPKELGVSSAKELDGA 152

Query: 147 SICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKL 206
           ++C+Q GTTTEL LAD+F+++N+ Y P+  E   E    Y A  CD YT D S L A + 
Sbjct: 153 TVCIQTGTTTELNLADFFRSNNISYEPVPIETNAEAQQQYLAGACDVYTTDASGLAATRA 212

Query: 207 TNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSK 266
           T + P  H +LP+IISK PL P +  GD EW ++V WT  A+++AEELG+T  NI +++ 
Sbjct: 213 TFEAPDAHTLLPEIISKEPLGPLVRHGDHEWGDVVRWTLNALISAEELGVTSANIGEMAA 272

Query: 267 DTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGY 326
            T NP++ R LG + +  +GE LGL+ DW    I   GNYGE+F  N+G  + + + RG 
Sbjct: 273 GTNNPEINRLLGTEGT--LGEMLGLSADWGKNAIAAGGNYGEVFADNIGEATPIGLARGL 330

Query: 327 NALWSKGGLMYAPPIR 342
           NA W+KGGL+Y+PP R
Sbjct: 331 NAQWTKGGLLYSPPFR 346


>gi|219847287|ref|YP_002461720.1| extracellular solute-binding protein family 3 protein [Chloroflexus
           aggregans DSM 9485]
 gi|219541546|gb|ACL23284.1| extracellular solute-binding protein family 3 [Chloroflexus
           aggregans DSM 9485]
          Length = 389

 Score =  318 bits (815), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 149/326 (45%), Positives = 220/326 (67%), Gaps = 4/326 (1%)

Query: 18  TSFSTNASILGDIKKRGFLKCGINTG-LVGFAEVKANGDWKGFDVDFCRALSSAIFDDPS 76
           T+   +  ++  I  RG L CG+N   L GFA V A+G + GFD+DFCRA+++A+FDDP+
Sbjct: 67  TNQPASGGLIQQILARGRLICGVNNNPLPGFASVDASGVYSGFDIDFCRAVAAALFDDPT 126

Query: 77  KIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKG 136
           K+ + PL+A+ERF ALQ+ +ID+L RN+ WTL R+ +LGL + P T++DGQG ++ K  G
Sbjct: 127 KVDFRPLSAQERFTALQTGEIDVLIRNSTWTLGRDGNLGLDWAPTTFYDGQGMMVRKDSG 186

Query: 137 ISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTG 196
           I+++  + GA+ICVQ GTTTEL LAD F+A  + + P+VF   +   AAY A +CD +T 
Sbjct: 187 INTLEDMDGATICVQTGTTTELNLADQFRARGLTFTPVVFPDGDSTRAAYDAGQCDGFTT 246

Query: 197 DISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGI 256
           D S L +       P++H IL   +SK PL PA+ QGD +W++ V W  +A   AEE GI
Sbjct: 247 DKSGLISSLTLLSNPADHKILEVTMSKEPLGPAVKQGDPQWFDAVRWIVFATFQAEEYGI 306

Query: 257 TQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGN 316
           T +N+N    ++  P+++RFLGI+   ++   +GL  D+  RIIRH+GNY E+++RNLG 
Sbjct: 307 TSQNVNDF-LNSDVPEIRRFLGIE--GDLAAGIGLPNDFAVRIIRHVGNYAEIYNRNLGP 363

Query: 317 QSELKIPRGYNALWSKGGLMYAPPIR 342
            +   +PRG NAL++ GGL+Y+PP R
Sbjct: 364 DTPFNLPRGLNALYTDGGLLYSPPFR 389


>gi|33594685|ref|NP_882329.1| putative ABC transporter periplasmic amino acid-binding protein
           [Bordetella pertussis Tohama I]
 gi|33598479|ref|NP_886122.1| putative ABC transporter periplasmic amino acid-binding protein
           [Bordetella parapertussis 12822]
 gi|33603422|ref|NP_890982.1| putative ABC transporter periplasmic amino acid-binding protein
           [Bordetella bronchiseptica RB50]
 gi|33564761|emb|CAE44086.1| putative ABC transporter periplasmic amino acid-binding protein
           [Bordetella pertussis Tohama I]
 gi|33574608|emb|CAE39258.1| putative ABC transporter periplasmic amino acid-binding protein
           [Bordetella parapertussis]
 gi|33577546|emb|CAE34811.1| putative ABC transporter periplasmic amino acid-binding protein
           [Bordetella bronchiseptica RB50]
          Length = 338

 Score =  317 bits (813), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 144/324 (44%), Positives = 227/324 (70%), Gaps = 3/324 (0%)

Query: 19  SFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKI 78
           S +   +   ++KK+GF++CG++TG+ GF+   + G+WKG DVD CRA+++ +F D SK 
Sbjct: 18  SVAHAGATFDNVKKKGFVQCGVSTGIPGFSIADSKGEWKGLDVDMCRAIAATMFGDASKF 77

Query: 79  QYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGIS 138
           +  PLN ++RF ALQS ++D+L+RNT  TL R+ +LGL    + Y+D QG ++ K+ G+ 
Sbjct: 78  KVTPLNTQQRFTALQSGEVDVLTRNTTVTLTRDTTLGLIGVGVNYYDSQGVMVSKELGVK 137

Query: 139 SVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDI 198
           S  +L+GA++CVQ GTTTEL LAD+F+ + +++ P+V ++ +EI  A+ A RCDA+T D 
Sbjct: 138 SAKELNGATVCVQPGTTTELNLADWFRGNKIEFKPVVIDKYDEIVRAFSAGRCDAFTTDK 197

Query: 199 SALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQ 258
           S L + + T ++P  +VILP+  SK PL P + QGD +W+N+V W+  AM+ AEE GIT 
Sbjct: 198 SQLASTRTTLEKPDNYVILPEDFSKEPLGPMVRQGDEQWFNVVRWSLNAMLEAEEYGITS 257

Query: 259 KNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQS 318
           KN+++++K ++NP++QR LG+  +  +G+ LG+   W + II+ +GNYGE F+  LG  S
Sbjct: 258 KNVDEMAK-SSNPNIQRILGV--TPGMGKNLGVDDKWAFNIIKQVGNYGESFEATLGKSS 314

Query: 319 ELKIPRGYNALWSKGGLMYAPPIR 342
            +K+ RG NA + +GGLMY  P+R
Sbjct: 315 AMKLERGLNASYKQGGLMYGWPVR 338


>gi|163848771|ref|YP_001636815.1| extracellular solute-binding protein [Chloroflexus aurantiacus
           J-10-fl]
 gi|163670060|gb|ABY36426.1| extracellular solute-binding protein family 3 [Chloroflexus
           aurantiacus J-10-fl]
          Length = 389

 Score =  317 bits (813), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 147/315 (46%), Positives = 217/315 (68%), Gaps = 6/315 (1%)

Query: 30  IKKRGFLKCGINTG-LVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKER 88
           I  RG L CG+N   L GFA V + G ++GFD+DFCRA+++A+FDDP+K+++ PL+A+ER
Sbjct: 79  ILSRGTLICGVNNNPLPGFASVDSAGVYRGFDIDFCRAVAAALFDDPTKVEFRPLSAQER 138

Query: 89  FLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASI 148
           F ALQS +ID+L RN+ WTL R+ +LGL + P T++DGQG ++ K  GI ++  + GA+I
Sbjct: 139 FTALQSGEIDVLIRNSTWTLGRDGTLGLDWAPTTFYDGQGMMVRKDSGIETLEDMDGATI 198

Query: 149 CVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTN 208
           CVQ G+TTEL LAD F+A  + + P+VF   +   AAY A +CD +T D S L +     
Sbjct: 199 CVQTGSTTELNLADQFRARGLTFTPVVFPDGDATRAAYDAGQCDGFTTDKSGLISSLTLL 258

Query: 209 DRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQ-VSKD 267
             P++H IL   +SK PL PA+ QGD +W++ V W  +A   AEE GIT +N++Q +  D
Sbjct: 259 TNPADHKILDVTMSKEPLGPAVRQGDPQWFDAVRWIVFATFQAEEYGITSQNLDQFLGSD 318

Query: 268 TTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYN 327
              P+++RFLGI+    +G  +GL  D+  R++RH+GNY E+++RNLG  +   +PRG N
Sbjct: 319 V--PEIRRFLGIE--GELGAGIGLPNDFAARVVRHVGNYAEIYNRNLGPDTPFNLPRGLN 374

Query: 328 ALWSKGGLMYAPPIR 342
           AL+++GGL+Y+PP R
Sbjct: 375 ALYTEGGLLYSPPFR 389


>gi|242280380|ref|YP_002992509.1| extracellular solute-binding protein family 3 [Desulfovibrio
           salexigens DSM 2638]
 gi|242123274|gb|ACS80970.1| extracellular solute-binding protein family 3 [Desulfovibrio
           salexigens DSM 2638]
          Length = 336

 Score =  317 bits (813), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 150/338 (44%), Positives = 227/338 (67%), Gaps = 5/338 (1%)

Query: 5   FFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFC 64
           F  S +CL+I+   S +  A  L ++KK GFLK G +    GF+ + +NG   GFDVDF 
Sbjct: 4   FRTSFICLMIVAMASIA-QAGTLDNVKKDGFLKAGTHIENPGFSALDSNGKRVGFDVDFI 62

Query: 65  RALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYF 124
           RA+++A+  +  +I+Y PL +KER  ALQS +IDILSR T  T+ R++ LGL F   T +
Sbjct: 63  RAVAAAV--NVPEIKYTPLTSKERLPALQSGEIDILSRTTTHTMSRDVKLGLDFTVTTLY 120

Query: 125 DGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDA 184
           DGQG ++ K+ GI+    L GA++C+Q G+TTEL ++D+F+ + M + P+VF++  ++  
Sbjct: 121 DGQGMMVRKELGITDAKDLDGATVCLQTGSTTELNISDFFRKNGMSFTPVVFDKQPDVRK 180

Query: 185 AYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWT 244
           AY   RCD +T D+S L A +   ++P+EH+IL ++ISK PL P +  GD +W +IV WT
Sbjct: 181 AYDTGRCDVHTTDVSGLAAQRSLMEKPAEHIILSEVISKEPLGPVVRHGDNQWSDIVRWT 240

Query: 245 HYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMG 304
            +  + AEE G+TQ N+ ++  ++ +P+VQR LG  K+ ++   LGL KD   RII+ +G
Sbjct: 241 IWLTMAAEEKGVTQANVEKMFANSKDPEVQRMLG--KTGSLWTDLGLDKDAPVRIIKTVG 298

Query: 305 NYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           NYGE+FDRNLG ++ L++ RG N  W++GGL+YAPP R
Sbjct: 299 NYGEIFDRNLGPKTPLRMERGLNKQWNEGGLIYAPPFR 336


>gi|297624238|ref|YP_003705672.1| family 3 extracellular solute-binding protein [Truepera
           radiovictrix DSM 17093]
 gi|297165418|gb|ADI15129.1| extracellular solute-binding protein family 3 [Truepera
           radiovictrix DSM 17093]
          Length = 339

 Score =  317 bits (813), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 150/342 (43%), Positives = 220/342 (64%), Gaps = 3/342 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           M K F  S LC++I  FT        L +++ RG L CG+N  L GF  V   G+ +GFD
Sbjct: 1   MRKWFVGSALCVLIASFTVAQAQGK-LAEVRNRGSLVCGVNDVLPGFGTVNEEGEHEGFD 59

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
           VDFC+A+++A+  D   + Y PL+A+ERF A+Q+ ++D+L RNT WT  R+  +GL F P
Sbjct: 60  VDFCKAIAAAVLGDADAVTYRPLSAQERFTAVQTGEVDVLIRNTTWTSSRDTEVGLNFGP 119

Query: 121 ITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVE 180
           + ++DGQGF++ +  GI S+  L G  I VQ+GTTTEL LAD   A +++Y P++FE  +
Sbjct: 120 VIFYDGQGFMVRRDSGIESLEDLEGRRIGVQSGTTTELNLADVMSALDIQYEPVIFETSD 179

Query: 181 EIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNI 240
           ++ AAY     DA+T D S L +L ++   P EH IL   ISK PLAPA++ GD EWY++
Sbjct: 180 QLVAAYDDGAVDAWTTDKSGLASLLISLSDPEEHRILDATISKEPLAPAVLHGDDEWYDV 239

Query: 241 VSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRII 300
           V W  + ++ AEE GIT +N+ ++++ +TNP++QR LG + S+   E +GL  D     I
Sbjct: 240 VKWVIFGLMEAEEYGITSENVRELAETSTNPNIQRILGAEPSAV--EQIGLEADAIATAI 297

Query: 301 RHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
             +GNYGE+++RNLG  +   IPRG NA + +GGL+Y  P R
Sbjct: 298 EAVGNYGEIYERNLGEGTPFNIPRGLNAQYYEGGLIYGMPFR 339


>gi|158338716|ref|YP_001519893.1| lysine-arginine-ornithine-binding periplasmic protein, putative
           [Acaryochloris marina MBIC11017]
 gi|158308957|gb|ABW30574.1| lysine-arginine-ornithine-binding periplasmic protein, putative
           [Acaryochloris marina MBIC11017]
          Length = 343

 Score =  317 bits (812), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 149/341 (43%), Positives = 221/341 (64%), Gaps = 9/341 (2%)

Query: 8   SILC---LIILFFTSFSTNASILGDIKK---RGFLKCGINTGLVGFAEVKANGDWKGFDV 61
           S LC   L+ L   S S++ +  G +++   +  ++CGI+  L GF+ V   G++ G DV
Sbjct: 6   SSLCAALLVALTLGSCSSSEAAGGRLQQVLAQKKVRCGISGELPGFSFVDEKGNYSGLDV 65

Query: 62  DFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPI 121
           D CRA+++A+FDDP  ++Y PLNAKERF A+Q+ ++D+LSRNT WTL R+ S+ +AF P+
Sbjct: 66  DICRAIAAALFDDPDAVEYRPLNAKERFAAVQTGEVDVLSRNTTWTLDRDSSVRMAFAPV 125

Query: 122 TYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEE 181
            ++DGQG ++    GI ++      ++C Q GTT E  L D  +   + Y  +V+E +  
Sbjct: 126 VFYDGQGVMVKADSGIKTLKDFKNRTVCTQTGTTNEKNLKDQMRKRKVDYKLVVYEDINS 185

Query: 182 IDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIV 241
             AAY   RCD  T D S L + +    +P  H IL +++SK PLAPA+  GD EW ++V
Sbjct: 186 AYAAYAEGRCDGVTSDRSQLISRRTALPKPESHTILDEVLSKEPLAPAVADGDVEWADVV 245

Query: 242 SWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIR 301
            W   A V AEELGI Q N+   +K + +P V+RFLG ++   +G++LGL+ D+  RI++
Sbjct: 246 RWVVNATVEAEELGIQQDNLASFAK-SEDPVVKRFLGTEE--ELGKSLGLSPDFAARIVK 302

Query: 302 HMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           H+GNYGE++DRNLG  ++L +PRG N LWSKGGLMY+PP R
Sbjct: 303 HVGNYGEIYDRNLGPNTKLNLPRGQNQLWSKGGLMYSPPFR 343


>gi|311108521|ref|YP_003981374.1| general L-amino acid-binding periplasmic protein AapJ 2
           [Achromobacter xylosoxidans A8]
 gi|310763210|gb|ADP18659.1| general L-amino acid-binding periplasmic protein AapJ 2
           [Achromobacter xylosoxidans A8]
          Length = 338

 Score =  317 bits (811), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 144/335 (42%), Positives = 218/335 (65%), Gaps = 3/335 (0%)

Query: 8   SILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRAL 67
           +I  L +   +S +     L  ++KRG+L+CG++TG+ GF+   + G W G DVD CRA+
Sbjct: 7   AICALALAAVSSQAFAGPTLDTVRKRGYLQCGVSTGIQGFSAPDSKGTWHGLDVDMCRAI 66

Query: 68  SSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQ 127
           ++ +F+D +K +  PL  + RF ALQS ++D+L+RN   T+ R+ +LGL    + Y+D Q
Sbjct: 67  AATVFNDATKYRLTPLTTQARFTALQSGEVDVLTRNVTPTMARDTTLGLLSVAVNYYDSQ 126

Query: 128 GFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYR 187
           G ++  K G+  + +L GA++CVQ GT TEL LAD+F++ ++++ P+V E+ +EI  A+ 
Sbjct: 127 GVMVSDKLGVKKLRELDGATVCVQPGTVTELDLADWFRSQSLRFKPVVIEKYDEIVRAFS 186

Query: 188 AHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYA 247
           A RCDA+T D S L A ++T + P  +VIL + ISKSPL P + QGD  W NIV W+  A
Sbjct: 187 AGRCDAFTSDKSQLAASRMTLENPESYVILDENISKSPLGPMVRQGDDNWINIVRWSLNA 246

Query: 248 MVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYG 307
           M+ AEE GIT  N++   K   +P+VQR LG+  +  +G  +G+   W Y I++ +GNYG
Sbjct: 247 MLEAEEFGITSSNVDAQLK-ANSPNVQRILGV--TPGMGRNMGVDDKWAYNIVKQVGNYG 303

Query: 308 EMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           E ++RNLG  S +K+PR  NA W  GGLMY  P+R
Sbjct: 304 ESYERNLGMSSPMKLPRALNAQWRDGGLMYGWPVR 338


>gi|85703851|ref|ZP_01034954.1| glutamate/glutamine/aspartate/asparagine ABC transporter,
           periplasmic substrate-binding protein [Roseovarius sp.
           217]
 gi|85671171|gb|EAQ26029.1| glutamate/glutamine/aspartate/asparagine ABC transporter,
           periplasmic substrate-binding protein [Roseovarius sp.
           217]
          Length = 339

 Score =  316 bits (810), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 150/317 (47%), Positives = 211/317 (66%), Gaps = 3/317 (0%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           L D+K RG L CG+ TGLVGFA   ANG W+GFDV  CRA+++A+  D + ++++P   K
Sbjct: 25  LDDVKARGKLNCGVTTGLVGFAAPDANGVWEGFDVAVCRAVAAAVLSDANAVEFVPTTGK 84

Query: 87  ERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGA 146
            RF AL S +ID+L+RNT WT  R+  L   F  + Y+DGQGF++ K  G+SS  +L GA
Sbjct: 85  TRFTALASGEIDMLARNTTWTFSRDTDLKFDFVGVNYYDGQGFLVPKSLGVSSAKELDGA 144

Query: 147 SICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKL 206
           ++C+Q GTTTEL LAD+F+A+N+ Y P+  E   E    Y A  CD YT D S L + + 
Sbjct: 145 TVCIQTGTTTELNLADFFRANNISYEPVPIETNAEGQQQYLAGACDTYTTDASGLASTRA 204

Query: 207 TNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSK 266
             + P++HVILP+IISK PL P +  GD +W +IV WT YA+V AEE+GIT  NI ++S 
Sbjct: 205 AFESPTDHVILPEIISKEPLGPLVRHGDNDWADIVRWTFYALVAAEEMGITSANIGELSA 264

Query: 267 DT-TNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRG 325
               NP++ R LG +   ++G  +GL  +W  R I   GNYGE+F++N+G ++ + + RG
Sbjct: 265 AAGDNPEINRILGTE--GDLGAMIGLDNEWAKRAIAASGNYGEIFEKNIGEKTPIGLARG 322

Query: 326 YNALWSKGGLMYAPPIR 342
            NA W++GG+MYAPP R
Sbjct: 323 LNAQWTQGGIMYAPPFR 339


>gi|163854807|ref|YP_001629105.1| putative extracellular solute-binding protein [Bordetella petrii
           DSM 12804]
 gi|163258535|emb|CAP40834.1| putative extracellular solute-binding protein [Bordetella petrii]
          Length = 338

 Score =  315 bits (808), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 145/313 (46%), Positives = 220/313 (70%), Gaps = 3/313 (0%)

Query: 30  IKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERF 89
           +KK+GF++CG++TG+ GF+   + G+WKG DV  CRA+++ +F+D +K +  PLN ++RF
Sbjct: 29  VKKKGFVQCGVSTGIPGFSMADSKGEWKGIDVAMCRAIAATMFNDSTKFKVTPLNTQQRF 88

Query: 90  LALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASIC 149
            ALQS ++D+L+RNT  TL R+ +LGL    + Y+D QG ++ K  G+ S  +L+GA+IC
Sbjct: 89  TALQSGEVDVLTRNTTQTLTRDTTLGLIGAGVNYYDSQGVMVSKDLGVKSAKELNGATIC 148

Query: 150 VQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTND 209
           VQ GTTTEL LAD+F+   +++ P+V ++ +EI  A+ A RCDA+T D S L + + T +
Sbjct: 149 VQPGTTTELNLADWFRGQKIEFKPVVIDKYDEIIRAFSAGRCDAFTTDKSQLASTRTTLE 208

Query: 210 RPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTT 269
            P   VILP+  SK PL P + QGD +W+NIV W+  AM+ AEE GIT KN+++++K ++
Sbjct: 209 NPDNFVILPEDFSKEPLGPMVRQGDEQWFNIVRWSLNAMLEAEEYGITSKNVDEMAK-SS 267

Query: 270 NPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNAL 329
           NP++QR LG+  +  +G+ LG+   W Y II+ +GNYGE+F+R LG  S +K+ RG NA 
Sbjct: 268 NPNIQRILGV--TPGMGKNLGVDDKWAYTIIKQVGNYGEVFERTLGADSAMKLERGLNAS 325

Query: 330 WSKGGLMYAPPIR 342
           +  GGLMY  P+R
Sbjct: 326 YKDGGLMYGWPVR 338


>gi|310816976|ref|YP_003964940.1| glutamate/glutamine/aspartate/asparagine ABC transporter,
           periplasmic substrate-binding protein
           [Ketogulonicigenium vulgare Y25]
 gi|308755711|gb|ADO43640.1| glutamate/glutamine/aspartate/asparagine ABC transporter,
           periplasmic substrate-binding protein
           [Ketogulonicigenium vulgare Y25]
          Length = 338

 Score =  315 bits (808), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 152/319 (47%), Positives = 207/319 (64%), Gaps = 2/319 (0%)

Query: 24  ASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPL 83
           A+ L D+K R  L CG NTGL GFA   A+G W+GFDV  CRA+++A+  DP+K+ ++P 
Sbjct: 22  AATLDDVKARDVLNCGTNTGLAGFAAPNADGVWEGFDVAVCRAVAAAVLGDPTKVNFVPT 81

Query: 84  NAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQL 143
               RF AL S +ID+LSR T WT  R++ L   F  + Y+DGQGFI+    G++S  +L
Sbjct: 82  TGATRFTALASGEIDMLSRVTTWTFQRDVELAFDFVGVNYYDGQGFIVPTSLGVTSAHEL 141

Query: 144 SGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYA 203
            GA++C+Q GTTTEL LAD+F+A+ + Y P+  E   E    Y A  CDAYT D S L A
Sbjct: 142 DGATVCIQTGTTTELNLADFFRANGISYEPVPIETNAEGQQQYLAGACDAYTTDASGLAA 201

Query: 204 LKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQ 263
            + T + P +H+ILP+IISK PL P +  GD +W +IV W+ +A+V AEE GIT  NI +
Sbjct: 202 TRATFEAPGDHIILPEIISKEPLGPVVRHGDNQWGDIVRWSFFALVAAEEYGITSANIEE 261

Query: 264 VSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIP 323
           +S  T NP++ R LG +   N+GE LGL  +W  R I   GNYGE+F + LG  + + + 
Sbjct: 262 LSAGTDNPEINRILGTE--GNLGEQLGLDAEWAKRAIAAEGNYGEIFAKYLGTDTPIGLD 319

Query: 324 RGYNALWSKGGLMYAPPIR 342
           RG NALW++GGL YA P R
Sbjct: 320 RGLNALWTQGGLQYAMPFR 338


>gi|209524398|ref|ZP_03272947.1| extracellular solute-binding protein family 3 [Arthrospira maxima
           CS-328]
 gi|209495189|gb|EDZ95495.1| extracellular solute-binding protein family 3 [Arthrospira maxima
           CS-328]
          Length = 355

 Score =  315 bits (807), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 140/354 (39%), Positives = 221/354 (62%), Gaps = 16/354 (4%)

Query: 3   KDFFVSILCLIILFFTSFSTNASILGD--------------IKKRGFLKCGINTGLVGFA 48
           + F + + CL  L  T+     S   D              +K RG L CG++ G+ GF+
Sbjct: 4   RGFLLLVSCLSALSLTACEPGGSPGSDGLAAGGSGQSRLNVVKNRGVLICGVDGGIPGFS 63

Query: 49  EVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTL 108
            V  +G++ G DVD C+A+++A+FDDP+ +QY  L++ ERF A+++ ++D+LSRNT WTL
Sbjct: 64  FVDQSGEYSGLDVDVCKAVAAALFDDPNAVQYRNLDSTERFEAMRAGEVDMLSRNTTWTL 123

Query: 109 LREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHN 168
            R+ S+G+ F P T+ DGQG ++    GI+S+      ++CV+AGTTTEL L D  +   
Sbjct: 124 SRDTSVGMEFAPTTFHDGQGMMVRADSGITSLEDFQDRAVCVEAGTTTELNLTDNMRERG 183

Query: 169 MKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAP 228
           + +  + F++ +   AAY   RC+  T D S L A + T   P++H+IL   +SK PL P
Sbjct: 184 ITFETVTFQQADPAYAAYAEGRCEGMTSDKSQLLARRSTLPNPNDHIILDVTMSKEPLGP 243

Query: 229 AIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEA 288
             +  D+ W++ V W  +A+  AEELGITQ N+ ++++ + NP ++RFLG++   ++G  
Sbjct: 244 VTLNNDSAWFDTVKWVTFALFEAEELGITQANVEEIAQTSENPTIRRFLGVE--GDLGTG 301

Query: 289 LGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           +GLT D+  R+IRH+GNY E++DRNLG  S+  +PR  N LW+ GGL+++PP R
Sbjct: 302 MGLTNDFAARVIRHVGNYAEVYDRNLGAGSQFNLPRNENELWTNGGLLFSPPFR 355


>gi|83595863|gb|ABC25225.1| glutamate/glutamine/aspartate/asparagine-binding protein bztA
           precursor [uncultured marine bacterium Ant4D3]
          Length = 340

 Score =  314 bits (805), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 146/315 (46%), Positives = 204/315 (64%), Gaps = 3/315 (0%)

Query: 29  DIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKER 88
           D++  G LKC + TGL GFA   ANG W+GFD DFCRA+++A+  D  K++++P   K R
Sbjct: 28  DVRAAGELKCVVTTGLAGFAAPDANGRWEGFDADFCRAVAAAVLGDGDKVKFVPSTGKTR 87

Query: 89  FLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASI 148
           F  L S + DIL RNT  TL R++ L L+F P+ ++DGQGF++    G++S   L GAS+
Sbjct: 88  FTMLNSGEGDILFRNTTETLSRDVDLKLSFLPVNFYDGQGFMVPAALGVTSAMDLDGASV 147

Query: 149 CVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTN 208
           C+Q GTTTEL LADYF+A+ M Y P+  E  EE    Y A RCD YT D S L + +   
Sbjct: 148 CIQTGTTTELNLADYFRANGMSYEPVPIETNEEGFTNYVAGRCDVYTTDASGLASTRAKF 207

Query: 209 DRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKN-INQVSKD 267
           D P++HV+LP+IISK PL  A+  GD +W++I  W   A++ AEE+G+TQ N +N  +  
Sbjct: 208 DDPTQHVVLPEIISKEPLGGAVRHGDDQWHDIGKWVVNALINAEEMGVTQANAMNLAANV 267

Query: 268 TTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYN 327
             NP + R +G + S  +G  LGL   W  R +   GNYGE+++RN+G  + L+I RG N
Sbjct: 268 GKNPGINRLVGSEGS--MGAMLGLDAKWAARAVAQGGNYGEIYERNVGPNTPLEIARGLN 325

Query: 328 ALWSKGGLMYAPPIR 342
            LW+ GG++YA PIR
Sbjct: 326 NLWNNGGVLYAAPIR 340


>gi|163745575|ref|ZP_02152935.1| glutamate/glutamine/aspartate/asparagine ABC transporter,
           periplasmic substrate-binding protein [Oceanibulbus
           indolifex HEL-45]
 gi|161382393|gb|EDQ06802.1| glutamate/glutamine/aspartate/asparagine ABC transporter,
           periplasmic substrate-binding protein [Oceanibulbus
           indolifex HEL-45]
          Length = 338

 Score =  314 bits (804), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 147/316 (46%), Positives = 207/316 (65%), Gaps = 2/316 (0%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           L D+K RG L CG+ TGL GFA   ANG+W+GFDV  CRA+++A+  D + ++++P   K
Sbjct: 25  LDDVKARGKLNCGVTTGLAGFAAPNANGEWEGFDVAVCRAVAAAVLGDKNAVEFVPTTGK 84

Query: 87  ERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGA 146
            RF AL S +ID L+RNT WT  R+  L   F  + Y+DGQGF++ K  G+SS   L GA
Sbjct: 85  TRFTALASGEIDFLARNTTWTFSRDTDLKFDFIGVNYYDGQGFMVPKALGVSSAKDLDGA 144

Query: 147 SICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKL 206
           ++C+Q GTTTEL LAD+F+ +N+ Y P+  E   E    Y A  CD YT D S L A + 
Sbjct: 145 TVCIQTGTTTELNLADFFRKNNISYEPVPVETNAEGQQQYLAGACDTYTTDASGLAATRA 204

Query: 207 TNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSK 266
           T + P +H++LP+IISK PL P +  GD EW +I  W   A++ AEELGIT  NI +++ 
Sbjct: 205 TFETPGDHILLPEIISKEPLGPLVRHGDNEWGDITRWVLNALIAAEELGITSANIEEMTG 264

Query: 267 DTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGY 326
           +T NP++ R LG + +  +GE +GL  +W  R I   GNYGE+F +N+G ++ + + RG 
Sbjct: 265 NTNNPEIARLLGTEGT--LGEMIGLDNEWAKRAIMAEGNYGEIFAKNIGEETPIGLARGL 322

Query: 327 NALWSKGGLMYAPPIR 342
           NA W+ GGL+YAPP+R
Sbjct: 323 NAQWTDGGLLYAPPVR 338


>gi|269964209|ref|ZP_06178500.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Vibrio harveyi 1DA3]
 gi|269831058|gb|EEZ85226.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Vibrio harveyi 1DA3]
          Length = 285

 Score =  312 bits (800), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 144/274 (52%), Positives = 191/274 (69%), Gaps = 3/274 (1%)

Query: 69  SAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQG 128
           S    + +K++Y+PL AKERF ALQS +ID+LSRNT WTL R+ +LGL F  + Y+DGQG
Sbjct: 15  SRSLGNKTKVKYVPLTAKERFTALQSGEIDVLSRNTTWTLHRDTALGLNFVGVNYYDGQG 74

Query: 129 FIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRA 188
           F++ K  G+SS  +L GAS+CVQ+GTTTEL LADYF+   M Y P+VF+   +    + A
Sbjct: 75  FMVKKDLGVSSAKELDGASVCVQSGTTTELNLADYFRNQGMAYKPVVFDTAAQTSKGFDA 134

Query: 189 HRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAM 248
            RCD  T D S LYAL+L    PS   +LP+IISK PL P + QGD +W+NI  WT +AM
Sbjct: 135 GRCDVLTTDQSGLYALRLNLKDPSSATVLPEIISKEPLGPVVRQGDDQWFNIAKWTLFAM 194

Query: 249 VTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGE 308
           V AEE GIT KN +++ K + +P+++R LG+D     G+ LG+  DW Y++I+ +GNYGE
Sbjct: 195 VNAEEYGITSKNADEMLK-SKDPNIKRILGVDGPK--GKGLGIRDDWGYQVIKQVGNYGE 251

Query: 309 MFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
            F+R +G  S LKI RG NALW+ GG MYAPPIR
Sbjct: 252 SFERTVGTGSPLKISRGVNALWNAGGFMYAPPIR 285


>gi|317404416|gb|EFV84833.1| extracellular solute-binding protein [Achromobacter xylosoxidans
           C54]
          Length = 338

 Score =  312 bits (799), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 142/314 (45%), Positives = 221/314 (70%), Gaps = 3/314 (0%)

Query: 29  DIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKER 88
           ++KK+GF++CG++TG+ GF+   + G++KG DVD CRA+++ +F D SK +  PLN ++R
Sbjct: 28  NVKKKGFVQCGVSTGIPGFSIADSKGEYKGLDVDLCRAVAATMFGDASKFKVTPLNTQQR 87

Query: 89  FLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASI 148
           F ALQS ++D+L+RNT  TL R+ +LGL    + Y+D QG ++ K   + S  +L+GA+I
Sbjct: 88  FTALQSGEVDVLTRNTTVTLTRDTTLGLIGVGVNYYDSQGVMVSKDLNVKSAKELNGATI 147

Query: 149 CVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTN 208
           CVQ GTTTEL LAD+F+   +++ P+V ++ +EI  A+ A RCDA+T D S L + + T 
Sbjct: 148 CVQPGTTTELNLADWFRGQKIEFKPVVIDKYDEIIRAFSAGRCDAFTTDKSQLASTRTTL 207

Query: 209 DRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDT 268
           + P +++ILP+  SK PL P + QGD +W+N++ W+  AM+ AEE GIT KN+++++K +
Sbjct: 208 ENPDKYIILPEDFSKEPLGPMVRQGDEQWFNVIRWSLNAMLEAEEYGITSKNVDEMTK-S 266

Query: 269 TNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNA 328
           TNP++QR LG+  +  +G+ LG+   W Y II+ +GNYGE F+  LG  S +K+ RG NA
Sbjct: 267 TNPNIQRILGV--TPGMGKNLGVDDKWAYNIIKQVGNYGESFEATLGKSSAMKLERGLNA 324

Query: 329 LWSKGGLMYAPPIR 342
            + +GGLMY  P+R
Sbjct: 325 SYKQGGLMYGWPVR 338


>gi|126728211|ref|ZP_01744027.1| glutamate/glutamine/aspartate/asparagine ABC transporter,
           periplasmic substrate-binding protein [Sagittula
           stellata E-37]
 gi|126711176|gb|EBA10226.1| glutamate/glutamine/aspartate/asparagine ABC transporter,
           periplasmic substrate-binding protein [Sagittula
           stellata E-37]
          Length = 336

 Score =  312 bits (799), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 141/323 (43%), Positives = 206/323 (63%), Gaps = 3/323 (0%)

Query: 21  STNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQY 80
           +  A  L ++K RG L CG+NTGLVGFA   +NG+W+GFDV  CRA+++A+  DP  + +
Sbjct: 16  AATAGTLDEVKSRGTLNCGVNTGLVGFASKDSNGEWRGFDVGLCRAVAAAVLGDPMAVNF 75

Query: 81  LPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSV 140
           +   A  RF AL + +ID+L RNT W+   +I L + F  I Y+DGQ F++ K  G+SS 
Sbjct: 76  VETTAATRFTALNAGEIDLLVRNTTWSFSTDIDLKVDFAGINYYDGQAFMVPKTLGLSSA 135

Query: 141 SQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISA 200
            +L G SICVQAGTT+ L + +YF  + M Y  +  E   E    Y    C+ Y+ D S 
Sbjct: 136 RELDGRSICVQAGTTSALNVDEYFDRYQMSYEAVPVEGTAEAQTLYLEGACEVYSSDASQ 195

Query: 201 LYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKN 260
           L A++ T   P +HV+L DIISK PL PA+  GD +W +IV WT  A++ AEELG+   N
Sbjct: 196 LAAIRATFGNPGDHVLLEDIISKEPLGPAVRHGDNDWADIVRWTLNALIAAEELGVNSAN 255

Query: 261 INQV-SKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSE 319
           ++++ ++ T+ P+++R LG++    +GE LGL  DW  R I+  GNYGE+F RN+G  + 
Sbjct: 256 VDELKAQGTSTPEIKRLLGLE--GRMGEMLGLDSDWAVRAIKAGGNYGELFSRNIGVDTP 313

Query: 320 LKIPRGYNALWSKGGLMYAPPIR 342
           + + RG N  W++GGL+Y+PP R
Sbjct: 314 IGLSRGLNLQWTEGGLLYSPPFR 336


>gi|27378020|ref|NP_769549.1| amino acid binding protein [Bradyrhizobium japonicum USDA 110]
 gi|27351166|dbj|BAC48174.1| bll2909 [Bradyrhizobium japonicum USDA 110]
          Length = 337

 Score =  312 bits (799), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 145/317 (45%), Positives = 209/317 (65%), Gaps = 4/317 (1%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           L  +K RG L CG++ G  GF+   + G++KG DVD+CRAL++ +  D SK++Y+ L A+
Sbjct: 24  LDTVKSRGTLVCGVSAGFAGFSAPDSQGNYKGLDVDYCRALAAGVLGDASKVRYVSLTAQ 83

Query: 87  ERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGA 146
            RF ALQS +ID+L RN+  T LR ++LGL   PI ++DGQGF++ K  G+  +  L GA
Sbjct: 84  NRFTALQSGEIDVLYRNSTQTYLRGVTLGLRQGPINFYDGQGFVVKKDLGVKDIKDLKGA 143

Query: 147 SICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALY-ALK 205
           ++CV  GTT E+TL DY +A+ + + P+VF+RV+ +   +   RCDA T D SAL  A+ 
Sbjct: 144 TVCVAQGTTHEVTLGDYGRANGIDWKPLVFDRVDTMYQTFFGGRCDAMTQDASALAGAVT 203

Query: 206 LTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVS 265
                P+++V+LP  ISK PL P    GD  W +I++W HY ++ AEELG+TQ N+++++
Sbjct: 204 TAAPNPADYVVLPQTISKEPLGPFTRNGDEVWSDIITWLHYGLIEAEELGVTQANVDEMA 263

Query: 266 KDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRG 325
           K  T P +QR LG   S ++G  LGL   W    I+  GNYGE+++RN+G  S LK+ RG
Sbjct: 264 KSQT-PAIQRLLG--ASGDLGSRLGLDNKWLVTAIKATGNYGEIYERNVGKASPLKLDRG 320

Query: 326 YNALWSKGGLMYAPPIR 342
            N LWSKGGLMYA P +
Sbjct: 321 LNGLWSKGGLMYAVPFK 337


>gi|323698172|ref|ZP_08110084.1| extracellular solute-binding protein family 3 [Desulfovibrio sp.
           ND132]
 gi|323458104|gb|EGB13969.1| extracellular solute-binding protein family 3 [Desulfovibrio
           desulfuricans ND132]
          Length = 337

 Score =  312 bits (799), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 143/334 (42%), Positives = 221/334 (66%), Gaps = 3/334 (0%)

Query: 9   ILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALS 68
           I  +I L   + S  A  L  +++ G L  G++ G+ GF+   +NG W GFDVD  +A++
Sbjct: 7   IFMVIALLAMAGSALAGTLEKVQQNGELVLGVSEGVAGFSAPDSNGKWAGFDVDMGKAVA 66

Query: 69  SAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQG 128
           +A+  +P  I+Y+PL +K++ +A+ S Q+D LSR T WT+ R+   G+ F  + ++DGQG
Sbjct: 67  AAVLKNPDAIKYVPLASKQKIVAVSSGQVD-LSRGTTWTMKRDCKQGVDFTVVLFYDGQG 125

Query: 129 FIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRA 188
            ++ K  G++  ++L GAS+ V +GTT+EL +AD+ +A+N+K   +VFE  +E   AY A
Sbjct: 126 LMVKKGLGVTKATELDGASVAVVSGTTSELNVADFARANNIKLETVVFESKKEAFNAYVA 185

Query: 189 HRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAM 248
            R DA+T D+S L +L+     P EH+ILP++ SK PL+P +  GD +W ++V+W  + +
Sbjct: 186 GRADAFTTDVSQLASLRAGTTNPDEHIILPEVFSKEPLSPFVRHGDQQWKDLVTWVLFGL 245

Query: 249 VTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGE 308
           + AEE GITQ N+ ++   +T+P VQR LG   + ++G  + L  DW  R I+ +GNYGE
Sbjct: 246 IEAEEKGITQANVLEMKAKSTDPVVQRMLG--ATGDVGALIDLDNDWLVRAIQAVGNYGE 303

Query: 309 MFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           M+DRN G +S LKIPRG+N LW+KGGL+YA PIR
Sbjct: 304 MYDRNFGPKSALKIPRGHNNLWTKGGLIYAMPIR 337


>gi|313902268|ref|ZP_07835673.1| extracellular solute-binding protein family 3 [Thermaerobacter
           subterraneus DSM 13965]
 gi|313467419|gb|EFR62928.1| extracellular solute-binding protein family 3 [Thermaerobacter
           subterraneus DSM 13965]
          Length = 385

 Score =  311 bits (797), Expect = 9e-83,   Method: Compositional matrix adjust.
 Identities = 136/313 (43%), Positives = 210/313 (67%), Gaps = 3/313 (0%)

Query: 30  IKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERF 89
           +  RG L CG+N  L GF+ +  +G   GFD DFCRA+++A+FDDP+ +++ PL+A+ERF
Sbjct: 76  VLSRGKLICGVNGQLPGFSYLDPSGQMTGFDADFCRAIAAALFDDPNAVEFRPLSAQERF 135

Query: 90  LALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASIC 149
            A+QS ++D+L RNT WTL R+   G+ F P T++DG G ++ K + + S++ L GA+IC
Sbjct: 136 TAVQSGEVDVLIRNTTWTLGRDTVNGMEFLPTTFYDGGGVMVRKDRNVKSLADLDGATIC 195

Query: 150 VQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTND 209
           V +GTT E+ L D  +A    + P  FE  +++ A Y +  CDA T D S L   +    
Sbjct: 196 VLSGTTNEMVLTDRMRALGASFTPKTFEDADQLYATYESGGCDAVTSDKSQLAGRRAVLS 255

Query: 210 RPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTT 269
            P  HVIL +++SK PL PA+   D+ W+++V W  +A + AEE GI  +N++Q  K++ 
Sbjct: 256 DPDNHVILDEMLSKEPLGPAVKNNDSTWFDVVKWIVFATIQAEEFGINSQNVDQF-KNSD 314

Query: 270 NPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNAL 329
           NPD++RFLG++    +G+ LG++ D+ YR+I+H+GNYGE+++RNLG  +  K+ RG N L
Sbjct: 315 NPDIRRFLGVE--GELGKGLGISNDFAYRVIKHVGNYGEIYERNLGPDTPFKLERGLNEL 372

Query: 330 WSKGGLMYAPPIR 342
           W+ GGL+Y+PP R
Sbjct: 373 WTNGGLLYSPPFR 385


>gi|293602099|ref|ZP_06684552.1| amino acid ABC superfamily ATP binding cassette transporter, amino
           acid-binding protein [Achromobacter piechaudii ATCC
           43553]
 gi|292819501|gb|EFF78529.1| amino acid ABC superfamily ATP binding cassette transporter, amino
           acid-binding protein [Achromobacter piechaudii ATCC
           43553]
          Length = 357

 Score =  311 bits (797), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 142/314 (45%), Positives = 223/314 (71%), Gaps = 3/314 (0%)

Query: 29  DIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKER 88
           ++KK+GF++CG++TG+ GF+   + G++KG DVD CRA++S +F D +K+++ PLN ++R
Sbjct: 47  NVKKKGFVQCGVSTGIPGFSIADSKGEYKGIDVDMCRAIASTMFGDATKVKFTPLNTQQR 106

Query: 89  FLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASI 148
           F ALQS ++D+L+RNT  TL R+ +LGL    + Y+D QG ++ K   + S  +L+GA+I
Sbjct: 107 FTALQSGEVDVLTRNTTVTLTRDTTLGLIGVGVNYYDSQGVMVSKDLNVKSAKELNGATI 166

Query: 149 CVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTN 208
           CVQ GTTTEL LAD+F+   +++ P+V ++ +EI  A+ A RCDA+T D S L + + T 
Sbjct: 167 CVQPGTTTELNLADWFRGQKIEFKPVVIDKYDEIIRAFSAGRCDAFTTDKSQLASTRTTL 226

Query: 209 DRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDT 268
           + P + VILP+  SK PL P + QGD +W+N+V W+  AM+ AEE GIT+ N+++++K +
Sbjct: 227 ENPDKFVILPEDFSKEPLGPMVRQGDEQWFNVVRWSLNAMLEAEEYGITKANVDEMTK-S 285

Query: 269 TNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNA 328
           +NP++QR LG+  +  +G+ LG+   W Y II+++GNYGE F+  LG  S +K+ RG NA
Sbjct: 286 SNPNIQRILGV--TPGMGKNLGVDDKWAYNIIKNVGNYGESFEATLGKGSAMKLERGLNA 343

Query: 329 LWSKGGLMYAPPIR 342
            + +GGLMY  P+R
Sbjct: 344 SYKQGGLMYGWPVR 357


>gi|311109074|ref|YP_003981927.1| general L-amino acid-binding periplasmic protein AapJ 4
           [Achromobacter xylosoxidans A8]
 gi|310763763|gb|ADP19212.1| general L-amino acid-binding periplasmic protein AapJ 4
           [Achromobacter xylosoxidans A8]
          Length = 338

 Score =  311 bits (796), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 143/314 (45%), Positives = 221/314 (70%), Gaps = 3/314 (0%)

Query: 29  DIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKER 88
           ++KK+GF++CG++TG+ GF+   + G++KG DVD CRA++S +F D +K+++ PLN ++R
Sbjct: 28  NVKKKGFVQCGVSTGIPGFSIADSKGEYKGIDVDLCRAIASTMFGDATKVKFTPLNTQQR 87

Query: 89  FLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASI 148
           F ALQS ++D+L+RNT  TL R+ +LGL    + Y+D QG ++ K   + S  +L+GA+I
Sbjct: 88  FTALQSGEVDVLTRNTTVTLTRDTTLGLIGVGVNYYDSQGVMVSKDLNVKSAKELNGATI 147

Query: 149 CVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTN 208
           CVQ GTTTEL LAD+F+   +++ P+V ++ +EI  A+ A RCDA+T D S L + + T 
Sbjct: 148 CVQPGTTTELNLADWFRGQKIEFKPVVIDKYDEIIRAFSAGRCDAFTTDKSQLASTRTTL 207

Query: 209 DRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDT 268
           + P + VILP+  SK PL P + QGD +W+NIV W+  AM+ AEE GIT+ N+++++K +
Sbjct: 208 ENPDKFVILPEDFSKEPLGPMVRQGDEQWFNIVRWSLNAMLEAEEYGITKANVDEMAK-S 266

Query: 269 TNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNA 328
            NP++QR LG+  +  +G+ LG+   W Y II+++GNYGE F+  LG  S +K+ RG NA
Sbjct: 267 PNPNIQRILGV--TPGMGKNLGVDDKWAYNIIKNVGNYGESFENTLGKSSAMKLERGLNA 324

Query: 329 LWSKGGLMYAPPIR 342
            +  GGLMY  P+R
Sbjct: 325 SYKNGGLMYGWPVR 338


>gi|330429592|gb|AEC20926.1| putative ABC transporter periplasmic amino acid-binding protein
           [Pusillimonas sp. T7-7]
          Length = 338

 Score =  310 bits (795), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 147/329 (44%), Positives = 219/329 (66%), Gaps = 4/329 (1%)

Query: 15  LFFTSFSTNASILGD-IKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFD 73
           LFF + ++ A    D +K +GF++CG +T L GF+   + G W G D+D C+A+++ +F 
Sbjct: 13  LFFAAATSQAGETYDAVKAKGFVQCGTHTALPGFSIADSKGVWSGIDIDLCKAIATMMFG 72

Query: 74  DPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHK 133
           D +K +  P+  ++RF ALQS +ID+L+RNT  T+ R+ +LGL    + Y+D QG ++ K
Sbjct: 73  DATKFKTTPVTTQQRFTALQSGEIDVLTRNTTATMTRDTTLGLMSAGVNYYDSQGIMVSK 132

Query: 134 KKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDA 193
           + G+ S  +LSGA++CVQ GTTTEL LAD+F+A+N+ + P+V    +E   +Y A RCDA
Sbjct: 133 ELGVKSAKELSGAAVCVQPGTTTELNLADWFRANNLDFKPVVINSPDEAMRSYVAGRCDA 192

Query: 194 YTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEE 253
           +T D S L  ++ T   P +HVILP+  SK PL P + QGD +W+ +V W    M+ AEE
Sbjct: 193 FTTDKSGLATIRTTLANPDDHVILPEDFSKEPLGPMVRQGDDQWFMVVRWALNTMLEAEE 252

Query: 254 LGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRN 313
            GIT KN++++ K ++NP++QR LG+  +  +G+ LGL   W Y +I+ +GNYGE F+RN
Sbjct: 253 YGITSKNVDEMLK-SSNPNIQRILGV--TGEMGKGLGLDNKWAYNLIKQVGNYGESFERN 309

Query: 314 LGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           LG  S +K+ RG NA W  GGLMY  PIR
Sbjct: 310 LGAGSAMKLERGINAQWRDGGLMYGWPIR 338


>gi|167041376|gb|ABZ06129.1| putative bacterial extracellular solute-binding protein, family 3
           [uncultured marine microorganism HF4000_005K23]
          Length = 348

 Score =  310 bits (794), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 151/346 (43%), Positives = 214/346 (61%), Gaps = 9/346 (2%)

Query: 2   YKDFFVSILCLIILFFTSFSTNAS----ILGDIKKRGFLKCGINTGLVGFAEVKANGDWK 57
           +K     I  + +LF       A+     L +  K+  LKCG++ GL GF+ + A G+W 
Sbjct: 7   FKHLLSLIAVVAVLFALGTEAMAAKKSKTLKNTIKKDTLKCGVSQGLPGFSNMDAAGNWT 66

Query: 58  GFDVDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLA 117
           G DVD CRA+++A+  D  K+ ++ L+AKERF AL + +IDILSRNT WTL R+  +GL 
Sbjct: 67  GVDVDVCRAVAAAVLGDSGKVTFIALSAKERFTALIAGEIDILSRNTTWTLSRDADIGLT 126

Query: 118 FRPITYFDGQGFIMHKKKGISSVSQL-SGASICVQAGTTTELTLADYFKAHNMKYHPIVF 176
           F  + ++DGQGF++ K  GI+S +   SG S CV  GTTTEL + D+F +  + Y P+VF
Sbjct: 127 FVGVNFYDGQGFMVRKDSGITSTNDFKSGLSACVNIGTTTELNMRDFFTSKGITYEPVVF 186

Query: 177 ERVEEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTE 236
           E+ +E+  AY A RCD YT D S L A +     P +H++LP+ ISK PL P + QGD  
Sbjct: 187 EKADEVKDAYDAGRCDTYTTDKSGLAAQRTKLANPDDHIVLPETISKEPLGPVVRQGDAV 246

Query: 237 WYNIVSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWT 296
           W +IV W+   M+ AEE GI   N + + K + NP ++R +G +    +G ALGL  DW+
Sbjct: 247 WEDIVRWSLNVMIEAEEYGINSANADSM-KTSKNPQIKRLVGAE--GELGAALGLDNDWS 303

Query: 297 YRIIRHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
            RII+ +GNYGE + RN+ +   L   RG N LW+KGGL+Y PP R
Sbjct: 304 LRIIKQVGNYGESYKRNIADTGILPT-RGPNELWTKGGLLYVPPAR 348


>gi|220910023|ref|YP_002485334.1| family 3 extracellular solute-binding protein [Cyanothece sp. PCC
           7425]
 gi|219866634|gb|ACL46973.1| extracellular solute-binding protein family 3 [Cyanothece sp. PCC
           7425]
          Length = 364

 Score =  310 bits (793), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 144/316 (45%), Positives = 208/316 (65%), Gaps = 3/316 (0%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           L  I  RG L CG++  L GF+ V   G++ G DVD CRA+++A+FDDP  +++  LNAK
Sbjct: 52  LATILNRGQLICGVSGELPGFSFVDQQGNYAGLDVDVCRAIAAALFDDPEAVEFRNLNAK 111

Query: 87  ERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGA 146
           ERF ALQ+ +IDILSRNT  T+ R+ ++G+ F P+ ++DGQG ++  + GI S+  L G 
Sbjct: 112 ERFTALQTGEIDILSRNTTLTMSRDTAIGIQFAPVVFYDGQGIMVRNQDGIRSLKDLQGK 171

Query: 147 SICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKL 206
           SIC+Q GTT E  L D  +   + Y P++FE +  + A Y   RC A + D S L + + 
Sbjct: 172 SICLQTGTTHEQNLTDQTRKLGIDYQPVIFEDINTMFATYAQGRCQAVSADRSGLISRRT 231

Query: 207 TNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSK 266
           T   P+ + ILPD++SK PLAPA+ +GD  W  +V W  Y+++ AEELGIT +NI +   
Sbjct: 232 TLPNPNGNEILPDVLSKEPLAPAVAKGDPTWSTVVEWIIYSLIEAEELGITTQNI-ESKL 290

Query: 267 DTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGY 326
            + +P ++RFLG  +  N+G  LGL+ D+  RII+ +GNYGE++DRNLG  + L + RG 
Sbjct: 291 QSADPTLRRFLG--REGNLGHGLGLSNDFAVRIIKGVGNYGEIYDRNLGPNTLLNLERGL 348

Query: 327 NALWSKGGLMYAPPIR 342
           N  WSKGGL+Y+PP R
Sbjct: 349 NQQWSKGGLLYSPPFR 364


>gi|294675892|ref|YP_003576507.1| glutamate/aspartate ABC transporter periplasmic
           glutamate/aspartate-binding protein BztA [Rhodobacter
           capsulatus SB 1003]
 gi|294474712|gb|ADE84100.1| glutamate/aspartate ABC transporter, periplasmic
           glutamate/aspartate-binding protein BztA [Rhodobacter
           capsulatus SB 1003]
          Length = 338

 Score =  310 bits (793), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 149/316 (47%), Positives = 211/316 (66%), Gaps = 2/316 (0%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           L D+K RG L CG N GL GFA   ANG ++GFDV  C+A+++A+  DP K++Y+PL  +
Sbjct: 25  LDDVKARGQLICGSNPGLTGFAAPDANGVYQGFDVAVCKAVAAAVLGDPMKVKYVPLTGE 84

Query: 87  ERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGA 146
            RF AL S ++D+L RN+ WT  R+  L L F  + Y+DGQGF+++K  G+SS  +L GA
Sbjct: 85  TRFTALASGEVDVLVRNSTWTFSRDTELALDFVAVNYYDGQGFMVNKSLGVSSAKELDGA 144

Query: 147 SICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKL 206
           +ICVQ GTTTE+ LAD+FKA+NM Y P+      E    + A  CD+YT D S L + + 
Sbjct: 145 TICVQTGTTTEMNLADFFKANNMTYTPVNIADDAEGQQKFAAGACDSYTTDASGLASSRA 204

Query: 207 TNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSK 266
           T    ++ VILP+IISK PL P +  GD  W +IV W+ YA+V AEE GIT+ N+ +V+ 
Sbjct: 205 TLPNAADIVILPEIISKEPLGPVVRHGDNNWGDIVRWSFYALVAAEEYGITKANLEEVAA 264

Query: 267 DTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGY 326
            T NP+++R LG++   ++G+ +GL  D+  R I   GNYGE+F+ N+G  + + + RG 
Sbjct: 265 STQNPEIRRLLGLE--GDMGKKIGLDNDFAKRAILASGNYGEVFEANIGASTSIGLARGL 322

Query: 327 NALWSKGGLMYAPPIR 342
           NA W++GGLMYAPP R
Sbjct: 323 NAQWTQGGLMYAPPFR 338


>gi|259416581|ref|ZP_05740501.1| glutamate/glutamine/aspartate/asparagine-binding protein
           bztAprecursor [Silicibacter sp. TrichCH4B]
 gi|259348020|gb|EEW59797.1| glutamate/glutamine/aspartate/asparagine-binding protein
           bztAprecursor [Silicibacter sp. TrichCH4B]
          Length = 335

 Score =  310 bits (793), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 143/334 (42%), Positives = 212/334 (63%), Gaps = 3/334 (0%)

Query: 10  LCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSS 69
           L + ++  ++ +  A  L ++K+RG L CG+  GL GFA +  +G W G +V FCRAL++
Sbjct: 4   LTVALVALSAGTAMAGTLEEVKERGKLICGVYPGLPGFAFLSEDGTWMGSEVAFCRALAA 63

Query: 70  AIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGF 129
           A+  DP+ ++++P  +K RF AL S ++D+L+RNT WT  R++ L   F  + Y+DGQGF
Sbjct: 64  AVLKDPTAVEFVPTPSKTRFTALASGEVDVLARNTTWTFSRDVDLKFEFAGVNYYDGQGF 123

Query: 130 IMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAH 189
           ++ K+ G++S  +L GA++C+Q GTTTEL LAD+F+A+ + Y P+  E   E    Y A 
Sbjct: 124 LVPKELGVTSAKELDGATVCIQTGTTTELNLADFFRANGISYEPVPVETNAESQQQYLAG 183

Query: 190 RCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMV 249
            CD YT D + L A +     P  H+ILP+ ISK PL P +  GD +W ++V WT  A++
Sbjct: 184 ACDVYTTDKAGLAATRSAFADPQNHLILPETISKEPLGPLVRHGDNQWGDVVRWTLNALI 243

Query: 250 TAEELGITQKNINQVSKDTT-NPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGE 308
            AEELGITQ N+  ++   T NP++ R LG + +   GE LGL +DW    I   GNYGE
Sbjct: 244 IAEELGITQDNVTALAASATNNPEINRMLGTEGT--YGEMLGLDQDWAVAAISAGGNYGE 301

Query: 309 MFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           +F R LG  + + + RG NAL+  GG++YAPP R
Sbjct: 302 IFARFLGEDTLIGLDRGLNALYRDGGILYAPPFR 335


>gi|3182934|sp|Q52663|BZTA_RHOCA RecName: Full=Glutamate/glutamine/aspartate/asparagine-binding
           protein BztA; Flags: Precursor
 gi|1655712|gb|AAB17886.1| BztA [Rhodobacter capsulatus SB 1003]
          Length = 338

 Score =  310 bits (793), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 149/316 (47%), Positives = 211/316 (66%), Gaps = 2/316 (0%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           L D+K RG L CG N GL GFA   ANG ++GFDV  C+A+++A+  DP K++Y+PL  +
Sbjct: 25  LDDVKARGQLICGSNPGLTGFAAPDANGVYQGFDVAVCKAVAAAVLGDPMKVKYVPLTGE 84

Query: 87  ERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGA 146
            RF AL S ++D+L RN+ WT  R+  L L F  + Y+DGQGF+++K  G+SS  +L GA
Sbjct: 85  TRFTALASGEVDVLVRNSTWTFSRDTELALDFVAVNYYDGQGFMVNKSLGVSSAKELDGA 144

Query: 147 SICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKL 206
           +ICVQ GTTTE+ LAD+FKA+NM Y P+      E    + A  CD+YT D S L + + 
Sbjct: 145 TICVQTGTTTEMNLADFFKANNMTYTPVNIADDAEGQQKFAAGACDSYTTDASGLASSRA 204

Query: 207 TNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSK 266
           T    ++ VILP+IISK PL P +  GD  W +IV W+ YA+V AEE GIT+ N+ +V+ 
Sbjct: 205 TLPNAADIVILPEIISKEPLGPVVRHGDNNWGDIVRWSFYALVAAEEYGITKANLEEVAA 264

Query: 267 DTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGY 326
            T NP+++R LG++   ++G+ +GL  D+  R I   GNYGE+F+ N+G  + + + RG 
Sbjct: 265 STQNPEIRRLLGLE--GDMGKKIGLDNDFAKRAILASGNYGEVFEANIGASTSIGLARGL 322

Query: 327 NALWSKGGLMYAPPIR 342
           NA W++GGLMYAPP R
Sbjct: 323 NAQWTQGGLMYAPPFR 338


>gi|119489532|ref|ZP_01622293.1| polar amino acid transport system substrate-binding proetin
           [Lyngbya sp. PCC 8106]
 gi|119454611|gb|EAW35758.1| polar amino acid transport system substrate-binding proetin
           [Lyngbya sp. PCC 8106]
          Length = 357

 Score =  309 bits (792), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 136/321 (42%), Positives = 214/321 (66%), Gaps = 3/321 (0%)

Query: 22  TNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYL 81
           T+ S L  +K RG L CG++ G+ GF+ V  NG++ G DVD C+A+++AIF+DP+ ++Y 
Sbjct: 40  TSQSRLDTVKSRGKLVCGVDGGIPGFSFVNENGEYSGLDVDMCKAVAAAIFNDPNAVEYR 99

Query: 82  PLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVS 141
            L++ ERF AL+S ++D+LSRNT WT+ R+ S+G+ F P T++DGQG ++ +  GI+S+ 
Sbjct: 100 NLDSTERFEALKSGEVDMLSRNTTWTITRDTSVGMEFAPTTFYDGQGMMVRRDSGITSLE 159

Query: 142 QLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISAL 201
              G ++CV+AGTTTEL L D  +   +      +++ +   AAY    CD  T D S L
Sbjct: 160 DFEGRTVCVEAGTTTELNLTDNMRKAGVNSETKTYQQADPAYAAYAEGACDGMTSDKSQL 219

Query: 202 YALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNI 261
            A + T   P +H++L   +SK PL P  I  D+ W+++V WT +A++  EELGI Q N+
Sbjct: 220 VARRSTLPNPDDHILLDVTMSKEPLGPVTINNDSAWFDVVKWTTFALIEGEELGINQANV 279

Query: 262 NQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELK 321
           +Q+ K +  P ++RFLGI+   ++G+ LGL  ++   +I+ +GNYGE+++RNLG  S+ +
Sbjct: 280 DQL-KSSEEPTIRRFLGIE--GDLGQGLGLDNEFAANVIKQVGNYGEIYERNLGQGSQFR 336

Query: 322 IPRGYNALWSKGGLMYAPPIR 342
           + RG NALW+ GGL+Y+PP R
Sbjct: 337 LDRGQNALWNNGGLLYSPPFR 357


>gi|295689853|ref|YP_003593546.1| extracellular solute-binding protein family 3 [Caulobacter segnis
           ATCC 21756]
 gi|295431756|gb|ADG10928.1| extracellular solute-binding protein family 3 [Caulobacter segnis
           ATCC 21756]
          Length = 376

 Score =  309 bits (791), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 144/318 (45%), Positives = 207/318 (65%), Gaps = 6/318 (1%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           L  ++ RG+L CG+  GL+GFA     G W+GFD DFCRA ++AIF      ++ P ++ 
Sbjct: 63  LAAVRARGYLVCGVQQGLIGFAYADNTGRWRGFDTDFCRATAAAIFGRAEAARFTPTSST 122

Query: 87  ERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGA 146
           ER   LQ+ ++D+L RNT  T  R+      F  + Y+DGQ F++ K  G++  +QL+GA
Sbjct: 123 ERLTVLQAGEVDVLWRNTSATFSRDAKFD--FSGVNYYDGQAFLVRKALGVAHAAQLNGA 180

Query: 147 SICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKL 206
            IC+Q G+T+E+ L DYF+AH + Y P+VF+  ++  AAY   +CD YT D+S L A + 
Sbjct: 181 RICIQTGSTSEMNLTDYFRAHKLTYEPVVFDTEDKARAAYGREQCDVYTADLSNLAAARA 240

Query: 207 TNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSK 266
           T  RP +H+ILP++ISK PL P + QGD  W N+V WT  AM+ AEELG+T  N+  +  
Sbjct: 241 TLARPGDHLILPEVISKEPLGPVVRQGDDAWGNVVRWTLNAMILAEELGVTSANVEALRA 300

Query: 267 DTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGY 326
            + NP+++R LG +     G  +GL+ D+ ++IIR +GNYGE+F RNLG  + LKI RG 
Sbjct: 301 RSDNPEIRRLLGAEP--GYGAMIGLSDDFAFQIIRQVGNYGEVFARNLGPATPLKIERGL 358

Query: 327 NALW--SKGGLMYAPPIR 342
           NALW  S  GL+YAPP+R
Sbjct: 359 NALWNASPPGLLYAPPMR 376


>gi|315499877|ref|YP_004088680.1| extracellular solute-binding protein family 3 [Asticcacaulis
           excentricus CB 48]
 gi|315417889|gb|ADU14529.1| extracellular solute-binding protein family 3 [Asticcacaulis
           excentricus CB 48]
          Length = 370

 Score =  308 bits (790), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 147/328 (44%), Positives = 221/328 (67%), Gaps = 4/328 (1%)

Query: 17  FTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPS 76
            T   ++++ L  +  RG + CG++ GL+GF+    +G W+GFDVDFCRAL++AIF D  
Sbjct: 45  LTPTQSDSATLKAVLARGRVSCGVHPGLIGFSYKDNSGRWRGFDVDFCRALAAAIFSDAD 104

Query: 77  KIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKG 136
           K+ Y+PL   ERF AL++ ++D+L R+T WTL R+ +  + +  I Y+DGQGF++ K   
Sbjct: 105 KVTYVPLTTTERFEALKTGKVDVLWRSTSWTLSRDAADQVDYAGINYYDGQGFLVRKSLR 164

Query: 137 ISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTG 196
           ++S ++L+GA ICVQ G+T+EL LAD+F+A  +KY+P+V +  +E   AY A +CDA + 
Sbjct: 165 LNSATELNGARICVQTGSTSELNLADFFRARGLKYNPVVVKNEDEGRDAYAAGQCDALSS 224

Query: 197 DISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGI 256
           D+SAL A + T   P+ H ILP+IISK PL P + QGD +W +IV WT Y  + AEELG+
Sbjct: 225 DVSALAAARATLSDPTAHTILPEIISKEPLGPVVRQGDDQWTDIVRWTLYVTIVAEELGV 284

Query: 257 TQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGN 316
           + + +     ++ NP+V+R   +    N+G  LGL  +W Y I+  +GNYGE+FDRN+G 
Sbjct: 285 SSETVKAQQLESQNPEVRRL--LGSEGNLGGGLGLGPEWAYNILSQVGNYGEIFDRNIGA 342

Query: 317 QSELKIPRGYNALWS--KGGLMYAPPIR 342
            S LK+ RG NA W+  + GL+Y+PP+R
Sbjct: 343 DSPLKLSRGLNAQWNAPERGLLYSPPVR 370


>gi|218246879|ref|YP_002372250.1| family 3 extracellular solute-binding protein [Cyanothece sp. PCC
           8801]
 gi|257059921|ref|YP_003137809.1| extracellular solute-binding protein family 3 [Cyanothece sp. PCC
           8802]
 gi|218167357|gb|ACK66094.1| extracellular solute-binding protein family 3 [Cyanothece sp. PCC
           8801]
 gi|256590087|gb|ACV00974.1| extracellular solute-binding protein family 3 [Cyanothece sp. PCC
           8802]
          Length = 363

 Score =  308 bits (790), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 145/326 (44%), Positives = 217/326 (66%), Gaps = 6/326 (1%)

Query: 18  TSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSK 77
           +S   + S L  IK+RG L CG+N  + GF+ V   G + G DVD CRA+++A+FDDPSK
Sbjct: 43  SSSKVSGSRLATIKERGTLICGVNGEVPGFSFVDEQGQYSGLDVDMCRAIAAALFDDPSK 102

Query: 78  IQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGI 137
           ++Y  L+A+ER  A+QS ++D+L+RNT WT+ R+ ++G+ F P  ++DGQG +  K  G 
Sbjct: 103 VEYRKLSAQERLTAVQSGEVDVLNRNTTWTMSRDTAVGMEFAPTVFYDGQGIMATKASGA 162

Query: 138 SSVSQLSGASICVQAGTTTELTLADYFKAHNM-KYHPIVFERVEEIDAAYRAHRCDAYTG 196
           +++  L+G SICV AGTTTE  LAD  +   +  Y+P+V + V+ + AAY+  RC+A T 
Sbjct: 163 NTLKDLTGKSICVLAGTTTEQNLADQMRKEGVTDYNPVVSDDVDALYAAYQEGRCEAVTS 222

Query: 197 DISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGI 256
           D S L A +    +  +HVIL  ++SK PL P +  GD+ WY+ V W  +A++ AEE GI
Sbjct: 223 DRSQLVARRSIFPKKDDHVILDVVMSKEPLGPVVADGDSTWYDAVKWITFAVIQAEEFGI 282

Query: 257 TQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGN 316
           T +N+    + T +P+++RFLGID    +GE +GL  D+  RII+H+GNYGE+++RN+G 
Sbjct: 283 TSQNLATF-ESTEDPNIKRFLGID--DKLGEDMGLPNDFAARIIKHVGNYGEIYERNIGK 339

Query: 317 QSELKIPRGYNALWSKGGLMYAPPIR 342
              L + RG N LW+ GGL+Y+PP R
Sbjct: 340 --PLGLERGQNQLWTNGGLLYSPPFR 363


>gi|119510485|ref|ZP_01629618.1| extracellular solute-binding protein, family 3 [Nodularia spumigena
           CCY9414]
 gi|119464907|gb|EAW45811.1| extracellular solute-binding protein, family 3 [Nodularia spumigena
           CCY9414]
          Length = 358

 Score =  308 bits (789), Expect = 9e-82,   Method: Compositional matrix adjust.
 Identities = 148/313 (47%), Positives = 218/313 (69%), Gaps = 3/313 (0%)

Query: 30  IKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERF 89
           IK RG L CG++  + GF+ V+ +G + G DVD CRA+++A+FD+P  +++  L+A+ERF
Sbjct: 49  IKSRGQLICGVSGQIPGFSFVETDGKYSGIDVDICRAIAAALFDNPDAVEFRNLSAQERF 108

Query: 90  LALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASIC 149
            ALQ+ +ID+LSRNT WTL R  ++GL F P+ ++DGQ  ++ K +GI+S++ +   +IC
Sbjct: 109 TALQTGEIDVLSRNTSWTLSRATAMGLEFAPVVFYDGQAIMVGKNRGINSLADMKDKAIC 168

Query: 150 VQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTND 209
           VQ+GTTTE  LAD  +  N+ Y PIVFE V    A Y   RCD  T D SAL + ++T  
Sbjct: 169 VQSGTTTEQNLADQMRKRNITYKPIVFEDVNVTFATYAEGRCDGITADRSALVSRRITLP 228

Query: 210 RPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTT 269
            P  +VIL ++IS  PLAPA+ +GD+   + V+W  Y+++ AEELGI  +N+ Q +  + 
Sbjct: 229 NPENNVILDEVISSEPLAPAVAKGDSVLGSAVTWVVYSLIKAEELGINSQNLGQFAT-SN 287

Query: 270 NPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNAL 329
           +PD++RFLG +   N+GE LGLT D+  RI++H+GNYGE++DRNLG ++ L +PRG N L
Sbjct: 288 DPDIKRFLGTE--GNLGEGLGLTNDFAARIVKHVGNYGEIYDRNLGPKTNLNLPRGQNQL 345

Query: 330 WSKGGLMYAPPIR 342
             +GGL+YAPP R
Sbjct: 346 GQQGGLLYAPPFR 358


>gi|33592620|ref|NP_880264.1| putative extracellular solute-binding protein [Bordetella pertussis
           Tohama I]
 gi|33595874|ref|NP_883517.1| putative extracellular solute-binding protein [Bordetella
           parapertussis 12822]
 gi|33600404|ref|NP_887964.1| putative extracellular solute-binding protein [Bordetella
           bronchiseptica RB50]
 gi|33565953|emb|CAE36503.1| putative extracellular solute-binding protein [Bordetella
           parapertussis]
 gi|33568003|emb|CAE31916.1| putative extracellular solute-binding protein [Bordetella
           bronchiseptica RB50]
 gi|33572266|emb|CAE41818.1| putative extracellular solute-binding protein [Bordetella pertussis
           Tohama I]
          Length = 340

 Score =  308 bits (788), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 142/317 (44%), Positives = 213/317 (67%), Gaps = 4/317 (1%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           L  +KK+GF++CG+  G+ GF+   + G+W+G DVD CRA+++A+F D  K +   L+ +
Sbjct: 27  LDAVKKKGFVQCGLTDGVAGFSATNSKGEWEGMDVDICRAVAAAVFGDAGKFKGTALSTQ 86

Query: 87  ERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGA 146
           +RF ALQS ++D+L R    T  R+ SLGLA    +++DGQG ++ K  G+ S  +L  A
Sbjct: 87  QRFTALQSGEVDVLLRTVTLTQTRDTSLGLAAVAASFYDGQGVLVRKALGVKSAKELDEA 146

Query: 147 SICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKL 206
           +ICVQ GTTTEL LAD+F+A+ +K+ P+V ++V E+  A+ + RCDA+T D S L A++ 
Sbjct: 147 TICVQPGTTTELNLADWFRANGIKFTPVVIDKVTEVVRAFESGRCDAFTDDASQLAAVRA 206

Query: 207 TN-DRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVS 265
           T   +P +  ILP+  SK PL P + QGD  W  IV WT +A++ AEE GITQ+N++++ 
Sbjct: 207 TQVAKPDDFEILPERFSKEPLGPMVRQGDENWLGIVRWTLFALMEAEEYGITQQNVDEML 266

Query: 266 KDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRG 325
           K + NP+V R LG+  +   G+ +GL + W Y  I+ +GNY ++F+RN+G  S L + RG
Sbjct: 267 K-SKNPNVLRILGV--TPGAGKNMGLDEKWAYNAIKAVGNYSQIFERNVGKDSRLGLQRG 323

Query: 326 YNALWSKGGLMYAPPIR 342
            NALWS+GG MY  PIR
Sbjct: 324 VNALWSQGGAMYPWPIR 340


>gi|260426367|ref|ZP_05780346.1| glutamate/glutamine/aspartate/asparagine-binding protein
           bztAprecursor [Citreicella sp. SE45]
 gi|260420859|gb|EEX14110.1| glutamate/glutamine/aspartate/asparagine-binding protein
           bztAprecursor [Citreicella sp. SE45]
          Length = 339

 Score =  307 bits (787), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 145/317 (45%), Positives = 206/317 (64%), Gaps = 3/317 (0%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           L D+K RG L CG++TGL GF+   ANG W+GFDV  CRA+++A+  DP  ++++P   +
Sbjct: 25  LDDVKARGSLNCGVSTGLTGFSAPDANGVWQGFDVAVCRAVAAAVLGDPMAVEFVPTTGQ 84

Query: 87  ERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGA 146
            RF AL S +ID+L+RNT WT  R++ L   F  + Y+DGQGF++ K  G+SS  +L GA
Sbjct: 85  TRFTALASGEIDVLARNTTWTFSRDVDLKFEFIGVNYYDGQGFMVPKALGVSSAKELDGA 144

Query: 147 SICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKL 206
           ++C+Q GTTTEL LAD+F+ +N+ Y P+  E   E    Y A  CD YT D S L A + 
Sbjct: 145 TVCIQTGTTTELNLADFFRVNNISYEPVPIETNAEAQQQYLAGACDVYTTDASGLAATRA 204

Query: 207 TNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVS- 265
           + + P +HVILP+IISK PL P +  GD+EW +IV WT  A+V AEE G+T  NI ++S 
Sbjct: 205 SFEAPGDHVILPEIISKEPLGPLVRHGDSEWGDIVRWTLNALVAAEEYGVTSANIGELSA 264

Query: 266 KDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRG 325
               NP++ R LG +    +G   GL  DW  + I   GNYGE+F++ +G  + + + RG
Sbjct: 265 APGNNPEINRLLGTE--GELGAMFGLEADWAKKAIMANGNYGEIFEKTIGENTPIGLSRG 322

Query: 326 YNALWSKGGLMYAPPIR 342
            NA W++GGL+Y+PP R
Sbjct: 323 LNAQWTEGGLLYSPPFR 339


>gi|319940740|ref|ZP_08015081.1| extracellular solute-binding protein, family 3 [Sutterella
           wadsworthensis 3_1_45B]
 gi|319805800|gb|EFW02574.1| extracellular solute-binding protein, family 3 [Sutterella
           wadsworthensis 3_1_45B]
          Length = 340

 Score =  306 bits (784), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 142/319 (44%), Positives = 213/319 (66%), Gaps = 2/319 (0%)

Query: 24  ASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPL 83
            ++L  I+    L CG+NT   GF+   + G W+G DV+ CR++++A+  +  K++Y+PL
Sbjct: 24  GAVLDKIRANDQLVCGVNTSAPGFSSADSKGHWEGLDVNLCRSVAAAVLGNADKVKYVPL 83

Query: 84  NAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQL 143
           ++ +   AL S QID+L+RNT WT+ R+ S G  F  ++Y+DGQ F++ K  G+ S+ +L
Sbjct: 84  SSTQHMTALASGQIDMLARNTTWTMTRDASHGNVFVAVSYYDGQAFMVPKSLGVKSLKEL 143

Query: 144 SGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYA 203
            GA++CVQ GTTTE T ADYF++H M+Y  +VF+  E    A+ + RCDAYT D+S L  
Sbjct: 144 DGATVCVQTGTTTEKTTADYFRSHGMQYKTVVFDTTEATQGAFLSGRCDAYTSDMSDLAG 203

Query: 204 LKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQ 263
           ++     PS+  ILP+ I+K PL PA+ +GD E++ IV W+  A + AEELG+TQ N++ 
Sbjct: 204 VRTVAQDPSKFDILPETITKEPLGPAVRRGDWEFFEIVRWSFMAFLNAEELGVTQANVDD 263

Query: 264 VSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIP 323
           + K + +P+V R +G  +  ++G  LGL KDW+YRII+ +GNYGE + +  G  S L +P
Sbjct: 264 MRKTSKDPNVMRLVGTGE--DMGRMLGLDKDWSYRIIKQVGNYGESWTKYFGPTSPLNLP 321

Query: 324 RGYNALWSKGGLMYAPPIR 342
           RG N LW+ GGLMYA PIR
Sbjct: 322 RGMNKLWTDGGLMYAMPIR 340


>gi|126731935|ref|ZP_01747738.1| ABC transporter amino acid-binding protein [Sagittula stellata
           E-37]
 gi|126707467|gb|EBA06530.1| ABC transporter amino acid-binding protein [Sagittula stellata
           E-37]
          Length = 337

 Score =  306 bits (783), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 146/316 (46%), Positives = 208/316 (65%), Gaps = 2/316 (0%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           L D+K  G LKCG++ GL GF+     G+W G DVD+CRAL++A+  D   ++Y+ L+AK
Sbjct: 24  LDDVKAAGSLKCGVSQGLPGFSATNDAGEWTGIDVDYCRALAAAVLGDADAVEYVSLSAK 83

Query: 87  ERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGA 146
           +RF AL S +ID+LSRNT WT+ R+  LG+ F  + Y+DGQG ++    GI+S  +L GA
Sbjct: 84  DRFTALSSGEIDVLSRNTTWTITRDTDLGITFVGVNYYDGQGMMVPAGLGITSALELDGA 143

Query: 147 SICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKL 206
           +IC   GTTTEL + DYF  H+M +  +  E  +E+ AAY A RCD +T D S + A +L
Sbjct: 144 TICTNTGTTTELNITDYFTQHDMSFELVALENSDEVIAAYGAGRCDVFTTDRSGVAAERL 203

Query: 207 TNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSK 266
               P  HV+LP+ ISK PL P++  GD +W  +  W    ++ AEE GIT +N++++  
Sbjct: 204 KLADPDAHVVLPETISKEPLGPSVRAGDEQWMKVAKWVLNGVIEAEEYGITSENVDEM-L 262

Query: 267 DTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGY 326
           ++ NP VQR LG    ++ G  LGL  D+ Y+ ++ +GNYGEM+DRN+G  + LK+ RG 
Sbjct: 263 ESENPSVQRILGA-GDNDYGAPLGLGADFVYQAVKQVGNYGEMYDRNVGPDTPLKLERGV 321

Query: 327 NALWSKGGLMYAPPIR 342
           N LW+KGG MYAPPIR
Sbjct: 322 NNLWNKGGFMYAPPIR 337


>gi|218437710|ref|YP_002376039.1| extracellular solute-binding protein family 3 [Cyanothece sp. PCC
           7424]
 gi|218170438|gb|ACK69171.1| extracellular solute-binding protein family 3 [Cyanothece sp. PCC
           7424]
          Length = 362

 Score =  306 bits (783), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 143/326 (43%), Positives = 213/326 (65%), Gaps = 6/326 (1%)

Query: 18  TSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSK 77
           TS S   S L  +K RG + CGIN  + GF+ V   G + G DVD CRA+++A+FDDP+K
Sbjct: 42  TSTSGGTSRLDTVKARGTVICGINGEVPGFSFVDEQGQYSGLDVDMCRAVAAALFDDPTK 101

Query: 78  IQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGI 137
           +++  L A +RF A+QS ++DIL+RNT WT+ R+ S+G+ F P T++DGQG ++ K  GI
Sbjct: 102 VEFRKLTADQRFTAVQSGEVDILNRNTTWTISRDTSVGMDFAPTTFYDGQGIMVTKASGI 161

Query: 138 SSVSQLSGASICVQAGTTTELTLADYFKAHNMK-YHPIVFERVEEIDAAYRAHRCDAYTG 196
           + +  L G S+CV +GTTTE  LAD  +   ++ Y PI  + V+++ AAY+  RC+  T 
Sbjct: 162 TKLEDLKGKSVCVLSGTTTEQNLADQMRKRGIEDYTPIASDDVDQLYAAYQEGRCEGVTS 221

Query: 197 DISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGI 256
           D S L A +    +P +HV+L  ++SK PL P +  GD++W + + W  YA + AEELGI
Sbjct: 222 DRSQLVARRSVLPKPEDHVVLDVVLSKEPLGPVVADGDSQWSDTIKWITYATIEAEELGI 281

Query: 257 TQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGN 316
             +NI +  K + +P+V+RFLG      +GE +GL  D+  R+I+H+GNY E++DRN+G 
Sbjct: 282 NSQNIGEFEK-SEDPNVKRFLG--SEGTLGEDMGLNNDFATRVIKHVGNYEEIYDRNIGK 338

Query: 317 QSELKIPRGYNALWSKGGLMYAPPIR 342
              L + RG N LW+ GGL+Y+PP R
Sbjct: 339 --PLGLERGPNQLWTNGGLLYSPPFR 362


>gi|296535903|ref|ZP_06898057.1| amino-acid ABC superfamily ATP binding cassette transporter,
           substrate-binding protein [Roseomonas cervicalis ATCC
           49957]
 gi|296263760|gb|EFH10231.1| amino-acid ABC superfamily ATP binding cassette transporter,
           substrate-binding protein [Roseomonas cervicalis ATCC
           49957]
          Length = 325

 Score =  305 bits (782), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 144/316 (45%), Positives = 212/316 (67%), Gaps = 4/316 (1%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           L  ++ +  L C  N G  GF    + G+ +G D D CRA+++A+    ++I++  L + 
Sbjct: 14  LAAVRAKALLDCSANQGSPGFGVPDSRGEQQGLDPDICRAVAAAVLGPNARIRWTVLTSA 73

Query: 87  ERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGA 146
            R  ALQS Q+DI++R   WT  RE++ GL F    ++DGQGFI+ K  G++  +QL GA
Sbjct: 74  TRVTALQSGQVDIVARTFTWTHAREVNAGLQFASPVFYDGQGFIVPKASGVTRAAQLDGA 133

Query: 147 SICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKL 206
           SICV AG+T EL LAD+ +++ ++ +P+VFE  E+   AY + RCDAYT D S L     
Sbjct: 134 SICVTAGSTNELNLADWARSNGLRVNPVVFEGNEDTRKAYTSGRCDAYTLDASQLAGFAT 193

Query: 207 TNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSK 266
           T  R  EHVIL DIISK PL+PA+ +GD +WY+IV WT +A++ AEE GITQ N++ +  
Sbjct: 194 TLPR-GEHVILSDIISKEPLSPAVRKGDAQWYDIVRWTIFALILAEEHGITQANVDSM-L 251

Query: 267 DTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGY 326
           ++ NP+V+R LG+  + + G A+GL + W Y  I+ +GNYGE+F+R+LG +S L + RG 
Sbjct: 252 ESQNPEVRRLLGV--AGDHGPAMGLDRRWAYNAIKAVGNYGEIFERHLGAESPLGLERGL 309

Query: 327 NALWSKGGLMYAPPIR 342
           NALW++GGL+YAPP+R
Sbjct: 310 NALWNRGGLLYAPPMR 325


>gi|254707031|ref|ZP_05168859.1| lysine-arginine-ornithine-binding periplasmic protein [Brucella
           pinnipedialis M163/99/10]
          Length = 251

 Score =  305 bits (781), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 141/252 (55%), Positives = 188/252 (74%), Gaps = 3/252 (1%)

Query: 93  QSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKK--GISSVSQLSGASICV 150
           QS ++D+L RNT WT+ R+ SLGL F  I Y+DGQGF+++ KK  GI+S  QLSGASICV
Sbjct: 1   QSGEVDVLIRNTTWTISRDTSLGLDFAGINYYDGQGFMINSKKLAGINSALQLSGASICV 60

Query: 151 QAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTNDR 210
           QAGTTTEL +ADYF+A+ M+Y+P+VFE++EE +AAY + RCDAYT D S+LY ++L    
Sbjct: 61  QAGTTTELNMADYFRANKMEYNPVVFEKIEEANAAYDSGRCDAYTTDQSSLYGVRLALAN 120

Query: 211 PSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTTN 270
           P +HVILP+IISK P    + QGD  W ++V WTH A++ AEE GITQ N+ ++ K + N
Sbjct: 121 PDDHVILPEIISKEPFGLTVRQGDARWADVVRWTHNALLNAEEYGITQANVEEMKK-SDN 179

Query: 271 PDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNALW 330
           PD++R LG +  + IG  LGL KDW  +II+ +GNYGE+F+RN+G+ S LKI RG NA W
Sbjct: 180 PDIKRLLGAEADTKIGTDLGLDKDWVVKIIKGVGNYGEIFERNIGSGSPLKIARGLNAQW 239

Query: 331 SKGGLMYAPPIR 342
           +KGGL Y  P+R
Sbjct: 240 NKGGLQYGIPVR 251


>gi|114766874|ref|ZP_01445796.1| glutamate/glutamine/aspartate/asparagine ABC transporter,
           periplasmic substrate-binding protein [Pelagibaca
           bermudensis HTCC2601]
 gi|114540920|gb|EAU43980.1| glutamate/glutamine/aspartate/asparagine ABC transporter,
           periplasmic substrate-binding protein [Roseovarius sp.
           HTCC2601]
          Length = 339

 Score =  303 bits (776), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 144/317 (45%), Positives = 205/317 (64%), Gaps = 3/317 (0%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           L D+K RG L CG++TGL GF+   ANG W+GFDV  CRA+++A+  DP  ++++    +
Sbjct: 25  LDDVKARGNLNCGVSTGLTGFSAPDANGVWQGFDVAVCRAVAAAVLGDPMAVEFVSTTGQ 84

Query: 87  ERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGA 146
            RF AL S +ID+L+RNT WT  R+  L   F  + Y+DGQGF++ K+ G+SS  +L GA
Sbjct: 85  TRFTALASGEIDMLARNTTWTFSRDNDLKFEFVGVNYYDGQGFMIPKELGVSSAKELDGA 144

Query: 147 SICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKL 206
           ++C+Q GTTTEL LAD+F+ +N+ Y P+  E   E    Y A  CD YT D S L A + 
Sbjct: 145 TVCIQTGTTTELNLADFFRVNNINYEPVPIETNAEAQQQYLAGACDVYTTDASGLAATRA 204

Query: 207 TNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSK 266
           + + P +HVILP+IISK PL P +  GD EW +I  WT  A++ AEE G+T  NI ++S 
Sbjct: 205 SFETPGDHVILPEIISKEPLGPLVRHGDNEWGDIARWTLNALIAAEEYGVTSANIEELSS 264

Query: 267 -DTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRG 325
             T NP++ R LG +    +G  +GL  DW  + I   GNYGE+F++ +G  + + + RG
Sbjct: 265 APTDNPEINRLLGTE--GELGAMIGLEADWAKKAIMANGNYGEIFEKTIGENTPIGLSRG 322

Query: 326 YNALWSKGGLMYAPPIR 342
            NA W++GGLMY+PP R
Sbjct: 323 LNAQWTEGGLMYSPPFR 339


>gi|86605966|ref|YP_474729.1| polar amino acid ABC transporter amino acid-binding protein
           [Synechococcus sp. JA-3-3Ab]
 gi|86608412|ref|YP_477174.1| polar amino acid ABC transporter periplasmic amino acid-binding
           protein [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|86554508|gb|ABC99466.1| polar amino amino acid ABC transporter (PAAT) family, amino
           acid-binding protein [Synechococcus sp. JA-3-3Ab]
 gi|86556954|gb|ABD01911.1| polar amino amino acid ABC transporter (PAAT) family, periplasmic
           amino acid-binding protein [Synechococcus sp.
           JA-2-3B'a(2-13)]
          Length = 345

 Score =  303 bits (776), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 145/313 (46%), Positives = 208/313 (66%), Gaps = 6/313 (1%)

Query: 30  IKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERF 89
           IK RG L CG+N  L GF  +   G + GFD+D CRA+++A+F DP K++Y+ L A  R 
Sbjct: 39  IKARGELICGVNNQLPGFGNLDDQGKYVGFDIDICRAVAAALFGDPDKVRYVYLTAANRQ 98

Query: 90  LALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASIC 149
            A+QS ++D++SRNT WTL R+    + F P TY+DGQGF++ K  G+  +  L+GA+IC
Sbjct: 99  SAIQSGEVDMISRNTTWTLTRDREWAVTFGPTTYYDGQGFMVRKSLGVEKLEDLNGATIC 158

Query: 150 VQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTND 209
           V AGTTTEL LAD F+A  + + P+ F+  +    AY   RCDA T D SAL + + +  
Sbjct: 159 VIAGTTTELNLADTFRARGIAFTPVTFDGDDSSFNAYEEGRCDAITSDQSALISRRASLA 218

Query: 210 RPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTT 269
            P +HVILP++ISK PL P +  GD  + +I++WT YA+  AEE GIT  N+++  K + 
Sbjct: 219 SPDDHVILPEVISKEPLGPLVPHGDESFSDIMNWTVYALFYAEEKGITSANVDEFLK-SE 277

Query: 270 NPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNAL 329
           +PD++RFLG  +  N+GE LGL  DW   +I+ +GNYGE+F+R+L   + L +PRG N  
Sbjct: 278 DPDIRRFLG--QEGNLGELLGLKPDWVVNVIKAVGNYGEIFNRHL---TPLGVPRGLNQP 332

Query: 330 WSKGGLMYAPPIR 342
           ++KGG+ YAPP R
Sbjct: 333 YTKGGIQYAPPFR 345


>gi|296536952|ref|ZP_06898974.1| amino acid ABC superfamily ATP binding cassette transporter,
           binding protein [Roseomonas cervicalis ATCC 49957]
 gi|296262721|gb|EFH09324.1| amino acid ABC superfamily ATP binding cassette transporter,
           binding protein [Roseomonas cervicalis ATCC 49957]
          Length = 338

 Score =  303 bits (775), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 135/322 (41%), Positives = 214/322 (66%), Gaps = 7/322 (2%)

Query: 22  TNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYL 81
           + +  L  ++ RG L CG++    GFA   + G+ +G + DFCRA+++A   D  +++++
Sbjct: 23  SGSPTLDAVRARGQLACGVSGTNPGFALADSRGEMRGSEADFCRAVAAATLGDAGRVKFV 82

Query: 82  PLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVS 141
            L +  RF ALQS +ID+L R   W+L RE SLGL F  IT+ DG  F++H   G+ S +
Sbjct: 83  VLTSTNRFTALQSGEIDLLVRTATWSLGREASLGLLFAGITFHDGTAFMVHAASGVRSAA 142

Query: 142 QLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISAL 201
           +L GA+IC+  GTTTEL + DYF+   M++ P++ + V E+ AA+R+ RCD+Y+ D SAL
Sbjct: 143 ELDGATICILPGTTTELAVTDYFRRGGMRFTPVLIDNVTELRAAFRSGRCDSYSSDASAL 202

Query: 202 YALKLTNDRPS-EHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKN 260
            + +      + ++ +LP++ISK PL P + +GD +W++IV WTH+AM+ AEELGI   +
Sbjct: 203 ASFRFGEGAGAGQYALLPEVISKEPLGPLVRKGDDKWFDIVRWTHFAMLAAEELGIRGAD 262

Query: 261 INQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSEL 320
             + +  + NPD++R LG+D   ++G A+GL   W + I+R +GNY E++DRN+   + L
Sbjct: 263 A-EAALASPNPDIRRLLGVD--GDLGRAMGLDNRWAFNILRQVGNYAEVWDRNI---APL 316

Query: 321 KIPRGYNALWSKGGLMYAPPIR 342
            +PRG+N +W++GGL YAPPIR
Sbjct: 317 GVPRGHNRIWTQGGLQYAPPIR 338


>gi|254466846|ref|ZP_05080257.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Rhodobacterales bacterium Y4I]
 gi|206687754|gb|EDZ48236.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Rhodobacterales bacterium Y4I]
          Length = 337

 Score =  301 bits (772), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 139/322 (43%), Positives = 208/322 (64%), Gaps = 4/322 (1%)

Query: 21  STNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQY 80
           S +A  L D++  G L CG++ G+ GF+   + G W G D D CRA+++A   D + +++
Sbjct: 20  SAHAGKLEDVRAAGELACGVSEGVPGFSNPNSEGVWTGLDADICRAVAAATLGDANAVRF 79

Query: 81  LPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSV 140
           +PL +K++ LA+ S Q+D+ SR T WT+ R+ + G+ F  + Y+DGQGF++    G++S 
Sbjct: 80  VPLASKQKVLAVSSGQVDMTSRTTTWTMKRDSAEGVDFTSVVYYDGQGFMVRADAGVTSA 139

Query: 141 SQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISA 200
            +L  A++C+  GTTTEL +AD+ +A+ +   P+VFE   E   AY + RCDA T D S 
Sbjct: 140 KELDAATVCLTTGTTTELNMADFARANGLTLEPVVFEGKREAVEAYASGRCDALTTDASQ 199

Query: 201 LYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKN 260
           L A +     PS+H ILP+IISK PLAP +  GD +W ++V+W  Y ++TAEELG+TQ N
Sbjct: 200 LAAFRAGFANPSDHKILPEIISKEPLAPFVAHGDNQWKDVVTWVVYGLITAEELGVTQAN 259

Query: 261 INQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSEL 320
           +  ++  + NPDVQR LG   S + G  LGL+  W    I  +GNYGE+++RNL   + L
Sbjct: 260 VADMAASSANPDVQRLLG--ASGDTGGLLGLSNTWMADAISAIGNYGEIYERNL--TATL 315

Query: 321 KIPRGYNALWSKGGLMYAPPIR 342
            + RG NALWS GG++YA P+R
Sbjct: 316 GLERGVNALWSDGGILYAMPVR 337


>gi|67922406|ref|ZP_00515917.1| extracellular solute-binding protein, family 3 [Crocosphaera
           watsonii WH 8501]
 gi|67855750|gb|EAM50998.1| extracellular solute-binding protein, family 3 [Crocosphaera
           watsonii WH 8501]
          Length = 350

 Score =  301 bits (771), Expect = 9e-80,   Method: Compositional matrix adjust.
 Identities = 143/352 (40%), Positives = 226/352 (64%), Gaps = 17/352 (4%)

Query: 3   KDFFVSILCLIILFFTSFS-----------TNASILGDIKKRGFLKCGINTGLVGFAEVK 51
           K +F+ I  L+ +  T+             T++S L  IK+RG L CG+N  + GF+ V 
Sbjct: 4   KPYFILIALLLTMPLTACGGGSQTSDNPTPTSSSRLDTIKQRGTLICGVNGEVPGFSFVD 63

Query: 52  ANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLRE 111
            NG + G DVD CRA+++A+FDDP K++Y  L+A+ERF A+QS ++D+L+RNT WT+ R+
Sbjct: 64  ENGQYSGLDVDVCRAIAAALFDDPEKVEYRKLSAQERFPAVQSGEVDVLNRNTTWTISRD 123

Query: 112 ISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNM-K 170
            + G+ F P  ++DGQG ++    G++ +  L+G SICV AGTTTE  LAD  +   +  
Sbjct: 124 TTNGMEFAPTIFYDGQGIMVTTASGVTDIQGLAGKSICVLAGTTTEQNLADQMRKKGITD 183

Query: 171 YHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAI 230
           Y+P+ F+ V+ + AAY+  RC+  T D S L A +      ++H IL  ++SK PL PA+
Sbjct: 184 YNPVTFDDVDALYAAYQQGRCEGVTADRSQLVARRSILPNSNDHNILNVVLSKEPLGPAV 243

Query: 231 IQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALG 290
              D++W++ V W  ++++ AEE GI  +N+    K + +P+++RFLG+D    +GE +G
Sbjct: 244 KNNDSDWFDAVKWITFSLIQAEEFGINSENLATFEK-SEDPNIRRFLGLDDK--LGEGIG 300

Query: 291 LTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           L  D+  R+++H+GNYGE++DRN+G    L + RG N LW++GGL+Y+PP R
Sbjct: 301 LPNDFASRVVKHVGNYGEVYDRNIG--KPLGLERGPNQLWTEGGLLYSPPFR 350


>gi|126659578|ref|ZP_01730709.1| extracellular solute-binding protein, family 3 [Cyanothece sp.
           CCY0110]
 gi|126619121|gb|EAZ89859.1| extracellular solute-binding protein, family 3 [Cyanothece sp.
           CCY0110]
          Length = 334

 Score =  301 bits (771), Expect = 9e-80,   Method: Compositional matrix adjust.
 Identities = 143/328 (43%), Positives = 219/328 (66%), Gaps = 8/328 (2%)

Query: 18  TSFSTNASI--LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDP 75
           TS  T AS   L  IK+RG L CG+N  + GF+ V  NG + G DVD CRA+++A+FDDP
Sbjct: 12  TSDPTTASTSRLDTIKQRGTLICGVNGEVPGFSFVDENGQYSGLDVDICRAIAAALFDDP 71

Query: 76  SKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKK 135
            K++Y  L+A+ERF A+QS ++D+L+RNT WT+ R+ + G+ F P  ++DGQG ++    
Sbjct: 72  EKVEYRKLSAQERFPAVQSGEVDVLNRNTTWTISRDTTNGMEFAPTVFYDGQGIMVTTAS 131

Query: 136 GISSVSQLSGASICVQAGTTTELTLADYFKAHNMK-YHPIVFERVEEIDAAYRAHRCDAY 194
           G++++  L+G SICV AGTTTE  LAD  +   ++ Y+P+ FE V+ + AAY+  RC+  
Sbjct: 132 GVANMEGLAGKSICVLAGTTTEQNLADQMRKRGIEDYNPVTFEDVDALYAAYQEGRCEGV 191

Query: 195 TGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEEL 254
           T D S L A +      ++H IL  ++SK PL PA+   D+ W++ V W  ++++ AEEL
Sbjct: 192 TADRSQLVARRSILPNRNDHAILNVVLSKEPLGPAVKNNDSAWFDAVKWITFSLIQAEEL 251

Query: 255 GITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNL 314
           GI  +NI +  + + +P+V+RFLG+D    +GE +GL  D+  R ++H+GNYGE+++RN+
Sbjct: 252 GINSENI-ETFETSEDPNVRRFLGLDDK--LGEGMGLPNDFAARAVKHVGNYGEVYERNI 308

Query: 315 GNQSELKIPRGYNALWSKGGLMYAPPIR 342
           G    L + RG N LW++GGL+Y+PP R
Sbjct: 309 G--EPLGLDRGQNNLWTEGGLLYSPPFR 334


>gi|254417720|ref|ZP_05031444.1| hypothetical protein BBAL3_30 [Brevundimonas sp. BAL3]
 gi|196183897|gb|EDX78873.1| hypothetical protein BBAL3_30 [Brevundimonas sp. BAL3]
          Length = 356

 Score =  300 bits (769), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 138/315 (43%), Positives = 199/315 (63%), Gaps = 4/315 (1%)

Query: 30  IKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERF 89
           +K+RG L CG++ GLVGFA     G W+GFD DFCRA+++AIF D + ++++PL+A +RF
Sbjct: 44  VKRRGRLNCGVHQGLVGFAYTDNRGQWRGFDADFCRAMAAAIFGDGNAVRFVPLSASDRF 103

Query: 90  LALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASIC 149
            AL+  ++D+L RN+ WT+ R+   G  F  I Y+DGQGF++ +   ++S ++L+GA IC
Sbjct: 104 AALKEGRVDVLWRNSSWTMSRDAGEGFVFAGINYYDGQGFLVRRSLSLASATELNGARIC 163

Query: 150 VQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTND 209
           VQAG+T +    D+F++  + Y P+V    E    AY    CDA + DISAL A +    
Sbjct: 164 VQAGSTAQANADDFFRSRGIAYRPVVLPSEEAARDAYGREDCDALSADISALAAARTVLA 223

Query: 210 RPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTT 269
               H IL D++SK PL P +  GD  W ++V WT  A+V AEE G+TQ+N   +SK + 
Sbjct: 224 DSQAHTILSDVVSKEPLGPVVRAGDERWADVVRWTLNAVVLAEEFGVTQENAEALSKTSN 283

Query: 270 NPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNAL 329
           +P ++R LG       G  LGL+ DW    I  +GNYG++FDRNLG+QS L + RG NA 
Sbjct: 284 DPRIKRLLG--SEGEYGALLGLSDDWAKDAILSVGNYGQIFDRNLGSQSPLDLARGLNAQ 341

Query: 330 WSK--GGLMYAPPIR 342
           W+    GL+Y  PIR
Sbjct: 342 WNARPAGLIYGLPIR 356


>gi|261314499|ref|ZP_05953696.1| cationic amino acid ABC transporter [Brucella pinnipedialis
           M163/99/10]
 gi|261303525|gb|EEY07022.1| cationic amino acid ABC transporter [Brucella pinnipedialis
           M163/99/10]
          Length = 247

 Score =  300 bits (769), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 139/248 (56%), Positives = 185/248 (74%), Gaps = 3/248 (1%)

Query: 97  IDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKK--GISSVSQLSGASICVQAGT 154
           +D+L RNT WT+ R+ SLGL F  I Y+DGQGF+++ KK  GI+S  QLSGASICVQAGT
Sbjct: 1   MDVLIRNTTWTISRDTSLGLDFAGINYYDGQGFMINSKKLAGINSALQLSGASICVQAGT 60

Query: 155 TTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEH 214
           TTEL +ADYF+A+ M+Y+P+VFE++EE +AAY + RCDAYT D S+LY ++L    P +H
Sbjct: 61  TTELNMADYFRANKMEYNPVVFEKIEEANAAYDSGRCDAYTTDQSSLYGVRLALANPDDH 120

Query: 215 VILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQ 274
           VILP+IISK P    + QGD  W ++V WTH A++ AEE GITQ N+ ++ K + NPD++
Sbjct: 121 VILPEIISKEPFGLTVRQGDARWADVVRWTHNALLNAEEYGITQANVEEMKK-SDNPDIK 179

Query: 275 RFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGG 334
           R LG +  + IG  LGL KDW  +II+ +GNYGE+F+RN+G+ S LKI RG NA W+KGG
Sbjct: 180 RLLGAEADTKIGTDLGLDKDWVVKIIKGVGNYGEIFERNIGSGSPLKIARGLNAQWNKGG 239

Query: 335 LMYAPPIR 342
           L Y  P+R
Sbjct: 240 LQYGIPVR 247


>gi|56697221|ref|YP_167586.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Ruegeria pomeroyi DSS-3]
 gi|56678958|gb|AAV95624.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Ruegeria pomeroyi DSS-3]
          Length = 337

 Score =  300 bits (768), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 138/316 (43%), Positives = 206/316 (65%), Gaps = 4/316 (1%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           L D++  G L CG++ G+ GF+   + G W G D D CRA+++A   D + ++++PL +K
Sbjct: 26  LDDVRAAGELACGVSEGVPGFSNPNSEGVWTGLDADICRAVAAATLGDANAVRFVPLASK 85

Query: 87  ERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGA 146
           ++ LA+ S Q+D+ SR T WT+ R+ + G+ F  + Y+DGQGF++    G++S  +L  A
Sbjct: 86  QKVLAVSSGQVDMTSRTTTWTMKRDSAEGVDFTSVVYYDGQGFMVRADAGVTSARELDAA 145

Query: 147 SICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKL 206
           ++C+  GTTTEL +AD+ +A+ +   P+VFE   E   AY + RCDA T D S L A + 
Sbjct: 146 TVCLTTGTTTELNMADFARANGLTLEPVVFEGKREAVEAYASGRCDALTTDASQLAAFRA 205

Query: 207 TNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSK 266
               PSEH ILP+IISK PLAP +  GD +W +IV+W  Y ++TAEELG+TQ N+ +++ 
Sbjct: 206 GFADPSEHKILPEIISKEPLAPFVAHGDNQWKDIVTWVVYGLITAEELGVTQANVAEMTA 265

Query: 267 DTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGY 326
            +TNP++QR LG   S + G  LGL   W    I  +GNYGE++DRNL   + L + RG 
Sbjct: 266 SSTNPNIQRLLG--TSGDTGGFLGLNSTWMVDTISAVGNYGEIYDRNL--TATLGLERGV 321

Query: 327 NALWSKGGLMYAPPIR 342
           NALW+ GG++YA P+R
Sbjct: 322 NALWTDGGILYAMPVR 337


>gi|307152419|ref|YP_003887803.1| extracellular solute-binding protein family 3 [Cyanothece sp. PCC
           7822]
 gi|306982647|gb|ADN14528.1| extracellular solute-binding protein family 3 [Cyanothece sp. PCC
           7822]
          Length = 356

 Score =  300 bits (767), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 140/319 (43%), Positives = 213/319 (66%), Gaps = 6/319 (1%)

Query: 25  SILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLN 84
           S L  IK RG L CG+N  + GF+ V   G ++G DVD CRA+++A+FDDP+K+++  L 
Sbjct: 43  SRLDTIKARGTLICGVNGEVPGFSFVDEKGQFEGLDVDMCRAVAAALFDDPNKVEFRKLT 102

Query: 85  AKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLS 144
           A++RF A+QS ++DIL+RNT WTL R+ S G+ F P T++DGQG ++ K  GI+ +  L 
Sbjct: 103 AEQRFTAVQSGEVDILNRNTTWTLSRDTSTGMEFGPTTFYDGQGMMVTKASGITKLEDLK 162

Query: 145 GASICVQAGTTTELTLADYFKAHNM-KYHPIVFERVEEIDAAYRAHRCDAYTGDISALYA 203
           G SICV +GTTTE  LAD  +   +  Y P+  + V+++ AAY+  RC+  T D S L A
Sbjct: 163 GKSICVLSGTTTEQNLADQMRKRGVTAYTPVASDDVDQLYAAYQEGRCEGITSDRSQLVA 222

Query: 204 LKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQ 263
            +    +P +H++L  ++SK PL   +  GD++W++ V W  YA++  EELGI  KNI  
Sbjct: 223 RRSVLPKPQDHIVLDVVMSKEPLGTLVADGDSKWFDTVKWITYAVIEGEELGINSKNIAN 282

Query: 264 VSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIP 323
             K + +P+V+RFLG++ +  +G+ +GL  D+  R+I+H+GNYGE+++RN+G    L + 
Sbjct: 283 FDK-SQDPNVRRFLGLEGT--LGQDMGLPNDFAARVIKHVGNYGEIYERNIG--KPLGLE 337

Query: 324 RGYNALWSKGGLMYAPPIR 342
           RG N LW+ GGL+Y+PP R
Sbjct: 338 RGPNRLWTNGGLLYSPPFR 356


>gi|313680184|ref|YP_004057923.1| amino acid ABC transporter substrate-binding protein, paat family
           [Oceanithermus profundus DSM 14977]
 gi|313152899|gb|ADR36750.1| amino acid ABC transporter substrate-binding protein, PAAT family
           [Oceanithermus profundus DSM 14977]
          Length = 339

 Score =  300 bits (767), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 146/316 (46%), Positives = 210/316 (66%), Gaps = 6/316 (1%)

Query: 30  IKKRGFLKCGINTGLVGFAEV-KANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKER 88
           +K+RG L CG+N G  GF  + +  GD+ GFDVDFCRA+++AIFDDP+K+ ++PLNAK R
Sbjct: 27  VKQRGKLICGVNGGAPGFGFIDEKTGDYVGFDVDFCRAVAAAIFDDPTKVDFVPLNAKVR 86

Query: 89  FLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASI 148
           F A+Q+ ++D++ RNT  T  R+  LG+ F P+ ++DGQG ++ K  G+ SV  L GA++
Sbjct: 87  FNAIQTGKVDVVFRNTTVTTSRDSQLGVDFLPVNFYDGQGVMVKKSLGVKSVYDLKGATV 146

Query: 149 CVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTN 208
           C  AGTTTE    D  +AHN+    + F+   +  A   + RCDA T D S L   K  +
Sbjct: 147 CTNAGTTTEKNWTDVDRAHNLGTKLLTFDDFSKSMAGLESGRCDAVTTDKSGLVGWKAKS 206

Query: 209 DRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDT 268
             P   VILP+ +SK PLA    Q D++W + ++W  YA + AEE GITQ N++Q+ K +
Sbjct: 207 KDPESLVILPETLSKEPLAGFTFQNDSKWRDALTWIVYATMQAEEFGITQANLDQMLK-S 265

Query: 269 TNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPR--GY 326
           +NP ++RFLG++  S +GE LGLT D+  R+IRH+GNYGE++ R+LG  S   IPR    
Sbjct: 266 SNPGIRRFLGVE--SKLGEGLGLTNDFAARVIRHVGNYGEIYARHLGPDSPFFIPREGSL 323

Query: 327 NALWSKGGLMYAPPIR 342
           NAL++ GGL+Y+PP R
Sbjct: 324 NALYTDGGLIYSPPFR 339


>gi|172037183|ref|YP_001803684.1| extracellular solute-binding protein [Cyanothece sp. ATCC 51142]
 gi|171698637|gb|ACB51618.1| extracellular solute-binding protein, family 3 [Cyanothece sp. ATCC
           51142]
          Length = 349

 Score =  300 bits (767), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 139/323 (43%), Positives = 215/323 (66%), Gaps = 6/323 (1%)

Query: 21  STNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQY 80
           +   S L  IK+RG L CG+N  + GF+ V  NG + G DVD CRA+++A+FDDP K++Y
Sbjct: 32  TATTSRLDTIKQRGTLICGVNGEVPGFSFVDENGQYSGLDVDICRAIAAALFDDPEKVEY 91

Query: 81  LPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSV 140
             L+A+ERF A+QS ++D+L+RNT WT+ R+ + G+ F P  ++DGQG ++    G++ +
Sbjct: 92  RKLSAQERFPAVQSGEVDVLNRNTTWTISRDTTNGMEFAPTVFYDGQGIMVTTASGVADM 151

Query: 141 SQLSGASICVQAGTTTELTLADYFKAHNMK-YHPIVFERVEEIDAAYRAHRCDAYTGDIS 199
             L+G SICV AGTTTE  LAD  +   ++ Y+P+ FE V+ + AAY+  RC+  T D S
Sbjct: 152 EGLAGKSICVLAGTTTEQNLADQMRKRGIEDYNPVTFEDVDALYAAYQEGRCEGVTADRS 211

Query: 200 ALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQK 259
            L A +      ++H IL  ++SK PL PA+   D+ W++ V W  ++++ AEELGI  +
Sbjct: 212 QLVARRSILPNRNDHAILNVVLSKEPLGPAVKNNDSAWFDAVKWITFSLIQAEELGINSQ 271

Query: 260 NINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSE 319
           NI    + + +P+V+RFLG+D    +GE +GL  D+  R+++H+GNYGE+++RN+G    
Sbjct: 272 NI-ATFETSEDPNVRRFLGLD--DKLGEGMGLPNDFAARVVKHVGNYGEVYERNIG--EP 326

Query: 320 LKIPRGYNALWSKGGLMYAPPIR 342
           L + RG N LW++GGL+Y+PP R
Sbjct: 327 LGLDRGPNNLWTEGGLLYSPPFR 349


>gi|317405314|gb|EFV85638.1| amino acid-binding periplasmic protein [Achromobacter xylosoxidans
           C54]
          Length = 341

 Score =  299 bits (766), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 141/314 (44%), Positives = 202/314 (64%), Gaps = 4/314 (1%)

Query: 30  IKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERF 89
           IKKRG L CG++ G  G +     G W G D D CRAL++A+  DP K +++PL++++RF
Sbjct: 31  IKKRGELVCGVSQGSAGLSIADKQGRWTGLDADLCRALAAAVLGDPEKTRFVPLSSQQRF 90

Query: 90  LALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASIC 149
            ALQ  +ID+L+RNT  T  R+  LG+    I ++DGQGF++ KK G+ S ++L GA +C
Sbjct: 91  PALQGGEIDVLNRNTTITSSRDAGLGIVSAGIVFYDGQGFLVPKKLGVKSATELDGAQVC 150

Query: 150 VQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISAL-YALKLTN 208
           VQ GT  E  L DYFK H + Y P+V E + E++ A+ A RCD Y  D S L  +     
Sbjct: 151 VQPGTVNEQNLVDYFKKHKLNYRPVVIENLVELEQAFYAGRCDVYLSDASTLAASRAARA 210

Query: 209 DRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDT 268
             P + VILP+ I+KSPL P + Q D  W  IV WT  A+V AEELGIT +N++  ++ +
Sbjct: 211 ANPDDFVILPERINKSPLGPFVRQDDPNWTAIVRWTVNALVAAEELGITSRNVDSQAQ-S 269

Query: 269 TNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNA 328
           ++  V+R LG+D    IG+  GL + W   +IR +GNYGE++DRNLG  + LK+ RG N 
Sbjct: 270 SDAQVRRLLGLDPG--IGKGFGLDEGWARNVIRAVGNYGEVWDRNLGAATPLKLDRGLNR 327

Query: 329 LWSKGGLMYAPPIR 342
            W++GGL+Y+PP +
Sbjct: 328 QWNQGGLLYSPPFQ 341


>gi|114771237|ref|ZP_01448657.1| glutamate/glutamine/aspartate/asparagine ABC transporter,
           periplasmic substrate-binding protein [alpha
           proteobacterium HTCC2255]
 gi|114548162|gb|EAU51049.1| glutamate/glutamine/aspartate/asparagine ABC transporter,
           periplasmic substrate-binding protein [alpha
           proteobacterium HTCC2255]
          Length = 339

 Score =  299 bits (765), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 143/317 (45%), Positives = 204/317 (64%), Gaps = 3/317 (0%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           L D++  G LKCG+ TGL GFA   ANG W GFDV  CRA+++A+  D + ++++P   K
Sbjct: 25  LEDVQAAGELKCGVTTGLAGFALADANGVWDGFDVAVCRAVAAAVLGDGNAVKFVPTTGK 84

Query: 87  ERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGA 146
            RF AL S +ID+L+RNT WT  R++ L   F  + Y+DGQGF+  K  G+SS   L GA
Sbjct: 85  TRFTALASGEIDLLARNTTWTFSRDVDLKFEFVGVNYYDGQGFMAPKALGVSSAKDLDGA 144

Query: 147 SICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKL 206
           ++C+Q GTTTEL LAD+F+++N+ Y P+  E   E  A Y A  CD +T D S L + + 
Sbjct: 145 TVCIQTGTTTELNLADFFRSNNISYEPVPIETNAEAQAQYLAGACDVFTTDASGLASTRA 204

Query: 207 TNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSK 266
           T + P +H++LP+I+SK PL P +  GD  W +I  WT  A++TAEELG+T  N+ + + 
Sbjct: 205 TFENPDDHIVLPEIVSKEPLGPLVRHGDNNWGDIARWTLNALITAEELGVTSANVAEHTA 264

Query: 267 DT-TNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRG 325
           +   NP+V R LG +   ++G  LGL K W  R I   GNYGE+F++N+G  + + I RG
Sbjct: 265 NAGNNPEVNRLLGTE--GDLGGMLGLDKQWASRAIAVNGNYGEIFEKNIGVNTPIGIARG 322

Query: 326 YNALWSKGGLMYAPPIR 342
            NA W+ GGL+Y+ P R
Sbjct: 323 LNASWTNGGLIYSAPFR 339


>gi|254424681|ref|ZP_05038399.1| hypothetical protein S7335_4841 [Synechococcus sp. PCC 7335]
 gi|196192170|gb|EDX87134.1| hypothetical protein S7335_4841 [Synechococcus sp. PCC 7335]
          Length = 350

 Score =  298 bits (763), Expect = 9e-79,   Method: Compositional matrix adjust.
 Identities = 140/324 (43%), Positives = 209/324 (64%), Gaps = 3/324 (0%)

Query: 19  SFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKI 78
           +  ++ S L  +  RG L CG++ G+ GF+ V+A G + G DVD C+A+++A+FDDP ++
Sbjct: 30  AVGSSGSRLQTVLDRGELICGVDGGIPGFSFVEA-GAYSGLDVDVCKAVAAALFDDPEQV 88

Query: 79  QYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGIS 138
            Y  L++ ERF AL+  ++D+LSRNT WTL R+ S+G+ F P T++DGQG ++ +  GI+
Sbjct: 89  VYRNLDSTERFEALKGGEVDMLSRNTTWTLSRDTSVGMEFGPTTFYDGQGMLVREADGIA 148

Query: 139 SVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDI 198
            +S   G S+CV+AGTTTEL LAD  +   + + P  F+  +   AAY A  C+  T D 
Sbjct: 149 ELSDFEGRSVCVEAGTTTELNLADQMRQLGVSFEPQTFQDADAAYAAYEAGSCEGMTSDK 208

Query: 199 SALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQ 258
           S L A + T   P EHV+L   +SK PL P  I  D+ W++ V W  YA++  EELG+T 
Sbjct: 209 SQLIARRSTLTNPDEHVLLDVTMSKEPLGPLTINNDSAWFDTVKWVTYALIEGEELGLTS 268

Query: 259 KNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQS 318
           +NI +    T +P ++RF G  +   +G  +GL  D+  R I+H+GNYGE+++RNLG  S
Sbjct: 269 ENIEETVASTEDPTIRRFAG--EEGTLGSDMGLPNDFALRAIKHVGNYGEIYERNLGEGS 326

Query: 319 ELKIPRGYNALWSKGGLMYAPPIR 342
           +  + RG NALWS+GGL+Y+PP R
Sbjct: 327 QFALARGQNALWSEGGLLYSPPFR 350


>gi|87120913|ref|ZP_01076805.1| glutamate/glutamine/aspartate/asparagine ABC transporter,
           periplasmic substrate-binding protein [Marinomonas sp.
           MED121]
 gi|86163751|gb|EAQ65024.1| glutamate/glutamine/aspartate/asparagine ABC transporter,
           periplasmic substrate-binding protein [Marinomonas sp.
           MED121]
          Length = 325

 Score =  298 bits (762), Expect = 9e-79,   Method: Compositional matrix adjust.
 Identities = 138/319 (43%), Positives = 205/319 (64%), Gaps = 2/319 (0%)

Query: 24  ASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPL 83
           A  L D+KKRGFL+CG      GFA    N  W+G ++D+C+ALSSA+F D +K + +P+
Sbjct: 9   ADTLDDVKKRGFLRCGTGEAKAGFAMPGDNNQWQGMEIDYCKALSSAVFGDETKFEVVPV 68

Query: 84  NAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQL 143
            +K RF +L S++ID+L + T WT  R+  LG+ F    +FDGQGF++ K+ G++S  QL
Sbjct: 69  TSKVRFTSLTSREIDVLVKGTTWTYSRDAKLGVDFAAYWFFDGQGFLIKKELGVTSAKQL 128

Query: 144 SGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYA 203
           +GA+IC+  GTT+E  +AD+F+ ++MKY P+V +   E   A +  RCD  T D+SAL +
Sbjct: 129 NGATICISPGTTSEKNVADFFRTYDMKYKPVVIKAGPETLDALQKGRCDVITNDLSALAS 188

Query: 204 LKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQ 263
            +     P + V+L D I+K PL+  + Q D+ W ++++WT  A+V AEELGITQ+N+ Q
Sbjct: 189 DRQKFTNPDDFVVLQDNIAKEPLSLYVRQNDSRWKDVITWTRNALVEAEELGITQENVGQ 248

Query: 264 VSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIP 323
            +K   +P V R LG   +   GE LGL   W +  I  +GNYGE+F+RN+G Q+ + + 
Sbjct: 249 HAKHPIDPRVARLLGAKGA--YGEMLGLPNTWAHDAISAVGNYGEIFERNVGEQTRMGLT 306

Query: 324 RGYNALWSKGGLMYAPPIR 342
           R  N  W  GGL++APP R
Sbjct: 307 RNLNQQWYDGGLVFAPPFR 325


>gi|56751276|ref|YP_171977.1| polar amino acid transport system substrate-binding protein
           [Synechococcus elongatus PCC 6301]
 gi|81299057|ref|YP_399265.1| extracellular solute-binding protein [Synechococcus elongatus PCC
           7942]
 gi|56686235|dbj|BAD79457.1| polar amino acid transport system substrate-binding proetin
           [Synechococcus elongatus PCC 6301]
 gi|81167938|gb|ABB56278.1| extracellular solute-binding protein, family 3 [Synechococcus
           elongatus PCC 7942]
          Length = 359

 Score =  297 bits (760), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 141/320 (44%), Positives = 207/320 (64%), Gaps = 5/320 (1%)

Query: 25  SILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLN 84
           S L  ++ RG L CG+   L GF+ + + G++ G DVD C+A+++A+F+DP  I+Y  L+
Sbjct: 43  SRLNQVQARGKLLCGVEGRLPGFSFLDSQGNYSGLDVDICKAIAAALFNDPKAIEYRSLD 102

Query: 85  AKERFLALQSKQIDILSRNTDWTLLREISLG--LAFRPITYFDGQGFIMHKKKGISSVSQ 142
           + ERF AL S ++D+LSRNT WTL R+   G  L F P T++DGQG ++ +  GI S+  
Sbjct: 103 SVERFPALASGEVDLLSRNTTWTLSRDAKGGNNLEFAPTTFYDGQGLMVRRNSGIQSLQD 162

Query: 143 LSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALY 202
             G SICV+ GTT+EL LAD  +   ++Y  I F   +   AAY   RC+  T D S L 
Sbjct: 163 FQGKSICVETGTTSELNLADTMRELGVQYQEIKFPNSDANYAAYAQGRCEGVTSDRSQLA 222

Query: 203 ALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNIN 262
           A + T     +H +L  +ISK PL+PA +  D+ W+++V W   A + AEE GITQ NI+
Sbjct: 223 ARRTTLSDADQHQLLDAVISKEPLSPATLNNDSPWFDVVKWVVNATIQAEEFGITQANID 282

Query: 263 QVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKI 322
           Q  K + NP+++RFLG++    +G+ LGL+ D+ YR I+ +GNYGE+++RN+G QS LK+
Sbjct: 283 QF-KTSKNPEIRRFLGLE--GELGQQLGLSNDFAYRAIKAVGNYGEIYERNVGQQSPLKL 339

Query: 323 PRGYNALWSKGGLMYAPPIR 342
            RG N L+  GGL+Y+PP R
Sbjct: 340 NRGLNQLYKNGGLLYSPPFR 359


>gi|218672485|ref|ZP_03522154.1| general L-amino acid ABC transporter, substrate-binding protein
           [Rhizobium etli GR56]
          Length = 219

 Score =  296 bits (759), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 129/220 (58%), Positives = 176/220 (80%), Gaps = 1/220 (0%)

Query: 123 YFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEI 182
           Y+DGQGF++ K   + S  +LSGAS+CVQ+GTTTEL LADYFKA+N++Y+P+VFE+++E+
Sbjct: 1   YYDGQGFMVRKSLNVKSALELSGASVCVQSGTTTELNLADYFKANNLQYNPVVFEKLDEV 60

Query: 183 DAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVS 242
           +AAY A RCD YT D S LY+L+LT   P EH ILP+IISK PL PA+ QGD +W++IVS
Sbjct: 61  NAAYDAGRCDVYTTDQSGLYSLRLTLKNPDEHAILPEIISKEPLGPAVRQGDDQWFDIVS 120

Query: 243 WTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRH 302
           W  YA++ AEE GITQ N++ + K++ NPD++RFLG++  + IG  LGLT +W Y II++
Sbjct: 121 WVGYALINAEEFGITQANVDDM-KNSPNPDIKRFLGVEADTKIGTDLGLTNEWAYNIIKN 179

Query: 303 MGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           +GNYGE+F+RN+G  S+LKI RG NALW+KGG+ YAPP+R
Sbjct: 180 VGNYGEVFERNVGQGSQLKIARGLNALWNKGGIQYAPPVR 219


>gi|166368449|ref|YP_001660722.1| amino acid transport system substrate-binding protein [Microcystis
           aeruginosa NIES-843]
 gi|166090822|dbj|BAG05530.1| amino acid transport system substrate-binding protein [Microcystis
           aeruginosa NIES-843]
          Length = 351

 Score =  296 bits (759), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 147/326 (45%), Positives = 210/326 (64%), Gaps = 6/326 (1%)

Query: 18  TSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSK 77
           T+ S +A  L  +K RG L CGIN  + GF+ V   G++ G DV  CRA+++A+FDDPSK
Sbjct: 31  TANSPSADRLQTVKNRGKLICGINGEVPGFSFVNEKGEYSGLDVQICRAIAAALFDDPSK 90

Query: 78  IQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGI 137
           ++Y  L+ +ERF A+Q+ ++DILSRNT WT+ R+ +LG+ F    ++DGQG +  K   +
Sbjct: 91  VEYRKLSPQERFTAVQTGEVDILSRNTTWTINRDTALGMEFITPVFYDGQGIMATKASNV 150

Query: 138 SSVSQLSGASICVQAGTTTELTLADYF-KAHNMKYHPIVFERVEEIDAAYRAHRCDAYTG 196
             +  LSG SICV +GTTTE  LAD   KA    Y PIV + VE +  AY+A RC A T 
Sbjct: 151 KKLEDLSGKSICVLSGTTTEQNLADAMAKAAVQGYKPIVSDDVEALYTAYQAGRCQAVTS 210

Query: 197 DISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGI 256
           D S L A +    RP +H +L  +ISK PLAPA+  GD  W N V    ++++  EE GI
Sbjct: 211 DRSQLVARRSVFPRPQDHQLLEVVISKEPLAPAVADGDPAWSNAVRSIVFSLIQGEEFGI 270

Query: 257 TQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGN 316
             +NI   + D+ +P ++RFLGID+   +GE +GL  D+  R+++ +GNYGE++DR +G 
Sbjct: 271 NSQNIATFA-DSKDPSIRRFLGIDE--KLGEDMGLPNDFAQRVLKQVGNYGEIYDREIGK 327

Query: 317 QSELKIPRGYNALWSKGGLMYAPPIR 342
              L++ RG N LW+KGGL+Y+PP R
Sbjct: 328 --PLQLDRGLNNLWTKGGLLYSPPFR 351


>gi|159028157|emb|CAO89764.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 351

 Score =  296 bits (758), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 147/326 (45%), Positives = 210/326 (64%), Gaps = 6/326 (1%)

Query: 18  TSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSK 77
           T+ S +A  L  +K RG L CGIN  + GF+ V   G++ G DV  CRA+++A+FDDP+K
Sbjct: 31  TANSPSADRLQTVKNRGKLICGINGEVPGFSFVNEKGEYSGLDVQICRAIAAALFDDPAK 90

Query: 78  IQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGI 137
           ++Y  L+ +ERF A+Q+ ++DILSRNT WT+ R+ +LG+ F    ++DGQG +  K   I
Sbjct: 91  VEYRKLSPQERFTAVQTGEVDILSRNTTWTINRDTALGMEFITPVFYDGQGIMATKASNI 150

Query: 138 SSVSQLSGASICVQAGTTTELTLADYF-KAHNMKYHPIVFERVEEIDAAYRAHRCDAYTG 196
             +  LSG SICV +GTTTE  LAD   KA    Y PIV + VE +  AY+A RC A T 
Sbjct: 151 KKLEDLSGKSICVLSGTTTEQNLADAMAKAAVQGYKPIVSDDVEALYTAYQAGRCQAVTS 210

Query: 197 DISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGI 256
           D S L A +    RP +H +L  +ISK PLAPA+  GD  W N V    ++++  EE GI
Sbjct: 211 DRSQLVARRSVFPRPQDHQLLEVVISKEPLAPAVADGDPAWSNAVRSIVFSLIQGEEFGI 270

Query: 257 TQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGN 316
             +NI   + D+ +P ++RFLGID+   +GE +GL  D+  R+++ +GNYGE++DR +G 
Sbjct: 271 NSQNIATFA-DSKDPSIRRFLGIDE--KLGEDMGLPNDFAQRVLKQVGNYGEIYDREIGQ 327

Query: 317 QSELKIPRGYNALWSKGGLMYAPPIR 342
              L++ RG N LW+KGGL+Y+PP R
Sbjct: 328 --PLQLDRGLNNLWTKGGLLYSPPFR 351


>gi|33600508|ref|NP_888068.1| ABC transporter substrate-binding protein [Bordetella
           bronchiseptica RB50]
 gi|33568107|emb|CAE32020.1| Putative ABC transport system, substrate-binding protein
           [Bordetella bronchiseptica RB50]
          Length = 336

 Score =  296 bits (758), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 145/333 (43%), Positives = 206/333 (61%), Gaps = 4/333 (1%)

Query: 10  LCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSS 69
           L +  +  T+   +A  L D+K RG L C   TG  GF+     G   G +VD CRA+++
Sbjct: 8   LLVAAIAHTAAPVHAGTLEDVKARGNLLCSSTTGSPGFSMPDDAGKRHGLEVDVCRAIAT 67

Query: 70  AIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGF 129
           A+F DP + + + LN  +RF ALQS ++DIL   T WTL RE   G  +  +TY+DGQG 
Sbjct: 68  AVFGDPERHKIVVLNPTQRFTALQSGEVDILFNTTTWTLSRE-GAGALYAGVTYYDGQGV 126

Query: 130 IMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAH 189
           ++ +K  I+S  +L G +IC   G+TTEL L D+F+A+ +    I F  V+E   AY + 
Sbjct: 127 LV-RKGTIASAKELDGGAICTNQGSTTELNLVDFFRANKVSNEVITFATVQEAANAYESG 185

Query: 190 RCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMV 249
           RCDA++ D   L AL+     P +HVIL D +SK PL  A+ +GD  W+++V W+ +A+ 
Sbjct: 186 RCDAWSADAGILAALRSKMKAPDDHVILADRLSKEPLGAAVRKGDDAWFSVVRWSIFALQ 245

Query: 250 TAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEM 309
            AEELG+T KNI + +K TTNP+V RF+G  K  ++G+ LGL  DW Y+I+  +G+Y E+
Sbjct: 246 AAEELGLTSKNIAEQAKSTTNPEVLRFVG--KEGSLGKVLGLNGDWAYQIVAQVGSYAEI 303

Query: 310 FDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           FDRN+G  S L + RG NA W  GGL Y PP R
Sbjct: 304 FDRNIGAASPLNLERGINASWKNGGLFYTPPFR 336


>gi|300022607|ref|YP_003755218.1| extracellular solute-binding protein family 3 [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299524428|gb|ADJ22897.1| extracellular solute-binding protein family 3 [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 344

 Score =  296 bits (758), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 141/321 (43%), Positives = 208/321 (64%), Gaps = 3/321 (0%)

Query: 22  TNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYL 81
           + AS++  I+KRG + CG++    GF+E+  +G WKGFDV+FC AL++A+  +   +++L
Sbjct: 27  SEASLIDTIRKRGHVVCGVSERAPGFSEISGSGTWKGFDVEFCSALAAAVLGNKDSVKFL 86

Query: 82  PLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVS 141
            L   ++F AL+  +ID+L   T WTL R+  LG  F    Y+DGQGFI+ +   ISSV 
Sbjct: 87  SLMPSDKFNALRDNEIDVLMGATSWTLTRDTELGARFVAALYYDGQGFIVPRNHSISSVL 146

Query: 142 QLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISAL 201
           +LSGASICV  G+T    +ADYF A  M+Y  I  +R +E+   Y +  C   TGD+S L
Sbjct: 147 ELSGASICVLPGSTDASAVADYFGARRMRYQLITSDRWDELVKTYSSGGCTVLTGDLSLL 206

Query: 202 YALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNI 261
              +      ++ ++LP+ ISK PL PA+  G   W+ +V WT+ A+V AEELGI   N+
Sbjct: 207 AYERSRLANGADQMLLPEYISKEPLGPAVKVGRDSWFAVVRWTYMALVAAEELGINSSNV 266

Query: 262 NQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELK 321
            ++ K + + DV+RFLG++  ++IG  LGL +DW Y+++R +GNY E+FDR LG  S LK
Sbjct: 267 -EMMKVSPSHDVRRFLGLE--ADIGAPLGLARDWAYQVVRQVGNYAEIFDRTLGQGSALK 323

Query: 322 IPRGYNALWSKGGLMYAPPIR 342
           + RG N LW+KGGLMY+ P+R
Sbjct: 324 LDRGLNNLWTKGGLMYSVPMR 344


>gi|288959842|ref|YP_003450182.1| general L-amino acid transport system substrate-binding protein
           [Azospirillum sp. B510]
 gi|288912150|dbj|BAI73638.1| general L-amino acid transport system substrate-binding protein
           [Azospirillum sp. B510]
          Length = 356

 Score =  295 bits (754), Expect = 8e-78,   Method: Compositional matrix adjust.
 Identities = 144/330 (43%), Positives = 207/330 (62%), Gaps = 4/330 (1%)

Query: 13  IILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIF 72
           I L  T  +     L  IK RG +K G+ T   GF    +NG W+GF VDF RALS A+F
Sbjct: 31  IGLALTGAAKAGPTLDAIKARGSIKVGVGT-QPGFFSPDSNGRWQGFFVDFGRALSIAVF 89

Query: 73  DDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMH 132
           +DP K+Q++  + ++R  ALQS + DIL      T  R   LG  F P+ ++DGQG ++ 
Sbjct: 90  NDPDKVQFVSSSPQQRLPALQSGEFDILLSGVTQTFTRATKLGFHFGPVVFYDGQGLLVP 149

Query: 133 KKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCD 192
           KK G++    L+GA++CVQ GTT EL + D+F+ + + + P+V E   E   A+ + RCD
Sbjct: 150 KKLGVAKGKDLNGATVCVQTGTTGELNITDFFRQNKIAFKPVVIEETAENQKAFSSGRCD 209

Query: 193 AYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAE 252
             T D S L   +    +P ++V+LP+ ISK PLAPAI  GD +W  IV+W  YA + AE
Sbjct: 210 VLTQDASDLAITRTQLPKPDDYVLLPERISKEPLAPAIRYGDDQWLEIVNWAVYATIQAE 269

Query: 253 ELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDR 312
           ELGITQ NI+     + +P ++RFLG+D S  +GEA  L   + Y I++ +GNYGE+FDR
Sbjct: 270 ELGITQANIDSFLT-SADPTIRRFLGVDPS--LGEAAKLDPKFAYTIVKTVGNYGEIFDR 326

Query: 313 NLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           N+G  +++ + RG+N LW++GGL+YAPP R
Sbjct: 327 NVGPATKVGLDRGFNKLWTQGGLLYAPPFR 356


>gi|293605353|ref|ZP_06687737.1| general amino acid ABC superfamily ATP binding cassette
           transporter, binding protein [Achromobacter piechaudii
           ATCC 43553]
 gi|292816245|gb|EFF75342.1| general amino acid ABC superfamily ATP binding cassette
           transporter, binding protein [Achromobacter piechaudii
           ATCC 43553]
          Length = 338

 Score =  294 bits (753), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 148/341 (43%), Positives = 218/341 (63%), Gaps = 5/341 (1%)

Query: 3   KDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVD 62
           + F  + +   +L   S +        +KK+GFL+CG   G+ GF+ + + G+W G DVD
Sbjct: 2   RKFLTTAVAATLLCVASGAQAGVTFDAVKKKGFLQCGF-AGIPGFSVLDSKGEWTGLDVD 60

Query: 63  FCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPIT 122
            CRA+++A+F D SK++   L A+ +F ALQS +ID+LSRNT  TL R+ +LGL    + 
Sbjct: 61  MCRAVAAAMFGDASKVKGNVLTAQAKFTALQSGEIDMLSRNTTQTLTRDTTLGLIGVGVN 120

Query: 123 YFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEI 182
           ++D QG I+ K   + SV +L GA+ICVQ GTTTEL LADYF++  + + P++ E  +E 
Sbjct: 121 FYDAQGLIVKKSMNVKSVKELDGATICVQPGTTTELNLADYFRSRGLTFKPVLVENYDEN 180

Query: 183 DAAYRAHRCDAYTGDISALYA-LKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIV 241
                + RCDAYT D S   A ++    +P +  IL + +SK PL P + QGD +W+N+V
Sbjct: 181 FRLLESGRCDAYTNDKSNTAANMRTRLAKPEDWEILSENLSKEPLGPMVRQGDEQWFNVV 240

Query: 242 SWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIR 301
            W+  AM+ AEE GIT KN++++ K +TNP+VQR LG+  +  +G+ LGL   W Y II+
Sbjct: 241 RWSLNAMLEAEEYGITSKNVDEMLK-STNPNVQRILGV--TPGMGKNLGLDDKWAYNIIK 297

Query: 302 HMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
            +GNYGE +DR +G  S LK+ RG N  W++GGLMY  P+R
Sbjct: 298 QVGNYGESYDRAMGKDSPLKLERGLNKQWTQGGLMYGWPVR 338


>gi|33596740|ref|NP_884383.1| ABC transporter substrate-binding protein [Bordetella parapertussis
           12822]
 gi|33573441|emb|CAE37426.1| Putative ABC transport system, substrate-binding protein
           [Bordetella parapertussis]
          Length = 336

 Score =  294 bits (752), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 144/325 (44%), Positives = 203/325 (62%), Gaps = 4/325 (1%)

Query: 18  TSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSK 77
           T+   +A  L D+K RG L C   TG  GF+     G   G +VD CRA+++A+F DP +
Sbjct: 16  TAAPVHAGTLEDVKARGNLLCSSTTGSPGFSMPDDAGKRHGLEVDVCRAIATAVFGDPER 75

Query: 78  IQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGI 137
            + + LN  +RF ALQS ++DIL   T WTL RE   G  +  +TY+DGQG ++ +K  I
Sbjct: 76  HKIVVLNPIQRFTALQSGEVDILFNTTTWTLSRE-GAGALYAGVTYYDGQGVLV-RKGTI 133

Query: 138 SSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGD 197
           +S  +L G +IC   G+TTEL L D+F+A+ +    I F  V+E   AY + RCDA++ D
Sbjct: 134 ASAKELDGGAICTNQGSTTELNLVDFFRANKVSNEVITFATVQEAANAYESGRCDAWSAD 193

Query: 198 ISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGIT 257
              L AL+     P +HVIL D +SK PL  A+ +GD  W+++V W+ +A+  AEELG+T
Sbjct: 194 AGILAALRSKMKAPDDHVILADRLSKEPLGAAVRKGDDAWFSVVRWSIFALQAAEELGLT 253

Query: 258 QKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQ 317
            KNI + +K TTNP+V RF+G  K  ++G+ LGL  DW Y+I+  +G+Y E+FDRN+G  
Sbjct: 254 SKNIAEQAKSTTNPEVLRFVG--KEGSLGKVLGLNGDWAYQIVAQVGSYAEIFDRNIGAA 311

Query: 318 SELKIPRGYNALWSKGGLMYAPPIR 342
           S L + RG NA W  GGL Y PP R
Sbjct: 312 SPLNLERGINASWKNGGLFYTPPFR 336


>gi|220914746|ref|YP_002490054.1| extracellular solute-binding protein family 3 [Methylobacterium
           nodulans ORS 2060]
 gi|219952497|gb|ACL62887.1| extracellular solute-binding protein family 3 [Methylobacterium
           nodulans ORS 2060]
          Length = 341

 Score =  294 bits (752), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 133/322 (41%), Positives = 216/322 (67%), Gaps = 7/322 (2%)

Query: 22  TNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYL 81
           + +  + DI+ RG L CG+  G  GF+   + G  +G D D CRA+++A   +  K++Y+
Sbjct: 26  SGSKTIDDIRARGQLVCGVTAGAAGFSLPDSRGVMRGIDADICRAVAAATLGEADKVRYV 85

Query: 82  PLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVS 141
           P     RF ALQS +IDIL R+T WTL RE +LGL F  + +FDG GF+++K  G+ S  
Sbjct: 86  PTTVTNRFTALQSGEIDILVRSTTWTLSREANLGLEFAGVYFFDGTGFMVNKSLGVKSSK 145

Query: 142 QLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISAL 201
           +L+GA+IC+Q GT+TEL +ADYF+ H MK+ PI+ +   E    + + RCDAY+ DISAL
Sbjct: 146 ELNGATICIQPGTSTELAVADYFREHGMKFKPILIQDPAETQNTFISGRCDAYSMDISAL 205

Query: 202 YALKLTND-RPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKN 260
            + +     +  ++V+LP++ISK P+   + +GD +++++V W+  A++  EE G+TQ N
Sbjct: 206 ASFRFQQGPKKDDYVLLPEVISKEPVGVMVRKGDEKFFDLVRWSMIALLQGEESGVTQAN 265

Query: 261 INQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSEL 320
           ++Q+  D+ +P ++R LG++   ++G+A+G+   W Y+I++ +GN+GE+++RN+   + L
Sbjct: 266 VDQM-LDSKDPTIRRMLGLE--GDLGKAMGVDNKWAYKILKSVGNFGEIWERNI---APL 319

Query: 321 KIPRGYNALWSKGGLMYAPPIR 342
            I RG NALW+KGGL Y PP+R
Sbjct: 320 GISRGINALWTKGGLHYPPPMR 341


>gi|152998090|ref|YP_001342925.1| extracellular solute-binding protein [Marinomonas sp. MWYL1]
 gi|150839014|gb|ABR72990.1| extracellular solute-binding protein family 3 [Marinomonas sp.
           MWYL1]
          Length = 339

 Score =  291 bits (746), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 143/342 (41%), Positives = 215/342 (62%), Gaps = 3/342 (0%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           M K    +I+   +L  ++    A  L ++K RG +KCGI+ G  GF+     G+W G D
Sbjct: 1   MKKLIATAIIGAGVLSASASVYAADKLEEVKARGVMKCGIHPGKAGFSTPDTKGNWTGLD 60

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
           V+ C+A+++A+F D SK++++ +N++ R  AL + +ID+L+R+T +T  R+   G+    
Sbjct: 61  VELCKAVAAAVFGDASKVEFITMNSRNRLTALVTDEIDMLARSTTFTATRDGLNGVDVTT 120

Query: 121 ITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVE 180
             ++DGQ  ++ K+ G++S+ +L GA+IC   GTT+E  + DYF++  + Y  ++ E   
Sbjct: 121 PWFYDGQALMVKKELGVNSIEELDGATICTYPGTTSEKNINDYFESRGLSYKALIVEGSA 180

Query: 181 EIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNI 240
           E  AAY A+RCDA T D SAL A +     PS +VILP+ ISK PL   + QG+ EW  +
Sbjct: 181 ESTAAYLANRCDAVTNDASALAADRQGMPDPSANVILPERISKEPLGAYVKQGNDEWRQV 240

Query: 241 VSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRII 300
           V+WT  A++ AEE GITQ N+++  K +T PDV R LG + S  +G+  GL   W Y  I
Sbjct: 241 VTWTAMALIEAEEQGITQSNVDEKLK-STKPDVMRLLGTEGS--LGKNFGLDDKWAYNAI 297

Query: 301 RHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           + +GNYGE+FDRNLG  S LK  RG N L++KGGL+YA P R
Sbjct: 298 KAVGNYGEIFDRNLGKDSALKFDRGLNNLYTKGGLLYAYPFR 339


>gi|83858265|ref|ZP_00951787.1| ABC glutamate/glutamine/aspartate/asparagine transporter,
           periplasmic substrate-binding protein [Oceanicaulis
           alexandrii HTCC2633]
 gi|83853088|gb|EAP90940.1| ABC glutamate/glutamine/aspartate/asparagine transporter,
           periplasmic substrate-binding protein [Oceanicaulis
           alexandrii HTCC2633]
          Length = 353

 Score =  291 bits (745), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 129/318 (40%), Positives = 200/318 (62%), Gaps = 2/318 (0%)

Query: 25  SILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLN 84
           S + ++++RG L+CG++TGLVGFA+    G W GF+V+ CRA ++A  +DP + +++P  
Sbjct: 38  SHMDEVQRRGVLRCGVDTGLVGFAQTDETGSWSGFEVELCRAYAAAFLNDPDRAEFIPTT 97

Query: 85  AKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLS 144
             +RF A++  ++DIL RNT WTL R    G+ F  I Y+DGQGF+     G++S  +LS
Sbjct: 98  TLDRFRAVREGEVDILLRNTSWTLSRATLQGVRFAGIYYYDGQGFLTPADLGLTSAQELS 157

Query: 145 GASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYAL 204
           GA ICVQ  TT+ L L DY + + + +  +  E V +   AY A +CDA+T D+S L   
Sbjct: 158 GARICVQPETTSALNLDDYAERYGLDFTIVSVETVADARTAYEAGQCDAFTSDVSRLAGF 217

Query: 205 KLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQV 264
           + +   P  H++LPD+ISK PL+P +   D  +   V W   +++ AEE G+TQ      
Sbjct: 218 RRSLSEPDRHMVLPDVISKEPLSPVVRDDDDAFAMAVEWVLTSLIAAEEYGVTQSQAASA 277

Query: 265 SKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPR 324
            + ++ P+V+R L +D+   +  +LGL  D+  + I   G+YGE+F+RNLG  S+L++ R
Sbjct: 278 DQTSSRPEVRRLLEVDE--EVAASLGLENDFARQAIAVGGHYGELFERNLGEASQLQLER 335

Query: 325 GYNALWSKGGLMYAPPIR 342
           G NA W +GGL+YAPP+R
Sbjct: 336 GLNAQWKEGGLLYAPPVR 353


>gi|126731767|ref|ZP_01747571.1| Lysine-arginine-ornithine-binding periplasmic protein [Sagittula
           stellata E-37]
 gi|126707594|gb|EBA06656.1| Lysine-arginine-ornithine-binding periplasmic protein [Sagittula
           stellata E-37]
          Length = 344

 Score =  290 bits (741), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 138/322 (42%), Positives = 206/322 (63%), Gaps = 6/322 (1%)

Query: 23  NASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLP 82
           +   L  IK RG L CG++    GFA   + G+W G +VD+C AL++A+F D  K++++ 
Sbjct: 27  SGDTLASIKSRGELLCGVHPARHGFAAPDSQGNWAGLEVDYCHALAAAVFGDADKVRFVA 86

Query: 83  LNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQ 142
           L++++RF A+QS ++D+L RN   TL R+ +LGL F P  ++ G GF++H   G+ +V  
Sbjct: 87  LSSQQRFPAIQSGEVDVLVRNVTATLGRDTALGLNFAPPIFYTGTGFLVHAGSGVETVED 146

Query: 143 LSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALY 202
           L GA+ICV  G+TTE  +A  F +  M+Y P+V E  +++  AY   RCDA T D +AL 
Sbjct: 147 LDGATICVAPGSTTERNVAQIFASRGMEYTPVVIENNKQLVDAYVTGRCDALTKDKAALP 206

Query: 203 ALKL--TNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKN 260
            ++   T D P EHV+LP I SK PLAPA+ QGD +WY+IV W  YA   AEELG+T +N
Sbjct: 207 GVRAYDTTD-PKEHVLLPGIFSKEPLAPAVRQGDDQWYDIVKWVVYATFNAEELGVTSEN 265

Query: 261 INQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSEL 320
             ++ +++ + DV   LG   + + G  LGLT+DW Y +I  +GNYGE++DR+ G  S +
Sbjct: 266 AEEM-RNSDDVDVMSLLGT--TGDYGSKLGLTEDWAYDVITQVGNYGEIYDRHFGPDSPV 322

Query: 321 KIPRGYNALWSKGGLMYAPPIR 342
           ++ R  N  W+ GGL+Y  PI+
Sbjct: 323 QLDRDLNKQWTDGGLLYGFPIK 344


>gi|301166613|emb|CBW26189.1| General L-amino acid substrate binding protein [Bacteriovorax
           marinus SJ]
          Length = 347

 Score =  290 bits (741), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 142/328 (43%), Positives = 204/328 (62%), Gaps = 4/328 (1%)

Query: 15  LFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDD 74
           L  TS S  AS + +IKKRG L CG++ GL GF+     G+WKGFDVD C+A++ AIF+D
Sbjct: 24  LLLTSLSW-ASTISEIKKRGHLNCGVSEGLTGFSIPNEKGEWKGFDVDICKAIAVAIFND 82

Query: 75  PSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKK 134
             K++++P +  ERF +L  KQIDILSRNT  T  RE++  + F P+ YFD QG ++ K+
Sbjct: 83  TQKVKFIPTSLGERFNSLAKKQIDILSRNTSRTFSREVTRDIEFAPVVYFDTQGILVSKR 142

Query: 135 KGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAY 194
             I  +  L    ICV+  TTT+  L DYFK HN++   + F+  +++   +   RC A 
Sbjct: 143 SKIKKIKDLDNKKICVKNNTTTQQNLIDYFKHHNLRLRQVRFDNNDQLVLGFLKKRCIAL 202

Query: 195 TGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEEL 254
           T D++ L + K          +L + I K PLAP I+ GD  W N+V WT Y+++ AEEL
Sbjct: 203 TSDVTTLISEKNHFQNSKSFTLLSERIEKEPLAPVILSGDRRWKNLVDWTIYSLIWAEEL 262

Query: 255 GITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNL 314
           G++  NI +  K + +P V+RF G  +  N  + LG++  WT  II  +GNY E+F RNL
Sbjct: 263 GVSSSNI-EAMKTSADPRVKRFFG--EGFNFEKMLGVSNGWTGNIISKIGNYSEVFHRNL 319

Query: 315 GNQSELKIPRGYNALWSKGGLMYAPPIR 342
           G  S LKIPRG N+LW  GG++Y+PP++
Sbjct: 320 GRDSNLKIPRGLNSLWKDGGILYSPPMK 347


>gi|326794954|ref|YP_004312774.1| ABC-type transporter periplasmic subunit family 3 [Marinomonas
           mediterranea MMB-1]
 gi|326545718|gb|ADZ90938.1| ABC-type transporter, periplasmic subunit family 3 [Marinomonas
           mediterranea MMB-1]
          Length = 343

 Score =  289 bits (740), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 137/341 (40%), Positives = 213/341 (62%), Gaps = 7/341 (2%)

Query: 7   VSILCLIILFFTSFS---TNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDF 63
            S+L L    F++ S     AS L ++K RG++ C I     GF  +   G+W+G D+D 
Sbjct: 5   TSLLILASSMFSAASYAAETASTLDEVKSRGYMNCVIGNSFPGFYSLNKEGEWQGMDIDM 64

Query: 64  CRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITY 123
           CR++S+A+F D SK+++LP+   + F +++S + D+LS+   WTL R+   GL F    +
Sbjct: 65  CRSVSAAVFGDSSKVKFLPVQWAQSFTSIKSGKGDMLSKGMTWTLSRDTQQGLDFLDTYF 124

Query: 124 FDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEID 183
           +DGQGF++ K  G+ SV  L GA++CV  GT++EL +AD+ +A+N+    +VF+     +
Sbjct: 125 YDGQGFMVRKDLGVDSVYDLEGATVCVLTGTSSELNIADFSRANNLDLKTVVFDDSSVRN 184

Query: 184 AAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSW 243
            A+    CDA T D S L A +     P ++++LP+ ISK  L+ A+ Q D+EW N+V W
Sbjct: 185 TAFFNDNCDALTNDKSGLAAQRSAAQNPDDYIVLPETISKEALSFAVKQNDSEWANVVKW 244

Query: 244 THYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHM 303
           T  AMV AEE GIT  N++Q+  ++ +P V+R LG++ + N G  LGL +DW Y++I+ +
Sbjct: 245 TFAAMVAAEEYGITSDNVDQMRSESNSPVVRRLLGVEGNLNTG--LGLPQDWAYQVIKSV 302

Query: 304 GNYGEMFDRNLGNQSELKIPR--GYNALWSKGGLMYAPPIR 342
           GNYGE+++RN+G  S L + R    NALW  GG+MYA   R
Sbjct: 303 GNYGEVYERNVGPNSVLGLKREGTLNALWKDGGMMYAKSFR 343


>gi|296534477|ref|ZP_06896902.1| ABC superfamily ATP binding cassette transporter, binding protein
           [Roseomonas cervicalis ATCC 49957]
 gi|296265196|gb|EFH11396.1| ABC superfamily ATP binding cassette transporter, binding protein
           [Roseomonas cervicalis ATCC 49957]
          Length = 449

 Score =  289 bits (740), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 130/322 (40%), Positives = 206/322 (63%), Gaps = 2/322 (0%)

Query: 21  STNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQY 80
           S+ +  L  ++ RG L CG++TG+ GFA   + G W+G DVD CR L++AIF+DP+K++ 
Sbjct: 130 SSASPTLEAVRARGQLVCGVHTGIAGFALPDSRGVWQGLDVDLCRGLAAAIFNDPAKLRL 189

Query: 81  LPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSV 140
           +P+++  RF AL S ++D+L R +  T+LR+ +LGL      +FDG GF++    G+  V
Sbjct: 190 VPVSSSTRFTALGSGELDVLFRTSTQTMLRDTTLGLRHAVTYFFDGHGFMVRADSGVQRV 249

Query: 141 SQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISA 200
           ++L GA+IC+  GTT E   ADYF++ N  + P+VFER +++ AA +A RCDA+  D S 
Sbjct: 250 AELRGATICLVQGTTNEQVTADYFRSINTPFQPVVFERTDQVAAALQAGRCDAFGTDASQ 309

Query: 201 LYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKN 260
           L A + +   P++  +LP+  SK P    + +GD  W++IV W   A++ AEE G+T  N
Sbjct: 310 LAATRASLPNPAQWSVLPERFSKEPYGAYVRRGDDNWFDIVRWYTTAIIEAEEQGVTAAN 369

Query: 261 INQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSEL 320
              +   + NP+ +R LG+  +  +G+AL L   W Y  IR +GNY E++DR++G  + +
Sbjct: 370 AEAMRGSSANPNTRRLLGV--TPELGQALKLDPLWAYNAIRAVGNYAEIYDRHMGPATPI 427

Query: 321 KIPRGYNALWSKGGLMYAPPIR 342
            +PRG N  W++GGL+YA P+R
Sbjct: 428 GLPRGPNEQWTRGGLLYAWPMR 449


>gi|83592118|ref|YP_425870.1| extracellular solute-binding protein [Rhodospirillum rubrum ATCC
           11170]
 gi|83575032|gb|ABC21583.1| extracellular solute-binding protein, family 3 [Rhodospirillum
           rubrum ATCC 11170]
          Length = 350

 Score =  289 bits (740), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 140/326 (42%), Positives = 203/326 (62%), Gaps = 3/326 (0%)

Query: 17  FTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPS 76
           F+S +     L  IK RG +K G+     GF+   + G W+GF +D  RAL+  +F+DP 
Sbjct: 28  FSSSAEAGETLDAIKARGVIKIGVGGNSPGFSAPDSAGRWQGFFIDIGRALAVTVFNDPE 87

Query: 77  KIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKG 136
           K +++  + ++R  ALQS + DIL      T+ R   LG  F P+ ++DGQG ++ KK G
Sbjct: 88  KAEFVNSSPQQRLPALQSGEFDILLSGVTQTITRATKLGFHFGPVVFYDGQGLLVPKKLG 147

Query: 137 ISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTG 196
           I+  S+L GA++CVQ GTT EL +AD+F+ H + + P+V E   E   A+ + RCD  T 
Sbjct: 148 ITKGSELDGATVCVQTGTTGELNIADFFRQHKISFKPVVIEESNEFLKAFASGRCDVLTQ 207

Query: 197 DISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGI 256
           D S L   +      +++V+LP+ ISK PLAPAI  GD  W  IV+WT YA++ AEELGI
Sbjct: 208 DSSDLAIRRTLLPNAADYVLLPERISKEPLAPAIRYGDDRWLEIVNWTVYALIEAEELGI 267

Query: 257 TQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGN 316
           TQ  I+     + NP ++RFLG+D S  + EA GL   + Y II+ +GNYGE+F+R++G 
Sbjct: 268 TQATIDSF-LGSDNPSIRRFLGVDPS--LAEATGLDAKFAYNIIKALGNYGEVFERSVGK 324

Query: 317 QSELKIPRGYNALWSKGGLMYAPPIR 342
            S+L   RGYN  W++GGL+Y+PP R
Sbjct: 325 ASKLGFERGYNQPWTQGGLLYSPPFR 350


>gi|227325810|ref|ZP_03829834.1| Extracellular solute-binding protein, family 3 precursor
           [Pectobacterium carotovorum subsp. carotovorum WPP14]
          Length = 350

 Score =  287 bits (735), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 138/336 (41%), Positives = 208/336 (61%), Gaps = 4/336 (1%)

Query: 8   SILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRAL 67
           S+L  +     + + N   L  IK RG L CG++    GF+ + + G W G DVD+CRAL
Sbjct: 18  SLLLPVAQATAADAGNGETLKKIKARGELVCGVHPARHGFSAIDSKGQWTGLDVDYCRAL 77

Query: 68  SSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQ 127
           ++AIF D +K+++  L+  +RF A+QS ++D+LSRN    L R+ SLGL F P T++ G 
Sbjct: 78  AAAIFGDANKVRFAALSTAQRFPAIQSGEVDVLSRNITADLSRDTSLGLNFAPPTFYTGT 137

Query: 128 GFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYR 187
           GF++     +  V  L GA++C+  G++TE  +A  F + N+ Y P+V E  +E  AAY 
Sbjct: 138 GFMVRTSANVKKVEDLDGATVCITPGSSTERNVAQIFASRNLHYTPVVIENNKEYVAAYL 197

Query: 188 AHRCDAYTGDISALYALK-LTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHY 246
           + RCD    D  AL  ++    ++PS+HVILP I SK PLA A+ QGD +WY+IV W  Y
Sbjct: 198 SGRCDVIARDKVALPGVRTFDAEKPSDHVILPGIYSKEPLAMAVRQGDDQWYDIVKWVVY 257

Query: 247 AMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNY 306
           A   AEE+ I Q+N++   K +T+PD+Q  LG+  + + G+ LGL   W Y +I+ +GNY
Sbjct: 258 ATFNAEEMEIGQQNVDSKLK-STDPDIQALLGV--TGDYGQKLGLNNQWAYNLIKQVGNY 314

Query: 307 GEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           G++++R+ G  +   + R  N LW+KGGL+Y  PIR
Sbjct: 315 GDIYNRHFGPDTPAPLERDLNNLWTKGGLLYGLPIR 350


>gi|261823404|ref|YP_003261510.1| extracellular solute-binding protein family 3 [Pectobacterium
           wasabiae WPP163]
 gi|261607417|gb|ACX89903.1| extracellular solute-binding protein family 3 [Pectobacterium
           wasabiae WPP163]
          Length = 350

 Score =  287 bits (734), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 137/321 (42%), Positives = 202/321 (62%), Gaps = 4/321 (1%)

Query: 23  NASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLP 82
           N   L  IK RG L CG++    GF+ + + G W G DVD+CRAL++AIF D SK+++  
Sbjct: 33  NGETLKKIKARGELVCGVHPARHGFSAIDSKGQWTGLDVDYCRALAAAIFGDASKVRFAA 92

Query: 83  LNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQ 142
           L+  +RF A+QS ++D+LSRN    L R+ SLGL F P T++ G GF++     + +V  
Sbjct: 93  LSTAQRFPAIQSGEVDVLSRNITADLSRDTSLGLNFAPPTFYTGTGFMVRTSANVKTVED 152

Query: 143 LSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALY 202
           L GA++C+  G++TE  +A  F + N+ Y P+V E  +E  AAY + RCD    D  AL 
Sbjct: 153 LDGATVCITPGSSTERNVAQIFASRNLHYTPVVIENNKEYVAAYLSGRCDVIARDKVALP 212

Query: 203 ALK-LTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNI 261
            ++    ++P++HVILP I SK PLA A+ QGD +WY+IV W  YA   AEE+ I Q+N+
Sbjct: 213 GVRTFDAEKPADHVILPGIYSKEPLAMAVRQGDDQWYDIVKWVVYATFNAEEMEIGQQNV 272

Query: 262 NQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELK 321
           +   K +T+PDVQ  LG   + + G+ LGL   W Y +I+ +GNYG++++R+ G  +   
Sbjct: 273 DSKLK-STDPDVQALLGT--TGDYGQKLGLNNQWAYNLIKQVGNYGDIYNRHFGPDTPAP 329

Query: 322 IPRGYNALWSKGGLMYAPPIR 342
           + R  N LW+KGGL+Y  PIR
Sbjct: 330 LERDLNNLWTKGGLLYGLPIR 350


>gi|152994191|ref|YP_001339026.1| extracellular solute-binding protein [Marinomonas sp. MWYL1]
 gi|150835115|gb|ABR69091.1| extracellular solute-binding protein family 3 [Marinomonas sp.
           MWYL1]
          Length = 343

 Score =  287 bits (734), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 132/320 (41%), Positives = 208/320 (65%), Gaps = 4/320 (1%)

Query: 25  SILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLN 84
           S L  +K+RG++ C I     GF  +   G+W+G D+D CR ++SA+F D SK+++LP+ 
Sbjct: 26  STLDAVKERGYVNCVIGNSFPGFYSLNKAGEWQGMDIDMCRGVASAVFGDASKVKFLPVQ 85

Query: 85  AKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLS 144
             + F +++S + DILS+   WTL R+ + GL F    ++DGQGF++ K  G+ SV +L+
Sbjct: 86  WAQSFTSIKSGKGDILSKGMTWTLSRDSAQGLDFLDTYFYDGQGFMVRKDLGVKSVKELN 145

Query: 145 GASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYAL 204
           GA++CV  GT++EL +ADY +A+N+    +VF+     + A+  + CDA T D S L A 
Sbjct: 146 GATVCVLTGTSSELNIADYSRANNLDIKTVVFDDSSVRNTAFFNNNCDALTNDKSGLAAQ 205

Query: 205 KLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQV 264
           +     P+++VILP+ ISK  L+ A+ Q D+EW N+V WT  AMV AEE G+  +N+ ++
Sbjct: 206 RSAAPNPNDYVILPETISKEALSFAVKQNDSEWANVVKWTFAAMVAAEEFGVNSQNVEKM 265

Query: 265 SKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPR 324
             ++ +P V+R LG++   N G  LGL +DW +++I+++GNYGE+++RN+G  S L + R
Sbjct: 266 RAESQSPVVRRLLGVEGDLNTG--LGLPQDWAFQVIKNVGNYGEVYERNVGTDSVLGLDR 323

Query: 325 --GYNALWSKGGLMYAPPIR 342
               N LW+KGGLMYA   R
Sbjct: 324 EGTLNELWTKGGLMYAKSFR 343


>gi|163793102|ref|ZP_02187078.1| ABC-type amino acid transport/signal transduction system,
           periplasmic component/domain [alpha proteobacterium
           BAL199]
 gi|159181748|gb|EDP66260.1| ABC-type amino acid transport/signal transduction system,
           periplasmic component/domain [alpha proteobacterium
           BAL199]
          Length = 346

 Score =  286 bits (732), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 139/324 (42%), Positives = 199/324 (61%), Gaps = 4/324 (1%)

Query: 21  STNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQY 80
           S   S L  +K RG L+C + T   G+  +   G W GFD + CRA+S+AIF DP KI+ 
Sbjct: 25  SAQQSTLDIVKSRGHLRCQLGTPAPGWYMLSDTGKWSGFDYENCRAVSAAIFGDPDKIEV 84

Query: 81  LPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSV 140
             + +  RF A+ + + D+LSR T WTL RE  LGL F  ++++DGQGF++ K  GI S 
Sbjct: 85  QSVTSAVRFTAMANGESDMLSRTTTWTLFRETQLGLDFTTVSFYDGQGFMVLKDAGIKSA 144

Query: 141 SQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISA 200
            +L GA++CV  GTTTEL L DY + + +   P+VFE     D  +    CDA T D S+
Sbjct: 145 LELKGATVCVATGTTTELNLTDYSRTNGLDIKPVVFEDSNVRDNTFFTGGCDAITNDKSS 204

Query: 201 LYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKN 260
           L + +      S   ILP+ ISK PL P + Q D++W +IV W+ Y M+ AEE G++  N
Sbjct: 205 LASTRAKAPDVSIFKILPETISKEPLGPVVRQNDSQWKDIVQWSVYTMIAAEEYGMSSTN 264

Query: 261 INQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSEL 320
           +++V  +TTNP+++R LG +   N G  LGL   W Y II+ +GNYGE ++  +G ++ +
Sbjct: 265 VDKVLAETTNPEIKRMLGAEGDLNKG--LGLEPKWAYNIIKMVGNYGENYEEFMGEKTVM 322

Query: 321 KIPR--GYNALWSKGGLMYAPPIR 342
            IPR    NALW+KGGL+Y+PP R
Sbjct: 323 NIPRDGSPNALWTKGGLLYSPPFR 346


>gi|163742834|ref|ZP_02150218.1| predicted amino-acid transporter subunit [Phaeobacter gallaeciensis
           2.10]
 gi|161383798|gb|EDQ08183.1| predicted amino-acid transporter subunit [Phaeobacter gallaeciensis
           2.10]
          Length = 347

 Score =  285 bits (730), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 141/348 (40%), Positives = 210/348 (60%), Gaps = 10/348 (2%)

Query: 3   KDFFVSILCLII----LFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKG 58
           K+ F  + C  +    L   + +   S L  +K RG L C +     GF ++  +GDW+G
Sbjct: 2   KNLFSMLSCAAMAAGGLSIAAPAAAQSTLETVKTRGHLNCQVGPPRAGFYQLLESGDWEG 61

Query: 59  FDVDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAF 118
            DV  CRA+++AIF DP+K+++  ++A  RF +L + + D+LSR   WT+ R+ +LG+ F
Sbjct: 62  SDVAVCRAMAAAIFGDPNKVEFQSVSASVRFTSLANGESDVLSRTATWTVGRDAALGIDF 121

Query: 119 RPITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFER 178
               + DGQGF++ K  GI S   L+GA++CV  G T+E TL D+ +A+N+    + F+ 
Sbjct: 122 TAPVFHDGQGFLVRKDSGIKSAFDLTGATVCVITGHTSEATLQDFSRANNLDIQAVAFDD 181

Query: 179 VEEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWY 238
              ++  Y    CDA T D   L +       PSEHV+LP+I+SK PL PA+  GD +W 
Sbjct: 182 SAIVNETYLNGGCDAITTDKGVLASEARGFPDPSEHVVLPEILSKEPLTPAVRNGDNQWG 241

Query: 239 NIVSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYR 298
           +IV WT +A++ AEELGITQ N+ +++ +  NP V RFLG +   N G  LGL KDW   
Sbjct: 242 DIVQWTVFALINAEELGITQANVEEIAANPPNPLVARFLGAEGELNTG--LGLPKDWVVH 299

Query: 299 IIRHMGNYGEMFDRNLGN--QSELKIPRG--YNALWSKGGLMYAPPIR 342
            I+ +GNYGE+++  LG+     L IPR    NALW++GGLM++PP R
Sbjct: 300 AIKAVGNYGEIYEHYLGDGRPEALGIPRAGSANALWTEGGLMFSPPFR 347


>gi|253690349|ref|YP_003019539.1| extracellular solute-binding protein family 3 [Pectobacterium
           carotovorum subsp. carotovorum PC1]
 gi|251756927|gb|ACT15003.1| extracellular solute-binding protein family 3 [Pectobacterium
           carotovorum subsp. carotovorum PC1]
          Length = 350

 Score =  285 bits (729), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 134/321 (41%), Positives = 202/321 (62%), Gaps = 4/321 (1%)

Query: 23  NASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLP 82
           N   L  IK RG L CG++    GF+ + + G W G DVD+CRAL++A+F D +K+++  
Sbjct: 33  NGETLKKIKARGELVCGVHPARHGFSAIDSKGQWTGLDVDYCRALAAAVFGDANKVRFAA 92

Query: 83  LNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQ 142
           L+  +RF A+QS ++D+LSRN    L R+ SLGL F P T++ G GF++     +  V  
Sbjct: 93  LSTAQRFPAIQSGEVDVLSRNITADLSRDTSLGLNFAPPTFYTGTGFMVRTSANVKKVED 152

Query: 143 LSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALY 202
           L GA++C+  G++TE  +A  F + N+ Y P+V E  +E  AAY + RCD    D  AL 
Sbjct: 153 LDGATVCITPGSSTERNVAQIFASRNLHYTPVVIENNKEYVAAYLSGRCDVIARDKVALP 212

Query: 203 ALK-LTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNI 261
            ++    ++PS+HVILP I SK PLA A+ QGD +WY+IV W  YA   AEE+ I Q+N+
Sbjct: 213 GVRTFDAEKPSDHVILPGIYSKEPLAMAVRQGDDQWYDIVKWVVYATFNAEEMEIGQQNV 272

Query: 262 NQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELK 321
           +   K +T+PD+Q  LG+  + + G+ LGL+  W Y +I+ +GNY ++++R+ G  +   
Sbjct: 273 DSKLK-STDPDIQALLGV--TGDYGQKLGLSNQWAYNVIKQVGNYSDIYNRHFGPDTPAP 329

Query: 322 IPRGYNALWSKGGLMYAPPIR 342
           + R  N LW+KGGL+Y  PIR
Sbjct: 330 LERDLNNLWTKGGLLYGLPIR 350


>gi|328950982|ref|YP_004368317.1| ABC-type transporter, periplasmic subunit family 3 [Marinithermus
           hydrothermalis DSM 14884]
 gi|328451306|gb|AEB12207.1| ABC-type transporter, periplasmic subunit family 3 [Marinithermus
           hydrothermalis DSM 14884]
          Length = 341

 Score =  285 bits (729), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 143/342 (41%), Positives = 219/342 (64%), Gaps = 11/342 (3%)

Query: 5   FFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEV-KANGDWKGFDVDF 63
             V++L +  L F   S    +L    +RG L CG+N    GF  + +  G ++GFD+DF
Sbjct: 7   LLVAVLLVGALGFAQQSRMDVVL----ERGKLVCGVNNVAPGFGFLNEQTGRFEGFDIDF 62

Query: 64  CRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITY 123
           CRA+++A+FDDP  ++Y+PL AK RF A+Q+ ++D++ RNT  T+ R+ S+G+ F P+ +
Sbjct: 63  CRAVAAALFDDPDAVEYVPLTAKARFSAIQTGEVDVVFRNTTITVSRDSSVGVDFLPVNF 122

Query: 124 FDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIV-FERVEEI 182
           +DGQG ++ K+ G++SV +L GA++C   GTTTE    D+ +A   +   ++ FE   ++
Sbjct: 123 YDGQGVMVKKELGVTSVFELEGATVCTNQGTTTEKNWTDFVRAQGWQGGQLLTFEDFSKV 182

Query: 183 DAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVS 242
             A+ + RCDA T D S L   K     P E VILP+ ISK PLA    Q D++W + ++
Sbjct: 183 FNAFISGRCDAATTDKSGLAGWKAQASNPDEIVILPETISKEPLAGFTFQNDSKWRDALT 242

Query: 243 WTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRH 302
           W  YA++ AEE GIT +N+++  K + +P ++RFLG++     GE LGL  D+  RI+RH
Sbjct: 243 WIVYALIQAEEFGITSENVDEFLK-SDSPAIRRFLGVE--GKFGEDLGLPNDFVVRILRH 299

Query: 303 MGNYGEMFDRNLGNQSELKIPR--GYNALWSKGGLMYAPPIR 342
           +GNYGE++DR+LG +S   IPR    N LW++GGL+YAPP R
Sbjct: 300 VGNYGEIYDRHLGPESPFYIPREGSLNELWTRGGLLYAPPFR 341


>gi|254469135|ref|ZP_05082540.1| glutamate/glutamine/aspartate/asparagine-binding protein
           [Pseudovibrio sp. JE062]
 gi|211960970|gb|EEA96165.1| glutamate/glutamine/aspartate/asparagine-binding protein
           [Pseudovibrio sp. JE062]
          Length = 678

 Score =  285 bits (728), Expect = 9e-75,   Method: Compositional matrix adjust.
 Identities = 129/292 (44%), Positives = 189/292 (64%), Gaps = 2/292 (0%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           L D+++RG L+C ++TGL GF+    NG W+GFDVD+CRA+++A+  D   +++ P   K
Sbjct: 27  LEDVQERGKLRCAVSTGLAGFSYTDENGKWQGFDVDYCRAVAAAVLGDADAVEFSPTTGK 86

Query: 87  ERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGA 146
            RF AL S ++DILSRNT WT  R+  L   F  ++Y+DGQGF++ K  G++S  +L GA
Sbjct: 87  TRFTALASGEVDILSRNTTWTFSRDADLKFTFLGVSYYDGQGFMVKKSLGVASAKELDGA 146

Query: 147 SICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKL 206
           ++C+Q GTTTEL L+DYF A  M Y P+  E   E  A Y A  CD YT D S L A + 
Sbjct: 147 TVCIQTGTTTELNLSDYFTAEGMSYEPLSIETNTEGRANYLADACDVYTTDASGLAASRA 206

Query: 207 TNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSK 266
           T +   +H++LP+IISK PL P +  GD +W +I  W   A+  AEE GIT  N ++++ 
Sbjct: 207 TFENADDHIVLPEIISKEPLGPLVRHGDDQWADIGRWVLNALKIAEEKGITAANADEMAA 266

Query: 267 DTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQS 318
           ++ +P+V R LG   S  +G ++GL  D+    I+ +GNYGE+F+R+LG Q+
Sbjct: 267 NSKDPEVLRLLG--ASGEMGASVGLGNDFALVAIKAVGNYGEVFERHLGTQT 316


>gi|254432874|ref|ZP_05046577.1| polar amino acid transport system substrate-binding proetin
           [Cyanobium sp. PCC 7001]
 gi|197627327|gb|EDY39886.1| polar amino acid transport system substrate-binding proetin
           [Cyanobium sp. PCC 7001]
          Length = 344

 Score =  283 bits (723), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 139/322 (43%), Positives = 204/322 (63%), Gaps = 8/322 (2%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           L  I  R  L CG+   L GF+ V+ +G + G DVD C+A+++A+  DP K++Y  LN+ 
Sbjct: 25  LNGITARDKLVCGVEGTLPGFSFVEPDGRYSGLDVDTCKAVAAAVLGDPDKVEYRNLNSS 84

Query: 87  ERFLALQSKQIDILSRNTDWTLLREISLG--LAFRPITYFDGQGFIMHKKKGISSVSQLS 144
           ERF AL S ++D+L+RNT  TL R+ + G  L+F P T++DGQG +   K GI+ +  LS
Sbjct: 85  ERFAALASGEVDMLARNTTATLSRDAAGGNGLSFAPTTFYDGQGVMAPVKSGITDLKGLS 144

Query: 145 GASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYAL 204
           G +ICV++GTTTEL LAD  +  ++ Y P+ F+  ++  AAY   RC A T D S L   
Sbjct: 145 GKAICVESGTTTELNLADRMREIDVPYTPLKFQTSDQTYAAYLGGRCAAVTSDRSQLAGK 204

Query: 205 KLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNIN-- 262
           + +   P +H +LPD++SK PL+PA    D  W + + W  ++++ AEE GITQ N++  
Sbjct: 205 RSSFPAPDDHQLLPDVLSKEPLSPATTNADPAWADALRWIVFSLMQAEEWGITQANLDSK 264

Query: 263 --QVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSEL 320
             +   +T   D++RF G++   + G  LGL  D+T R IR +GNYGE+F+RN+G  S L
Sbjct: 265 LAEAQANTNLADLRRFFGVE--GDFGRQLGLPADFTVRAIRAVGNYGEIFERNVGTTSRL 322

Query: 321 KIPRGYNALWSKGGLMYAPPIR 342
           K+ RG N LWS+GGL+YA P R
Sbjct: 323 KLERGLNRLWSEGGLIYAQPFR 344


>gi|39935694|ref|NP_947970.1| polar amino acid ABC transport substrate-binding protein AapJ-2
           [Rhodopseudomonas palustris CGA009]
 gi|39649547|emb|CAE28069.1| polar amino acid ABC transport substrate-binding protein, aapJ-2
           [Rhodopseudomonas palustris CGA009]
          Length = 340

 Score =  282 bits (722), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 142/316 (44%), Positives = 198/316 (62%), Gaps = 7/316 (2%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           L  IK RG +K G+ T   G+    +NG W+GF VDF RAL+  +F DP K+Q+   + +
Sbjct: 32  LDRIKSRGVIKVGVGT-TPGYFAPDSNGRWQGFFVDFGRALAVTVFGDPDKVQFTSSSPQ 90

Query: 87  ERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGA 146
           +R  ALQS + D+L      T+ R   LG  F P  ++DGQG ++ K  G++S SQL GA
Sbjct: 91  QRLPALQSGEFDVLLSGVTVTITRAFKLGFHFGPTIFYDGQGILVRKDLGVTSASQLDGA 150

Query: 147 SICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKL 206
           +I +Q+GTT EL +ADYF+ H  K+ P+  E   E  AA  + R D  T D S L A + 
Sbjct: 151 TIGIQSGTTGELNIADYFRKHRHKFTPVTIEDTSEFIAALDSGRVDGLTQDASDLAAKQT 210

Query: 207 TNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSK 266
              +PS++VILP+ +SK PLAPA+  GD  W  IV+WT  A + AEE GIT KN++   K
Sbjct: 211 QLKKPSDYVILPERLSKEPLAPAVAGGDDRWLEIVTWTVNATIQAEEWGITSKNVDDFLK 270

Query: 267 DTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGY 326
            + +P ++RFLG+D S  + E++GL   W Y II+ +GNYGE+FDR+L     L   RGY
Sbjct: 271 -SDDPSIRRFLGVDPS--LAESIGLDPKWAYTIIKTVGNYGEIFDRHL---KPLGWERGY 324

Query: 327 NALWSKGGLMYAPPIR 342
           N LW++GGL+Y+PP R
Sbjct: 325 NRLWTQGGLLYSPPFR 340


>gi|192291277|ref|YP_001991882.1| extracellular solute-binding protein family 3 [Rhodopseudomonas
           palustris TIE-1]
 gi|192285026|gb|ACF01407.1| extracellular solute-binding protein family 3 [Rhodopseudomonas
           palustris TIE-1]
          Length = 340

 Score =  281 bits (718), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 141/316 (44%), Positives = 197/316 (62%), Gaps = 7/316 (2%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           L  IK RG +K G+ T   G+    +NG W+GF VDF RAL+  +F DP K+Q+   + +
Sbjct: 32  LDRIKSRGVIKVGVGT-TPGYFAPDSNGRWQGFFVDFGRALAVTVFGDPDKVQFTSSSPQ 90

Query: 87  ERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGA 146
           +R  ALQS + D+L      T+ R   LG  F P  ++DGQG ++ K  G++S SQL GA
Sbjct: 91  QRLPALQSGEFDVLLSGVTVTITRAFKLGFHFGPTIFYDGQGILVRKDLGVTSASQLDGA 150

Query: 147 SICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKL 206
           +I +Q+GTT EL +ADYF+ H  K+ P+  E   E  AA  + R D  T D S L A + 
Sbjct: 151 TIGIQSGTTGELNIADYFRKHRHKFTPVTIEDTSEFIAALDSGRVDGLTQDASDLAAKQT 210

Query: 207 TNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSK 266
              +P ++VILP+ +SK PLAPA+  GD  W  IV+WT  A + AEE GIT KN++   K
Sbjct: 211 QLKKPGDYVILPERLSKEPLAPAVAGGDDRWLEIVTWTVNATIQAEEWGITSKNVDDFLK 270

Query: 267 DTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGY 326
            + +P ++RFLG+D S  + E++GL   W Y II+ +GNYGE+FDR+L     L   RGY
Sbjct: 271 -SDDPSIRRFLGVDPS--LAESIGLDPKWAYTIIKTVGNYGEIFDRHL---KPLGWERGY 324

Query: 327 NALWSKGGLMYAPPIR 342
           N LW++GGL+Y+PP R
Sbjct: 325 NRLWTQGGLLYSPPFR 340


>gi|222102263|ref|YP_002546853.1| polar amino acid ABC transport substrate-binding protein, aapJ-2
           [Agrobacterium radiobacter K84]
 gi|221728380|gb|ACM31389.1| polar amino acid ABC transport substrate-binding protein, aapJ-2
           [Agrobacterium radiobacter K84]
          Length = 347

 Score =  280 bits (716), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 136/319 (42%), Positives = 202/319 (63%), Gaps = 4/319 (1%)

Query: 24  ASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPL 83
            S L  IK+RG +K G+ T   GF    ++G W+GF VDF RAL+  IF++P K+++   
Sbjct: 33  GSTLDKIKERGVIKVGVGT-TPGFFTPDSSGRWQGFFVDFGRALAVTIFNNPDKVEFTNS 91

Query: 84  NAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQL 143
           + ++R  ALQ+ + DIL      T+ R   LG  F P+ ++DGQG ++ K  G++  + L
Sbjct: 92  SPQQRLPALQAGEFDILLSGVTETITRAFKLGFHFGPVVFYDGQGLLVRKDLGVTKGADL 151

Query: 144 SGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYA 203
            GA+I +Q+GTT EL +AD+F+    K+ P+  E   E   A  + R DA T D + L A
Sbjct: 152 DGATIGIQSGTTGELNIADFFRKTGKKFTPVTIEETAEFTKALDSGRVDALTQDSTDLAA 211

Query: 204 LKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQ 263
            +    +P ++V+LP+ +SK PLAPAI  GD +W  IV+WT YA + AEE GIT+ N++ 
Sbjct: 212 KRTQLKKPDDYVLLPERLSKEPLAPAIRAGDDQWLEIVNWTIYATIQAEEFGITKDNVDT 271

Query: 264 VSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIP 323
             K + +P +QRFLG+D S  +G+A+GL   + Y II+ +GNYGE+F+RN+G  + L   
Sbjct: 272 FLK-SDDPAIQRFLGVDPS--LGQAIGLDPKFAYNIIKAVGNYGEIFERNVGKGTPLNFD 328

Query: 324 RGYNALWSKGGLMYAPPIR 342
           RG N LW+KGGL+Y+PP R
Sbjct: 329 RGLNQLWTKGGLIYSPPFR 347


>gi|221370067|ref|YP_002521163.1| Extracellular solute-binding protein, family 3 precursor
           [Rhodobacter sphaeroides KD131]
 gi|221163119|gb|ACM04090.1| Extracellular solute-binding protein, family 3 precursor
           [Rhodobacter sphaeroides KD131]
          Length = 335

 Score =  280 bits (715), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 129/324 (39%), Positives = 206/324 (63%), Gaps = 4/324 (1%)

Query: 20  FSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQ 79
           F+ +   L  +K+RG + CG++    GFA   + G W GF+VDFC A+++A+F D +K++
Sbjct: 15  FAQSGDTLAAVKERGEVLCGVHPARHGFAAPDSQGKWSGFEVDFCHAIAAAVFGDANKVR 74

Query: 80  YLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISS 139
           ++ L++++RF A+QS ++D+L+RN   TL R+ +LGL F P  ++ G GF++    GI  
Sbjct: 75  FVALSSQQRFPAIQSGEVDVLARNVTATLSRDTALGLNFAPPIFYTGTGFLVRAADGIEK 134

Query: 140 VSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDIS 199
           V  L GA+IC+  G+TTE  +A  F A  + Y P+V E  +++  AY   RCDA T D +
Sbjct: 135 VEDLDGAAICMAPGSTTERNVAQIFAARGLSYTPVVIENNKQLVDAYVTGRCDALTKDKA 194

Query: 200 ALYALK-LTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQ 258
           AL  ++    + P +HV+LP I SK PLA A+ QGD +WY++V W  YA   AEELG+TQ
Sbjct: 195 ALPGVRAFDTEVPGDHVLLPGIYSKEPLAMAVRQGDDKWYDLVKWVTYATFNAEELGVTQ 254

Query: 259 KNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQS 318
            N++++ K + +PD+Q  LG+    + G  LG+  DW Y I++ +GNY +++ R+ G  +
Sbjct: 255 ANVDEM-KASDDPDIQTLLGV--IGDNGTKLGVPNDWAYAIVKQVGNYEDIYMRHFGPDT 311

Query: 319 ELKIPRGYNALWSKGGLMYAPPIR 342
            + + R  N LW++GGL+Y  P+ 
Sbjct: 312 PVALDRDQNQLWTEGGLLYGFPMH 335


>gi|186470673|ref|YP_001861991.1| extracellular solute-binding protein [Burkholderia phymatum STM815]
 gi|184196982|gb|ACC74945.1| extracellular solute-binding protein family 3 [Burkholderia
           phymatum STM815]
          Length = 345

 Score =  280 bits (715), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 139/323 (43%), Positives = 200/323 (61%), Gaps = 7/323 (2%)

Query: 21  STNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQY 80
           +  +  L  IK RG L+CGI+ G+ GF+     G + G D DFCRA+++A+  DP+K+ +
Sbjct: 29  AAGSETLAHIKARGTLRCGISEGIAGFSAADGAGHFSGIDADFCRAVAAAVLGDPNKVTF 88

Query: 81  LPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSV 140
           +PL A  RF AL++ +ID+L+RNT WTLLRE +LG+ F  I ++D Q F++ +K G +S 
Sbjct: 89  VPLKASARFPALRTDRIDLLARNTTWTLLREGTLGIQFAGILFYDAQAFMVSRKNGTAS- 147

Query: 141 SQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISA 200
           S L+GA++CVQ  TT+E  L  Y  A+++   P+V   V E+  A+ + RC A T D S 
Sbjct: 148 SSLNGATVCVQQDTTSERNLMGYASANSLNVKPLVVGSVPELAQAFFSGRCSAATADASL 207

Query: 201 LYALKLTNDRPSEHV-ILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQK 259
           L  LK      +  V ILP+ +SK PL PA+   D  W  +V W  + ++TAEELG+T++
Sbjct: 208 LSVLKSRAPGGASTVEILPERLSKQPLGPAVRGDDDAWLVVVRWVLFTLITAEELGVTRE 267

Query: 260 NINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSE 319
           N     +D   P V R L  D  + +   LG+   WT R ++  GNYGEMF+RNLG  S 
Sbjct: 268 NYAARVRD---PLVARALVPD--ATVTATLGIEPGWTLRALQSAGNYGEMFERNLGAGSP 322

Query: 320 LKIPRGYNALWSKGGLMYAPPIR 342
           L + RG N LW+ GGLMYAPP++
Sbjct: 323 LGLERGLNNLWTHGGLMYAPPMQ 345


>gi|126464337|ref|YP_001045450.1| extracellular solute-binding protein [Rhodobacter sphaeroides ATCC
           17029]
 gi|126106148|gb|ABN78678.1| extracellular solute-binding protein, family 3 [Rhodobacter
           sphaeroides ATCC 17029]
          Length = 345

 Score =  280 bits (715), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 129/324 (39%), Positives = 206/324 (63%), Gaps = 4/324 (1%)

Query: 20  FSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQ 79
           F+ +   L  +K+RG + CG++    GFA   + G W GF+VDFC A+++A+F D +K++
Sbjct: 25  FAQSGDTLAAVKERGEVLCGVHPARHGFAAPDSQGKWSGFEVDFCHAIAAAVFGDANKVR 84

Query: 80  YLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISS 139
           ++ L++++RF A+QS ++D+L+RN   TL R+ +LGL F P  ++ G GF++    GI  
Sbjct: 85  FVALSSQQRFPAIQSGEVDVLARNVTATLSRDTALGLNFAPPIFYTGTGFLVRAADGIEK 144

Query: 140 VSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDIS 199
           V  L GA+IC+  G+TTE  +A  F A  + Y P+V E  +++  AY   RCDA T D +
Sbjct: 145 VEDLDGAAICMAPGSTTERNVAQIFAARGLSYTPVVIENNKQLVDAYVTGRCDALTKDKA 204

Query: 200 ALYALK-LTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQ 258
           AL  ++    + P +HV+LP I SK PLA A+ QGD +WY++V W  YA   AEELG+TQ
Sbjct: 205 ALPGVRAFDTEVPGDHVLLPGIYSKEPLAMAVRQGDDKWYDLVKWVTYATFNAEELGVTQ 264

Query: 259 KNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQS 318
            N++++ K + +PD+Q  LG+    + G  LG+  DW Y I++ +GNY +++ R+ G  +
Sbjct: 265 ANVDEM-KASDDPDIQTLLGV--IGDNGTKLGVPNDWAYAIVKQVGNYEDIYMRHFGPDT 321

Query: 319 ELKIPRGYNALWSKGGLMYAPPIR 342
            + + R  N LW++GGL+Y  P+ 
Sbjct: 322 PVALDRDQNQLWTEGGLLYGFPMH 345


>gi|87302592|ref|ZP_01085409.1| polar amino acid transport system substrate-binding proetin
           [Synechococcus sp. WH 5701]
 gi|87282936|gb|EAQ74893.1| polar amino acid transport system substrate-binding proetin
           [Synechococcus sp. WH 5701]
          Length = 405

 Score =  278 bits (711), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 135/322 (41%), Positives = 205/322 (63%), Gaps = 8/322 (2%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           L  I+ R  L CG++  L GF+ +  +G + G D D CRA+++A+  DPSK++Y  LN+ 
Sbjct: 86  LSTIRGRDKLVCGVDGKLPGFSFLGPDGTYSGLDADTCRAVAAAVLGDPSKVEYRDLNSS 145

Query: 87  ERFLALQSKQIDILSRNTDWTLLREISLG--LAFRPITYFDGQGFIMHKKKGISSVSQLS 144
           ERF AL S ++D+L+RNT  TL R+ + G  ++F P T++DGQG ++    G  ++  L 
Sbjct: 146 ERFAALASGEVDMLARNTTMTLSRDSAGGNGISFGPTTFYDGQGVMVPVASGARTLKDLD 205

Query: 145 GASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYAL 204
           G  ICV++GTTTEL LAD  +   + Y P+ F+  ++  AAY   RC A T D S L A 
Sbjct: 206 GKPICVESGTTTELNLADRMREQGIAYTPLKFQTGDQTYAAYLGGRCVAVTSDRSQLAAK 265

Query: 205 KLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKN---- 260
           + +  +P EH++LP+++SK PL PA + GD  W + + WT +A+  AEELGIT+ N    
Sbjct: 266 RSSFPKPDEHILLPEVMSKEPLTPASVNGDPAWADALRWTVFALFQAEELGITKANVAAK 325

Query: 261 INQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSEL 320
           + +   +T   D++RFLG++   + G+ LGL  D+  + I  +GNYGE+F+RN+G  S L
Sbjct: 326 VAEAKANTNQADLRRFLGVE--GDFGKQLGLPADFVAKTIAAVGNYGEIFERNVGTGSPL 383

Query: 321 KIPRGYNALWSKGGLMYAPPIR 342
           K+ R  N LW++GGL+Y+PP R
Sbjct: 384 KLERAENRLWTQGGLIYSPPFR 405


>gi|124026134|ref|YP_001015250.1| extracellular solute-binding protein [Prochlorococcus marinus str.
           NATL1A]
 gi|123961202|gb|ABM75985.1| extracellular solute-binding protein, family 3 [Prochlorococcus
           marinus str. NATL1A]
          Length = 353

 Score =  278 bits (710), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 141/331 (42%), Positives = 213/331 (64%), Gaps = 12/331 (3%)

Query: 18  TSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSK 77
           T+   N+S L  IK R  L CG++  + GF+ +K++G ++G DVD C+A ++AI  D  K
Sbjct: 25  TTNQDNSSRLNLIKNRNELICGVSGKIPGFSFLKSDGTYQGLDVDICKAFAAAIIGDSEK 84

Query: 78  IQYLPLNAKERFLALQSKQIDILSRNTDWTLLREIS--LGLAFRPITYFDGQGFIMHKKK 135
           IQY PL A ERF A+++ +ID+LSRNT +TL R+ S   GL F P+ + DGQG ++ K+ 
Sbjct: 85  IQYRPLTAAERFTAIKTGEIDLLSRNTTFTLSRDSSGGNGLTFAPVVFHDGQGLMVKKES 144

Query: 136 GISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYT 195
            IS +  L+  SICV +GTTTE  + D F++ ++ Y PI ++ + ++ A Y   RC A T
Sbjct: 145 KISGLKDLANKSICVGSGTTTEQNINDAFESASLPYTPIKYQDLNQVVAGYLQGRCSAMT 204

Query: 196 GDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELG 255
            D S L A +     P EH+IL D++SK PLAPA    D +  + + W  +++++AEE G
Sbjct: 205 SDRSQLAAARSGFKNPKEHIILEDVLSKEPLAPASDGQDQKLADAMRWVVFSLISAEEQG 264

Query: 256 ITQKNIN---QVSKDTTNPDVQ---RFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEM 309
           IT+ NI+   Q++K+  NP ++   RFLGID    +GE +GL+ D+  ++I   GNYGE+
Sbjct: 265 ITKSNIDKKVQIAKN--NPQLKPLRRFLGID--GGLGEKIGLSNDFVVKVISSTGNYGEI 320

Query: 310 FDRNLGNQSELKIPRGYNALWSKGGLMYAPP 340
           ++R+LG  SE+ IPRG N L+ KGG+  +PP
Sbjct: 321 YERHLGQNSEVPIPRGQNELYKKGGVHISPP 351


>gi|72382453|ref|YP_291808.1| extracellular solute-binding protein [Prochlorococcus marinus str.
           NATL2A]
 gi|72002303|gb|AAZ58105.1| amino acid ABC transporter substrate-binding protein, PAAT family
           [Prochlorococcus marinus str. NATL2A]
          Length = 353

 Score =  278 bits (710), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 141/331 (42%), Positives = 213/331 (64%), Gaps = 12/331 (3%)

Query: 18  TSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSK 77
           T+   N+S L  IK R  L CG++  + GF+ +K++G ++G DVD C+A ++AI  D  K
Sbjct: 25  TTNQDNSSRLNLIKNRNELICGVSGKIPGFSFLKSDGTYQGLDVDICKAFAAAIIGDSEK 84

Query: 78  IQYLPLNAKERFLALQSKQIDILSRNTDWTLLREIS--LGLAFRPITYFDGQGFIMHKKK 135
           IQY PL A ERF A+++ +ID+LSRNT +TL R+ S   GL F P+ + DGQG ++ K+ 
Sbjct: 85  IQYRPLTAAERFTAIKTGEIDLLSRNTTFTLSRDSSGGNGLTFAPVVFHDGQGLMVKKES 144

Query: 136 GISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYT 195
            IS +  L+  SICV +GTTTE  + D F++ ++ Y PI ++ + ++ A Y   RC A T
Sbjct: 145 KISGLKDLANKSICVGSGTTTEQNINDAFESASLPYTPIKYQDLNQVVAGYLQGRCSAMT 204

Query: 196 GDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELG 255
            D S L A +     P EH+IL D++SK PLAPA    D +  + + W  +++++AEE G
Sbjct: 205 SDRSQLAAARSGFKNPQEHIILDDVLSKEPLAPASDGQDQKLADAMRWVVFSLISAEEQG 264

Query: 256 ITQKNIN---QVSKDTTNPDVQ---RFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEM 309
           IT+ NI+   Q++K+  NP ++   RFLGID    +GE +GL+ D+  ++I   GNYGE+
Sbjct: 265 ITKSNIDKKVQIAKN--NPQLKPLRRFLGID--GGLGEKIGLSNDFVVKVISSTGNYGEI 320

Query: 310 FDRNLGNQSELKIPRGYNALWSKGGLMYAPP 340
           ++R+LG  SE+ IPRG N L+ KGG+  +PP
Sbjct: 321 YERHLGQNSEVPIPRGQNELYKKGGVHISPP 351


>gi|113953701|ref|YP_730400.1| polar amino acid ABC transporter periplasmic amino acid-binding
           protein [Synechococcus sp. CC9311]
 gi|113881052|gb|ABI46010.1| polar amino amino acid ABC transporter (PAAT) family, periplasmic
           amino acid-binding protein [Synechococcus sp. CC9311]
          Length = 381

 Score =  277 bits (709), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 137/354 (38%), Positives = 219/354 (61%), Gaps = 16/354 (4%)

Query: 3   KDFFVSILCLIILFFTSFSTNASILGD--------IKKRGFLKCGINTGLVGFAEVKANG 54
           K   V +L L ++ F       + LG+        IK+R  L+CG++  + GF+ ++ +G
Sbjct: 30  KQMRVHLLALPLVSFLFILNGCATLGEGGASRLDLIKRRAELRCGVSGKIPGFSFLRRDG 89

Query: 55  DWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREI-- 112
            + G DVD CRA ++A+   P ++QY  L A ERF AL++ +ID+LSRNT + L R+   
Sbjct: 90  SFAGLDVDICRAFAAALTGSPDQVQYRSLTAPERFTALRTGEIDLLSRNTTFNLSRDAVG 149

Query: 113 SLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYH 172
             G++F P+ + DGQG ++ ++ G+S ++ L G +ICV +GTTTE  L D F+A  + Y 
Sbjct: 150 GNGVSFAPVVFHDGQGLLVKRQSGVSDLNDLQGKTICVGSGTTTEQNLNDAFQARGIDYK 209

Query: 173 PIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQ 232
           PI ++ + ++ A Y   RC A T D S L A +   + P +HVILP+++SK PLAP    
Sbjct: 210 PIKYQDLNQVIAGYLQGRCSAMTSDRSQLAAARSGFNNPEQHVILPEVLSKEPLAPLAAG 269

Query: 233 GDTEWYNIVSWTHYAMVTAEELGITQKNI-NQVSKDTTNPD---VQRFLGIDKSSNIGEA 288
           GD    + + W  YA++ AEELGITQ+NI +++ +    P+   ++RFLG++    +GE 
Sbjct: 270 GDQRLADAMRWVIYALIAAEELGITQQNIGDKLEEAQRRPELTQLRRFLGVE--GELGEK 327

Query: 289 LGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           LGL  D+  ++I+ +GNYGE+++R+LG  S + IPRG N L+  GG++ +PP +
Sbjct: 328 LGLNNDFIVKVIQAVGNYGEIYNRHLGPDSAVPIPRGLNNLYRNGGVLTSPPFQ 381


>gi|78213330|ref|YP_382109.1| extracellular solute-binding protein [Synechococcus sp. CC9605]
 gi|78197789|gb|ABB35554.1| extracellular solute-binding protein, family 3 [Synechococcus sp.
           CC9605]
          Length = 353

 Score =  277 bits (708), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 141/326 (43%), Positives = 199/326 (61%), Gaps = 8/326 (2%)

Query: 21  STNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQY 80
           S   S L  +K RG L CG++  + GF+ +  +G + G DVD CRA+++A   D  K+QY
Sbjct: 28  SAAGSRLDLVKARGELLCGVSGKIPGFSFLNPDGRYTGLDVDICRAMAAAFVGDAEKVQY 87

Query: 81  LPLNAKERFLALQSKQIDILSRNTDWTLLREI--SLGLAFRPITYFDGQGFIMHKKKGIS 138
            PL A ERF AL+S +ID+LSRNT  TL R+     GL F P+ + DGQG +++   G+ 
Sbjct: 88  RPLTAPERFTALRSGEIDLLSRNTTHTLSRDAMGGNGLRFGPVVFHDGQGLMVNAASGVR 147

Query: 139 SVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDI 198
           S++ LSG SICV +GTTTE  L D F +  + Y PI ++ + ++   Y   RC+A T D 
Sbjct: 148 SLADLSGKSICVGSGTTTEQNLNDAFASQGLPYTPIKYQDLNQVVGGYLQGRCEAMTSDR 207

Query: 199 SALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQ 258
           S L A +     P  H IL D ISK PLAPA++ GD    + ++W   A++ AEE GITQ
Sbjct: 208 SQLAAARSGFSDPQAHQILDDRISKEPLAPAVVGGDQPMGDAMTWVVNALIEAEERGITQ 267

Query: 259 KNINQVSK----DTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNL 314
            N++ V K    D +   ++RFLG+D    +G  LGL  D+  ++IR  GNYGE+++R+L
Sbjct: 268 ANVDAVVKQAAADPSQTSLRRFLGVDP--GLGRKLGLADDFVVQVIRATGNYGEIYNRHL 325

Query: 315 GNQSELKIPRGYNALWSKGGLMYAPP 340
           G  S + IPRG N L  +GGLM +PP
Sbjct: 326 GLDSAVAIPRGANRLAGEGGLMISPP 351


>gi|33865374|ref|NP_896933.1| ABC transporter, substrate binding protein for amino acids
           [Synechococcus sp. WH 8102]
 gi|33632543|emb|CAE07355.1| ABC transporter, substrate binding protein for amino acids
           [Synechococcus sp. WH 8102]
          Length = 353

 Score =  276 bits (707), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 139/317 (43%), Positives = 194/317 (61%), Gaps = 8/317 (2%)

Query: 30  IKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERF 89
           +K+R  L CG++  + GF+ +   G + G DVD CRA+++A   D  K+QY PL A ERF
Sbjct: 37  VKQRDELLCGVSGKIPGFSFLTPKGTYTGLDVDICRAMAAAFLGDADKVQYRPLTAPERF 96

Query: 90  LALQSKQIDILSRNTDWTLLR--EISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGAS 147
            AL+S +ID+LSRNT  TL R  E   GL F P+ + DGQG I+    G++S++ LSG +
Sbjct: 97  TALRSGEIDLLSRNTTHTLSRDAEGGNGLGFAPVVFHDGQGLIVPVNSGVTSLADLSGQA 156

Query: 148 ICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLT 207
           ICV +GTTTE  L D F +  + Y PI ++ + ++   Y   RC A T D S L A +  
Sbjct: 157 ICVGSGTTTEQNLNDAFASKGIPYTPIKYQDLNQVVGGYLQGRCQAMTSDRSQLAAARSG 216

Query: 208 NDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQ---- 263
              P  HVIL D +SK PLAPA++ GD    + ++W  YA++ AEE GITQ N+++    
Sbjct: 217 FIEPEGHVILEDRLSKEPLAPAVVGGDQRLVDAMTWVVYALIEAEERGITQANLDRQLRA 276

Query: 264 VSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIP 323
              D +   ++RFLG+D    +G  LGL  D+  + IR  GNYGE++DR+LG +S + IP
Sbjct: 277 AEADPSQAAMRRFLGVD--GGLGRKLGLPDDFVVQAIRATGNYGEIYDRHLGPESPVAIP 334

Query: 324 RGYNALWSKGGLMYAPP 340
           RG N L   GGLM APP
Sbjct: 335 RGANRLAEDGGLMIAPP 351


>gi|123966465|ref|YP_001011546.1| ABC transporter for amino acids, substrate binding protein
           [Prochlorococcus marinus str. MIT 9515]
 gi|123200831|gb|ABM72439.1| ABC transporter for amino acids, substrate binding protein
           [Prochlorococcus marinus str. MIT 9515]
          Length = 349

 Score =  276 bits (706), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 141/324 (43%), Positives = 207/324 (63%), Gaps = 8/324 (2%)

Query: 23  NASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLP 82
           N S L  I+KR  L CG++  + GF+ ++ +G +KG DVD C+A +SAI  D  KIQ+ P
Sbjct: 26  NISRLSLIQKRDELICGVSGKIPGFSFIERDGKYKGLDVDICKAFASAIIGDSEKIQFRP 85

Query: 83  LNAKERFLALQSKQIDILSRNTDWTLLREI--SLGLAFRPITYFDGQGFIMHKKKGISSV 140
           L A ERFLA+++  ID+LSRNT +TL R+     GL F P+ + DGQG ++ K  GI S+
Sbjct: 86  LTAAERFLAIKTGDIDLLSRNTTFTLSRDSFEGNGLTFAPVVFHDGQGLMVKKNSGIDSI 145

Query: 141 SQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISA 200
            +L+  SICV +GTTTE  + D F++ ++ Y PI ++ + ++ A Y   RC+A T D S 
Sbjct: 146 QELANKSICVGSGTTTEQNINDTFESLSLPYVPIKYQDLNQVVAGYLQGRCEAMTSDRSQ 205

Query: 201 LYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKN 260
           L A +       +H+IL +++SK PLAPA    + +  + + WT +A++ AEE GITQ N
Sbjct: 206 LAAARSGFKNAKDHIILDNVLSKEPLAPASNGSEQKLADAMRWTIFALIAAEEQGITQLN 265

Query: 261 I-NQVSKDTTNPDVQ---RFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGN 316
           I ++V     NP ++   RFLGID    +GE +GL  D+   +I+  GNYGE++DRNLG 
Sbjct: 266 IDDKVQLAKNNPQLKSLRRFLGID--GGLGEKIGLRNDFVVNVIKATGNYGEIYDRNLGK 323

Query: 317 QSELKIPRGYNALWSKGGLMYAPP 340
            S++ IPRG N ++SKGGL  +PP
Sbjct: 324 DSDVPIPRGLNKIYSKGGLHISPP 347


>gi|116072941|ref|ZP_01470203.1| ABC transporter for amino acids, substrate binding protein
           [Synechococcus sp. RS9916]
 gi|116068246|gb|EAU73998.1| ABC transporter for amino acids, substrate binding protein
           [Synechococcus sp. RS9916]
          Length = 349

 Score =  276 bits (706), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 138/325 (42%), Positives = 201/325 (61%), Gaps = 8/325 (2%)

Query: 24  ASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPL 83
           AS LG I++R  L+CG++  + GF+ ++ NG + G DVD C+A ++A   D + ++Y PL
Sbjct: 27  ASRLGLIQQRKSLRCGVSGKIPGFSFLRPNGSYSGLDVDLCKAFAAAFVGDATAVEYRPL 86

Query: 84  NAKERFLALQSKQIDILSRNTDWTLLREISLG--LAFRPITYFDGQGFIMHKKKGISSVS 141
            A ERF AL++ +ID+LSRNT + L R+ + G  ++F P+ + DGQG I+ K  GI  ++
Sbjct: 87  TAPERFTALRTGEIDLLSRNTTFNLSRDAAGGNGVSFAPVVFHDGQGLIVKKTSGIRQLT 146

Query: 142 QLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISAL 201
            L   SICV +GTTTE  L D  +A  + Y PI ++ + ++ A Y   RC A T D S L
Sbjct: 147 DLRNQSICVGSGTTTEQNLNDALEAQGIAYTPIKYQDLNQVVAGYLQDRCSAMTSDRSQL 206

Query: 202 YALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNI 261
            A +     P EHVIL  ++SK PLAP  + GD    + + W  YA++TAEELG+TQ N+
Sbjct: 207 AAARSGFANPQEHVILNAVLSKEPLAPLSVGGDQRLGDAMRWVVYALITAEELGLTQANV 266

Query: 262 NQ-VSKDTTNP---DVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQ 317
            + ++K   NP    ++RFLG+D    +G  LGL  D+  R+I   GNYGE+++R+LG  
Sbjct: 267 QERLAKAQNNPQMTQLRRFLGVD--GELGTKLGLAPDFVVRVIEATGNYGEIYNRHLGPD 324

Query: 318 SELKIPRGYNALWSKGGLMYAPPIR 342
           S + IPRG N L   GG M APP +
Sbjct: 325 SAVPIPRGLNQLHRDGGAMTAPPFQ 349


>gi|78184422|ref|YP_376857.1| extracellular solute-binding protein [Synechococcus sp. CC9902]
 gi|78168716|gb|ABB25813.1| extracellular solute-binding protein, family 3 [Synechococcus sp.
           CC9902]
          Length = 367

 Score =  276 bits (705), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 137/317 (43%), Positives = 198/317 (62%), Gaps = 8/317 (2%)

Query: 30  IKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERF 89
           ++ RG L CG++  + GF+ +   G + GFDVD C+A+++A   D +K+QY PL A ERF
Sbjct: 51  VQSRGELLCGVSGKIPGFSFLSPEGRYAGFDVDICKAMAAAFVGDSAKVQYRPLTAPERF 110

Query: 90  LALQSKQIDILSRNTDWTLLREISLG--LAFRPITYFDGQGFIMHKKKGISSVSQLSGAS 147
            AL+S +ID+LSRNT  TL R+ + G  L+F P  + DGQG ++    G+ S++ LSG +
Sbjct: 111 TALRSGEIDLLSRNTTHTLSRDAAGGNGLSFAPTVFHDGQGLMVSVGSGVRSIADLSGKA 170

Query: 148 ICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLT 207
           ICV +GTTTE  L D F A  + Y PI ++ + ++   Y   RC A T D S L + +  
Sbjct: 171 ICVGSGTTTEQNLNDAFAAQGLPYTPIKYQDLNQVVGGYLQGRCAAMTSDRSQLASARSG 230

Query: 208 NDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSK- 266
              P +HVIL D +SK PLAPA++ GD    +  +W  YA++ AEE GITQ N++ V + 
Sbjct: 231 FKDPQQHVILEDRLSKEPLAPAVVGGDQRMADATNWVVYALIEAEERGITQANLDDVLER 290

Query: 267 ---DTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIP 323
              D +   ++RFLG+D    +G  LGL  D+  ++IR  GNYGE+++R+LG  S + IP
Sbjct: 291 AVADPSQAALRRFLGVD--GGLGAKLGLPDDFVVQVIRATGNYGEIYNRHLGPGSAVTIP 348

Query: 324 RGYNALWSKGGLMYAPP 340
           RG N L  +GGLM APP
Sbjct: 349 RGPNRLGVEGGLMIAPP 365


>gi|124022922|ref|YP_001017229.1| amino acid ABC transporter substrate-binding protein
           [Prochlorococcus marinus str. MIT 9303]
 gi|123963208|gb|ABM77964.1| ABC transporter for amino acids, substrate binding protein
           [Prochlorococcus marinus str. MIT 9303]
          Length = 349

 Score =  275 bits (704), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 140/349 (40%), Positives = 213/349 (61%), Gaps = 11/349 (3%)

Query: 1   MYKDFFVSILCLIILFFTSFSTN---ASILGDIKKRGFLKCGINTGLVGFAEVKANGDWK 57
           M + F   ++ L +L     S +    S L  I KRG L CG++  + GF+ +  NG ++
Sbjct: 1   MIRRFATGLVTLSLLATGCASIDQGGGSRLELISKRGQLHCGVSGKIPGFSFLLGNGRYE 60

Query: 58  GFDVDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLG-- 115
           G DVD CRA+++A+  D +K+QY PL A ERF AL++ +ID+LSRNT   L R+ + G  
Sbjct: 61  GLDVDICRAMAAAVVGDATKVQYRPLTAPERFTALKTGEIDLLSRNTTLNLSRDAAGGNG 120

Query: 116 LAFRPITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIV 175
           L F P+ + DGQG ++ +  GI  +  L  ++ICV +GTTTE  L D F+   + Y PI 
Sbjct: 121 LTFAPVVFHDGQGLMVKRSTGIKGLQDLKASNICVGSGTTTEQNLNDAFQERKLSYTPIK 180

Query: 176 FERVEEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDT 235
           ++ + ++ A Y   RC A T D S L A +     P +H+IL  ++SK PLAPA + GD 
Sbjct: 181 YQDLNQVVAGYLQGRCLAMTSDRSQLAAARSGFPDPEQHIILDVVLSKEPLAPASVGGDQ 240

Query: 236 EWYNIVSWTHYAMVTAEELGITQKNIN-QVSKDTTNPD---VQRFLGIDKSSNIGEALGL 291
              + + W  +A+  AEE GITQ+N++ ++ +  TNP    ++RFLG+D  + +G+ LGL
Sbjct: 241 RLGDAIRWVVFALFAAEEFGITQENVDSKLQQAKTNPQMSSLRRFLGVD--AGLGQKLGL 298

Query: 292 TKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPP 340
             D+  ++IR  GNYGE+++R+LG  S + IPRG N  + +GGL+ APP
Sbjct: 299 ADDFVVKVIRATGNYGEIYNRHLGPNSSVPIPRGLNRSYRQGGLLIAPP 347


>gi|297567745|ref|YP_003686716.1| hypothetical protein Mesil_3397 [Meiothermus silvanus DSM 9946]
 gi|296852194|gb|ADH65208.1| hypothetical protein Mesil_3397 [Meiothermus silvanus DSM 9946]
          Length = 345

 Score =  275 bits (703), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 140/322 (43%), Positives = 209/322 (64%), Gaps = 8/322 (2%)

Query: 25  SILGDIKKRGFLKCGINTGLVGFAEV-KANGDWKGFDVDFCRALSSAIFDDPSKIQYLPL 83
           S L  +K RG L CG+N  L GF  + +  G   GFDVDFCRA+++A+FDDP K++Y+PL
Sbjct: 28  SRLDVVKGRGKLVCGVNARLPGFGFLDEKTGKATGFDVDFCRAVAAALFDDPEKVEYVPL 87

Query: 84  NAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQL 143
           +A+ RF A+Q+ ++D+  RNT  T  R+ ++G+ F P+T++DGQG +M KK   SS+ +L
Sbjct: 88  DARVRFQAVQNGEVDVAFRNTTVTSSRDGAVGVDFLPVTFYDGQG-VMVKKGKASSLREL 146

Query: 144 SGASICVQAGTTTELTLADYFKAHNMK-YHPIVFERVEEIDAAYRAHRCDAYTGDISALY 202
            GA+ C   GTT E  ++DY ++   +    + FE  +++ AA    RCDA+T D S L 
Sbjct: 147 EGATFCTTQGTTNEKNISDYIRSRRWRNTRLLTFEDGQKVFAALLEGRCDAFTADKSQLV 206

Query: 203 ALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNIN 262
             + T   P + +IL + ISK PLA  + + D+ W + ++W  YA + AEE GIT KN++
Sbjct: 207 GYRGTASNPDDLLILRETISKEPLAGMVRENDSRWRDALTWIVYATIQAEEFGITVKNLD 266

Query: 263 QVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKI 322
           Q +K    P+V+RFLG++    +G+ LGL  D+  RI+RH+GNYGE++DR  G +S   I
Sbjct: 267 QQTKSDV-PEVRRFLGLE--GTLGKDLGLPPDFAVRIVRHVGNYGEIYDRYFGPKSAFAI 323

Query: 323 PRG--YNALWSKGGLMYAPPIR 342
           PR    NAL++KGGL+Y+PP R
Sbjct: 324 PRAGTLNALYNKGGLLYSPPFR 345


>gi|218516840|ref|ZP_03513680.1| general L-amino acid ABC transporter, substrate-binding protein
           [Rhizobium etli 8C-3]
          Length = 211

 Score =  275 bits (703), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 118/205 (57%), Positives = 165/205 (80%)

Query: 21  STNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQY 80
           + +A+ LGD+K +GF++CG+NTGL GFA   A+G+W GFDVDFC+A++SA+F DP+K+++
Sbjct: 7   AASATTLGDVKAKGFVQCGVNTGLAGFAAPDASGNWAGFDVDFCKAVASAVFGDPTKVKF 66

Query: 81  LPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSV 140
            PL+A  RF ALQS +ID+L+RNT W++ R+ +LGL FR + Y+DGQGF++ K   + S 
Sbjct: 67  TPLSAANRFPALQSGEIDVLARNTTWSINRDTALGLNFRFVNYYDGQGFMVRKSLNVKSA 126

Query: 141 SQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISA 200
            +LSGAS+CVQ+GTTTEL LADYFKA+N++Y+P+VFE+++E++AAY A RCD YT D S 
Sbjct: 127 LELSGASVCVQSGTTTELNLADYFKANNLQYNPVVFEKLDEVNAAYDAGRCDVYTTDQSG 186

Query: 201 LYALKLTNDRPSEHVILPDIISKSP 225
           LY+L+LT   P EH ILP+IISK P
Sbjct: 187 LYSLRLTLKNPDEHAILPEIISKEP 211


>gi|33240126|ref|NP_875068.1| amino acid ABC transporter periplasmic protein [Prochlorococcus
           marinus subsp. marinus str. CCMP1375]
 gi|33237653|gb|AAP99720.1| ABC-type amino acid transport/signal transduction systems,
           periplasmic component/domain [Prochlorococcus marinus
           subsp. marinus str. CCMP1375]
          Length = 350

 Score =  274 bits (700), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 141/349 (40%), Positives = 220/349 (63%), Gaps = 15/349 (4%)

Query: 3   KDFFVSILCLIILFFTSFST---NASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGF 59
           K FF  ++ L IL     ST   NAS L  IKKR  L CG++  + GF+ ++ +G ++G 
Sbjct: 4   KRFFSGMMTLSILLTGCASTGERNASRLQLIKKRNSLICGVSGKIPGFSFLETDGTYQGL 63

Query: 60  DVDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREI--SLGLA 117
           D+D C+A ++A   D  ++QY PL A ERF A+++ +ID+LSRNT + L R+     GL 
Sbjct: 64  DIDICKAFAAAFIGDSKRVQYRPLTAAERFTAVRTGEIDLLSRNTTFNLSRDSIGGNGLT 123

Query: 118 FRPITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFE 177
           F P+ + DGQG ++ +   I+++  L+  SICV +GTTTE  + D F+A ++ Y PI ++
Sbjct: 124 FAPVIFHDGQGLMVKRNSRINTIESLANKSICVGSGTTTEQNINDAFEAISLPYTPIKYQ 183

Query: 178 RVEEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEW 237
            + ++ A Y   RC A T D S L A +    +P +H+IL DI+SK PLAPA   GD + 
Sbjct: 184 DLNQVVAGYLQGRCSAMTSDRSQLAAARSGFPKPEDHIILNDILSKEPLAPASSGGDQKL 243

Query: 238 YNIVSWTHYAMVTAEELGITQKNIN---QVSKDTTNPDVQ---RFLGIDKSSNIGEALGL 291
            + + W  +++++AEE GIT+ NI    Q++++  NP ++   RFLG++   ++GE +GL
Sbjct: 244 SDAMRWVIFSLISAEEQGITKGNIKEKLQIAQN--NPQMKSLRRFLGVE--GDLGEKIGL 299

Query: 292 TKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPP 340
             D+  ++I   GNYGE+++R+LG  SE+ IPRG N L++KGG+  APP
Sbjct: 300 ANDFVVKVISSTGNYGEIYNRHLGINSEVPIPRGLNKLYNKGGVQIAPP 348


>gi|33863169|ref|NP_894729.1| ABC transporter for amino acids, substrate binding protein
           [Prochlorococcus marinus str. MIT 9313]
 gi|33635086|emb|CAE21072.1| ABC transporter for amino acids, substrate binding protein
           [Prochlorococcus marinus str. MIT 9313]
          Length = 349

 Score =  273 bits (699), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 133/317 (41%), Positives = 200/317 (63%), Gaps = 8/317 (2%)

Query: 30  IKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERF 89
           I KRG L CG++  + GF+ +  NG ++G DVD CRA+++A   D +K+QY PL A ERF
Sbjct: 33  ISKRGQLNCGVSGKIPGFSFLLGNGRYEGLDVDICRAMAAAFIGDATKVQYRPLTAPERF 92

Query: 90  LALQSKQIDILSRNTDWTLLREISLG--LAFRPITYFDGQGFIMHKKKGISSVSQLSGAS 147
            AL++ +ID+LSRNT   L R+ + G  L F P+ + DGQG ++ +  GI  +  L  ++
Sbjct: 93  TALKTGEIDLLSRNTTLNLSRDAAGGNGLTFAPVVFHDGQGLMVKRSSGIKGLQDLKASN 152

Query: 148 ICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLT 207
           ICV +GTTTE  L D F+   + Y PI ++ + ++ A Y   RC A T D S L A +  
Sbjct: 153 ICVGSGTTTEQNLNDAFQERKLSYTPIKYQDLNQVVAGYLQGRCLAMTSDRSQLAAARSG 212

Query: 208 NDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNIN-QVSK 266
              P +H+IL  ++SK PLAPA + GD    + + W  +A+  AEE GITQ+N++ ++ +
Sbjct: 213 FPDPEQHIILDVVLSKEPLAPASVGGDQRLGDAIRWVVFALFAAEEFGITQENVDSKLEQ 272

Query: 267 DTTNPD---VQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIP 323
             TNP    ++RFLG+D  + +G+ LGL  D+  ++IR  GNYGE+++R+LG  S + IP
Sbjct: 273 AQTNPQMSSLRRFLGVD--AGLGQKLGLVDDFVVKVIRATGNYGEIYNRHLGPNSSVPIP 330

Query: 324 RGYNALWSKGGLMYAPP 340
           RG N  + +GGL+ APP
Sbjct: 331 RGRNRSYRQGGLLIAPP 347


>gi|260434256|ref|ZP_05788226.1| general L-amino acid-binding periplasmic protein AapJ
           [Synechococcus sp. WH 8109]
 gi|260412130|gb|EEX05426.1| general L-amino acid-binding periplasmic protein AapJ
           [Synechococcus sp. WH 8109]
          Length = 368

 Score =  273 bits (697), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 139/326 (42%), Positives = 199/326 (61%), Gaps = 8/326 (2%)

Query: 21  STNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQY 80
           S   S L  +K RG L CG++  + GF+ + ++G + G DVD CRA+++A   D  K+QY
Sbjct: 43  SAAGSRLDLVKARGELLCGVSGKIPGFSFLSSDGRYTGLDVDICRAMAAAFVGDAEKVQY 102

Query: 81  LPLNAKERFLALQSKQIDILSRNTDWTLLREI--SLGLAFRPITYFDGQGFIMHKKKGIS 138
            PL A ERF AL+S +ID+LSRNT  TL R+     GL F P+ + DGQG +++   G+ 
Sbjct: 103 RPLTAPERFTALRSGEIDLLSRNTTHTLSRDAVGGNGLRFGPVVFHDGQGLMVNAASGVR 162

Query: 139 SVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDI 198
           S++ LSG SICV +GTTTE  L D F +  + Y PI ++ + ++   Y   RC A T D 
Sbjct: 163 SLADLSGKSICVGSGTTTEQNLNDAFASKGLPYIPIKYQDLNQVVGGYLQGRCAAMTSDR 222

Query: 199 SALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQ 258
           S L A +     P  H IL D ISK PL+PA++ GD    + ++W    ++ AEE GITQ
Sbjct: 223 SQLAAARSGFSDPEAHQILDDRISKEPLSPAVVGGDQPMGDAMTWVINGLIEAEERGITQ 282

Query: 259 KNINQVSK----DTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNL 314
            N++ V K    D++   ++RFLG+D    +G  LGL  D+  ++IR  GNYGE+++R+L
Sbjct: 283 ANVDAVVKQAAADSSQTALRRFLGVDP--GLGRKLGLADDFVVQVIRATGNYGEIYNRHL 340

Query: 315 GNQSELKIPRGYNALWSKGGLMYAPP 340
           G  S + IPRG N L  +GGLM +PP
Sbjct: 341 GPDSAVAIPRGANRLAGEGGLMISPP 366


>gi|78779551|ref|YP_397663.1| extracellular solute-binding protein [Prochlorococcus marinus str.
           MIT 9312]
 gi|78713050|gb|ABB50227.1| amino acid ABC transporter substrate-binding protein, PAAT family
           [Prochlorococcus marinus str. MIT 9312]
          Length = 349

 Score =  272 bits (695), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 138/324 (42%), Positives = 205/324 (63%), Gaps = 8/324 (2%)

Query: 23  NASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLP 82
           N S L  I++R  L CG++  + GF+ ++ +G +KG DVD C+A ++AI  D  KIQ+ P
Sbjct: 26  NISRLSLIQERDELICGVSGKIPGFSFIERDGSYKGLDVDICKAFAAAIIGDSEKIQFRP 85

Query: 83  LNAKERFLALQSKQIDILSRNTDWTLLREI--SLGLAFRPITYFDGQGFIMHKKKGISSV 140
           L A ERFLA+++  ID+LSRNT  TL R+     GL F P+ + DGQG ++ K  GI S+
Sbjct: 86  LTAAERFLAIKTGDIDLLSRNTTLTLSRDSFGGNGLTFAPVVFHDGQGLMVKKNSGIESI 145

Query: 141 SQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISA 200
            +L+  SICV +GTTTE  + D F++ ++ Y PI ++ + ++ A Y   RC A T D S 
Sbjct: 146 QELANKSICVGSGTTTEQNINDTFESLSLPYVPIKYQDLNQVVAGYLQGRCQAMTSDRSQ 205

Query: 201 LYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKN 260
           L A +       +H+IL D++SK PLAPA    + +  + + WT +A++ AEE GITQ N
Sbjct: 206 LAAARSGFKNAKDHIILDDVLSKEPLAPASDGSEQKLADAMRWTVFALIAAEEQGITQSN 265

Query: 261 I-NQVSKDTTNPDVQ---RFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGN 316
           I +++     NP ++   RFLG+D    +GE +GL  D+   +I+  GNYGE++DRNLG 
Sbjct: 266 IADRLQLAKNNPQLKSLRRFLGVD--GGLGEKIGLRNDFVVNVIKATGNYGEIYDRNLGI 323

Query: 317 QSELKIPRGYNALWSKGGLMYAPP 340
            S++ IPRG N ++SKGGL  +PP
Sbjct: 324 DSDVPIPRGLNEIYSKGGLHISPP 347


>gi|170690235|ref|ZP_02881402.1| extracellular solute-binding protein family 3 [Burkholderia
           graminis C4D1M]
 gi|170144670|gb|EDT12831.1| extracellular solute-binding protein family 3 [Burkholderia
           graminis C4D1M]
          Length = 345

 Score =  271 bits (694), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 136/325 (41%), Positives = 189/325 (58%), Gaps = 6/325 (1%)

Query: 19  SFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKI 78
           S + +   L  +K RG L+CG++ G+ GF+   A G W G DVDFCRAL++A   D  K+
Sbjct: 26  SNAADGEALASVKTRGVLRCGVSEGVAGFSSQDAAGQWSGIDVDFCRALAAAALGDSRKV 85

Query: 79  QYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGIS 138
            ++PL A ERF AL++++ID+LSRNT WTLLRE +L   F  + ++D Q F++       
Sbjct: 86  AFVPLKASERFPALETRRIDVLSRNTTWTLLREGALKAQFAGVLFYDNQAFMVPAASASQ 145

Query: 139 SVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDI 198
               L GA++CVQ  T+T   L  Y  A      P+V    +E   A+ A RC AYT D 
Sbjct: 146 LAGALKGATVCVQKDTSTLSHLIAYSDASGADIKPLVAGSADEARRAFFAGRCAAYTADA 205

Query: 199 SALYALKLTNDRPSEH-VILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGIT 257
           S L AL L     S+   ILP+ ISK PL P +  GD  W  +V W    ++ AEE+ +T
Sbjct: 206 SYLAALLLHAPGGSQAFAILPERISKEPLGPVVRGGDQAWLTLVRWVLLTLIAAEEMDVT 265

Query: 258 QKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQ 317
           ++N+    +   NP V R L  D +  +   +G+   WT R +  +GNYG+MFDRN+G  
Sbjct: 266 RENLEIRLR---NPSVSRALVPDDT--VTRTIGVEPGWTVRALESVGNYGQMFDRNVGAH 320

Query: 318 SELKIPRGYNALWSKGGLMYAPPIR 342
           S L + RG N LW++GGLMYAPPIR
Sbjct: 321 SPLGLARGTNDLWTRGGLMYAPPIR 345


>gi|317970283|ref|ZP_07971673.1| extracellular solute-binding protein [Synechococcus sp. CB0205]
          Length = 354

 Score =  271 bits (694), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 132/322 (40%), Positives = 199/322 (61%), Gaps = 8/322 (2%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           L  +K RG L CG++  L GF+ V  +G ++GF+VD CRA+++ +  DP+K+++  L+A 
Sbjct: 35  LAAVKARGQLVCGVDGKLPGFSFVAPDGRYQGFEVDLCRAVAAGVLSDPAKVEFRDLSAS 94

Query: 87  ERFLALQSKQIDILSRNTDWTLLREISLG--LAFRPITYFDGQGFIMHKKKGISSVSQLS 144
           ERF A+ S ++D+LSR+T  TL R+ + G  L+F PI ++ GQ  +++   GI+ + QL+
Sbjct: 95  ERFAAVNSGEVDLLSRSTTMTLSRDAAGGNALSFAPIHFYGGQAVMVNAGSGITYLKQLA 154

Query: 145 GASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYAL 204
           G  ICV  GTTTEL LAD  +  N  Y P+ F+   +   AY   RC A T D + L A 
Sbjct: 155 GKPICVTTGTTTELNLADRMRELNAAYMPLKFQNDGQTYGAYLQGRCVAVTSDRALLAAK 214

Query: 205 KLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNIN-- 262
           + +   P  HV+L   +SK PLA   + GD  W + V W  YA++ AEE GITQ N+   
Sbjct: 215 RSSFPDPKAHVLLAGDLSKEPLAMGTVNGDPAWADAVRWIAYALMQAEESGITQANVEAK 274

Query: 263 --QVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSEL 320
             +   D+   D++RFLG+D    +G+ LGL  D+  ++I+ +GNYGE+F+RNLG  + +
Sbjct: 275 LAEAQADSNQADLRRFLGVD--GQLGQQLGLPADFVVQVIKAVGNYGEIFERNLGVNTRI 332

Query: 321 KIPRGYNALWSKGGLMYAPPIR 342
            + RG N  W+ GGL+Y+PP R
Sbjct: 333 NLERGTNRQWTDGGLIYSPPFR 354


>gi|148655565|ref|YP_001275770.1| extracellular solute-binding protein [Roseiflexus sp. RS-1]
 gi|148567675|gb|ABQ89820.1| extracellular solute-binding protein, family 3 [Roseiflexus sp.
           RS-1]
          Length = 415

 Score =  271 bits (693), Expect = 9e-71,   Method: Compositional matrix adjust.
 Identities = 135/324 (41%), Positives = 203/324 (62%), Gaps = 10/324 (3%)

Query: 26  ILGDIKKRGFLKCGINTGLVGFAEVKA-NGDWKGFDVDFCRALSSAIFDDPSKIQYLPLN 84
           IL  +K+RG+L CG N  L GF    +    W GFDVDFCRA+++AIF D +K++++ L 
Sbjct: 95  ILARVKERGYLICGTNADLPGFGFYDSVRQTWSGFDVDFCRAVAAAIFGDATKVEFVALG 154

Query: 85  A----KERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSV 140
                  RF A++  ++D+L RNT WTL R IS GLAF P T+ DGQ F++  K  I+ +
Sbjct: 155 TGPGPNNRFDAVREGRVDVLFRNTTWTLGRNIS-GLAFGPTTFHDGQTFMVRAKDRITKL 213

Query: 141 SQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISA 200
             L G  ICV  GTT+E  L D F A  +++   V +  +E+  AY    CDA T D S 
Sbjct: 214 EDLEGKVICVAKGTTSEQNLNDDFAARGIRFTARVLDGEDELYPAYDEGECDAVTSDSSQ 273

Query: 201 LYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKN 260
           L A +     P++H+IL D IS+ PL P I + D +W +++SWT +A + AEEL + Q+N
Sbjct: 274 LAAKRQQLKNPADHIILGDRISREPLGPVIARDDNQWLDVISWTVFATIYAEELRVDQRN 333

Query: 261 INQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSEL 320
           ++++   TT+P ++R LG++   N GE LGL  D+ Y+II+ +GNYG++++RNLG  + +
Sbjct: 334 VDRLRTSTTDPRIKRLLGLE--GNFGEGLGLPNDFAYQIIKQVGNYGDIYNRNLGPNTVI 391

Query: 321 KIPRGYNALWS--KGGLMYAPPIR 342
            + RG N +W+   GG++ +PP R
Sbjct: 392 NLDRGPNKVWNLGAGGVLASPPFR 415


>gi|326204744|ref|ZP_08194599.1| extracellular solute-binding protein family 3 [Clostridium
           papyrosolvens DSM 2782]
 gi|325985115|gb|EGD45956.1| extracellular solute-binding protein family 3 [Clostridium
           papyrosolvens DSM 2782]
          Length = 363

 Score =  271 bits (692), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 130/316 (41%), Positives = 197/316 (62%), Gaps = 3/316 (0%)

Query: 25  SILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLN 84
           SIL  +K RG +  G +T L GF  ++ +G + GFD++  +A ++AI  DP+  +  P+ 
Sbjct: 49  SILQKVKARGKVYIGCDTVLPGFGFLETDGKYSGFDIEIGKAFAAAILGDPNAAEMKPVT 108

Query: 85  AKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLS 144
            + RF ALQ+ +IDILSR T  ++ R+ +LG+ F P  ++DGQG ++ K K + +   L 
Sbjct: 109 GQTRFTALQTGEIDILSRATTMSITRDTTLGIRFLPTDFYDGQGIMVKKNKNVKTFKDLD 168

Query: 145 GASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYAL 204
           G  I V+ GTTTE  +     A   K + +VFE  + I +AY A   DA+T D S L + 
Sbjct: 169 GMRIGVEQGTTTEKNVTTKLAAVGAKANIVVFENQDSIVSAYEAGSIDAWTSDKSGLVSR 228

Query: 205 KLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQV 264
                +  EH IL + +SK PL PAI  GD +W+N+  WT YA++ AEELGITQ N+ ++
Sbjct: 229 LAGMSKQDEHAILEETLSKEPLTPAIKAGDDQWFNVTRWTLYALMQAEELGITQANVEEM 288

Query: 265 SKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPR 324
            K + +P ++  LG +   ++G+ LGL+ DW  ++I+ +GNYGE+++R LG  S  K+ R
Sbjct: 289 VK-SDDPSIRSLLGAE--GDLGKNLGLSNDWVVKLIKGVGNYGEIYERTLGQGSAFKLDR 345

Query: 325 GYNALWSKGGLMYAPP 340
           G NALW+ GGLMY+PP
Sbjct: 346 GLNALWTDGGLMYSPP 361


>gi|88808790|ref|ZP_01124300.1| ABC transporter for amino acids, substrate binding protein
           [Synechococcus sp. WH 7805]
 gi|88787778|gb|EAR18935.1| ABC transporter for amino acids, substrate binding protein
           [Synechococcus sp. WH 7805]
          Length = 338

 Score =  271 bits (692), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 131/325 (40%), Positives = 203/325 (62%), Gaps = 8/325 (2%)

Query: 24  ASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPL 83
           AS L  I++RG L+CG++  + GF+ ++ +G + G DVD C+A ++A   D SK++Y PL
Sbjct: 16  ASRLDLIRQRGELRCGVSGKIPGFSFLERDGRYAGLDVDMCQAFAAAFVGDSSKVEYRPL 75

Query: 84  NAKERFLALQSKQIDILSRNTDWTLLREISLG--LAFRPITYFDGQGFIMHKKKGISSVS 141
            A ERF AL++ +ID+LSRNT + L R+ S G  + F P+ + DGQG ++ +  GI  + 
Sbjct: 76  TAPERFTALRTGEIDLLSRNTTFNLSRDASGGNGVTFAPVVFHDGQGLLVRRNSGIKGLD 135

Query: 142 QLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISAL 201
            L   +ICV +GTTTE  L D F+A  + Y P+ ++ + ++ A Y   RC A T D S L
Sbjct: 136 DLRDKTICVGSGTTTEQNLNDVFQARGIAYKPVKYQDLNQLVAGYLQGRCSAMTSDRSQL 195

Query: 202 YALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNI 261
            + +    +P+ H ILP+++SK PLAP    GD    + + W  YA++TAEE+GIT+ N+
Sbjct: 196 ASARSGFAQPNNHQILPEVLSKEPLAPLSSGGDQRLADAMRWVVYALITAEEMGITKANV 255

Query: 262 N----QVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQ 317
           +    + + D +   ++RFLG+D    +G  LGL  D+   +++  GNYGE++DR+LG Q
Sbjct: 256 DVKLQEATSDPSKTALRRFLGVD--GELGSKLGLRNDFVVSVLKTTGNYGEIYDRHLGPQ 313

Query: 318 SELKIPRGYNALWSKGGLMYAPPIR 342
           S + IPRG N L   GG++ APP +
Sbjct: 314 SAVPIPRGLNQLHRDGGVLIAPPFQ 338


>gi|116070918|ref|ZP_01468187.1| extracellular solute-binding protein, family 3 [Synechococcus sp.
           BL107]
 gi|116066323|gb|EAU72080.1| extracellular solute-binding protein, family 3 [Synechococcus sp.
           BL107]
          Length = 371

 Score =  271 bits (692), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 136/317 (42%), Positives = 196/317 (61%), Gaps = 8/317 (2%)

Query: 30  IKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERF 89
           ++ RG L CG++  + GF+ +  +G + G DVD C+A+++A   D +K+QY PL A ERF
Sbjct: 55  VQTRGELLCGVSGKIPGFSFLSPDGRYAGLDVDVCKAMAAAFVGDSTKVQYRPLTAPERF 114

Query: 90  LALQSKQIDILSRNTDWTLLREISLG--LAFRPITYFDGQGFIMHKKKGISSVSQLSGAS 147
            AL+S +ID+LSRNT  TL R+ + G  L+F P  + DGQG ++    G  S++ LSG +
Sbjct: 115 TALRSGEIDLLSRNTTHTLSRDAAGGNGLSFAPTVFHDGQGLMVSVGSGARSMADLSGKA 174

Query: 148 ICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLT 207
           ICV +GTTTE  L D F A  + Y PI ++ + ++   Y   RC A T D S L + +  
Sbjct: 175 ICVGSGTTTEQNLNDAFAAQGLPYTPIKYQDLNQVVGGYLQGRCAAMTSDRSQLASARSG 234

Query: 208 NDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSK- 266
              P +HVIL D +SK PLAPA++ GD    +  +W  YA++ AEE GITQ N++ V + 
Sbjct: 235 FKDPQQHVILEDRLSKEPLAPAVVGGDQRMADATNWVVYALIEAEERGITQANLDDVLER 294

Query: 267 ---DTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIP 323
              D +   ++RFLG+D    +G  LGL  D+  ++IR  GNYGE+++R+LG  S + IP
Sbjct: 295 AVADPSQAALRRFLGVD--GGLGAKLGLPDDFVVQVIRATGNYGEIYNRHLGPGSAVTIP 352

Query: 324 RGYNALWSKGGLMYAPP 340
           RG N L   GGLM APP
Sbjct: 353 RGPNRLGRDGGLMIAPP 369


>gi|116749482|ref|YP_846169.1| extracellular solute-binding protein [Syntrophobacter fumaroxidans
           MPOB]
 gi|116698546|gb|ABK17734.1| extracellular solute-binding protein, family 3 [Syntrophobacter
           fumaroxidans MPOB]
          Length = 347

 Score =  270 bits (690), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 129/340 (37%), Positives = 203/340 (59%), Gaps = 4/340 (1%)

Query: 5   FFVSILCL-IILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDF 63
           F V++L   ++LF  + ++    L  IK RG L+CG++ G+ GF+    +G W G DVDF
Sbjct: 10  FLVTLLIASVLLFPENVASAGDTLIRIKARGKLRCGVSDGIPGFSWKGPDGRWTGMDVDF 69

Query: 64  CRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITY 123
           CRAL++A+  DP K+ ++PL A  RF AL++ ++D+L+RNT WT+ RE  LG+ F  +  
Sbjct: 70  CRALAAAVLKDPEKVDFVPLTASRRFPALKAGELDVLARNTTWTMEREAVLGILFAGVLV 129

Query: 124 FDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEID 183
           +D QGF++    GI+ +SQL GA++CV  G++ E  +A  F A N  Y P+  E   +  
Sbjct: 130 YDTQGFLVPTSSGITELSQLDGATVCVVRGSSHEEHIAQTFGARNWTYQPLQVESSVQAM 189

Query: 184 AAYRAHRCDAYTGDISALYALKL-TNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVS 242
           AA    +C A+T +   L   ++   D P ++ +L + IS+ P+ P + +GD +W+ IV 
Sbjct: 190 AALNEGKCKAFTSESPQLKTARMNAPDGPDQYSLLKETISEEPMGPVVRRGDEDWFTIVR 249

Query: 243 WTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRH 302
           W  + ++ AE+ G T  N+    + T +     +  +D    I ++LG+   W  R++  
Sbjct: 250 WVLFTLILAEDGGYTGANVRSRLEKTADFRAMSWKQLD--GLIAKSLGIDPGWRIRVVES 307

Query: 303 MGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           +GNYGE+F+RNLG+QS L + RG N LW   GLMYAPP R
Sbjct: 308 VGNYGEVFERNLGSQSTLNLERGPNKLWKDAGLMYAPPFR 347


>gi|148239754|ref|YP_001225141.1| ABC transporter, substrate binding protein for amino acids
           [Synechococcus sp. WH 7803]
 gi|147848293|emb|CAK23844.1| ABC transporter, substrate binding protein for amino acids
           [Synechococcus sp. WH 7803]
          Length = 338

 Score =  268 bits (685), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 130/325 (40%), Positives = 201/325 (61%), Gaps = 8/325 (2%)

Query: 24  ASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPL 83
           AS L  +++RG L+CG++  + GF+ +   G + G DVD C+A ++A   D +K++Y PL
Sbjct: 16  ASRLDLVRQRGELRCGVSGKIPGFSFLDREGRYAGLDVDMCKAFAAAFVGDANKVEYRPL 75

Query: 84  NAKERFLALQSKQIDILSRNTDWTLLREISLG--LAFRPITYFDGQGFIMHKKKGISSVS 141
            A ERF AL++ +ID+LSRNT + L R+ S G  +AF P+ + DGQG ++ +  GI  + 
Sbjct: 76  TAPERFTALRTGEIDLLSRNTTFNLSRDASGGNGVAFAPVVFHDGQGLLVRRDSGIKRLE 135

Query: 142 QLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISAL 201
            L   +ICV +GTTTE  L D F+A  + Y P+ ++ + ++ A Y   RC A T D S L
Sbjct: 136 DLRNQTICVGSGTTTEQNLNDVFQAKGIPYKPVKYQDLNQLVAGYLQKRCAAMTSDRSQL 195

Query: 202 YALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNI 261
            + +   ++P  H ILP+++SK PLAP    GD    + + W  YA+VTAEE+GITQ N+
Sbjct: 196 ASARSGFEQPGNHQILPEVLSKEPLAPLSSGGDQRLADAMRWVVYALVTAEEMGITQNNV 255

Query: 262 N----QVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQ 317
           +    +   D +   ++RFLG++    +G  LGL  D+   +++  GNYGE+++R+LG Q
Sbjct: 256 DAKLQEAINDPSKTALRRFLGVE--GELGSKLGLPNDFVVSVLKATGNYGEIYNRHLGPQ 313

Query: 318 SELKIPRGYNALWSKGGLMYAPPIR 342
           S + IPRG N L   GG++ APP +
Sbjct: 314 SAVPIPRGLNQLHRDGGVLIAPPFQ 338


>gi|156741676|ref|YP_001431805.1| extracellular solute-binding protein [Roseiflexus castenholzii DSM
           13941]
 gi|156233004|gb|ABU57787.1| extracellular solute-binding protein family 3 [Roseiflexus
           castenholzii DSM 13941]
          Length = 411

 Score =  268 bits (684), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 134/324 (41%), Positives = 202/324 (62%), Gaps = 10/324 (3%)

Query: 26  ILGDIKKRGFLKCGINTGLVGFAEV-KANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLN 84
           IL  +K+RG+L CG N  L GF         W GFDVDFCRA+++AIF D +K++++ L 
Sbjct: 91  ILARVKERGYLICGTNADLPGFGFYDNVRQAWSGFDVDFCRAVAAAIFGDATKVEFVALG 150

Query: 85  A----KERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSV 140
                  RF A++  ++D+L RNT WTL R IS GLAF P T+ DGQ F++  +  I+ +
Sbjct: 151 TGPGPNNRFDAVREGRVDVLFRNTTWTLGRNIS-GLAFGPTTFHDGQTFMVRIRDRITKL 209

Query: 141 SQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISA 200
             L+G  ICV  GTT+E  L D F A  +++   V    +E+  AY    CDA T D S 
Sbjct: 210 EDLAGKVICVAKGTTSEQNLNDDFAARGIQFTARVLNGEDELYPAYDEGECDAVTSDSSQ 269

Query: 201 LYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKN 260
           L A +     P++H+IL D IS+ PL P I + D +W +++SWT +A + AEEL + Q+N
Sbjct: 270 LAAKRQQLKNPADHIILGDRISREPLGPVIARDDNQWLDVISWTVFATIYAEELRVDQRN 329

Query: 261 INQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSEL 320
           ++++   TT+P ++R LG++   N GE LGL  D+ Y+II+ +GNYG++++RNLG  + +
Sbjct: 330 VDRLRASTTDPRIKRLLGLE--GNFGEGLGLPNDFAYQIIKQVGNYGDIYNRNLGPNTVI 387

Query: 321 KIPRGYNALWS--KGGLMYAPPIR 342
            + RG N +W+   GG++ +PP R
Sbjct: 388 NLDRGPNKVWNLGAGGVLASPPFR 411


>gi|83591779|ref|YP_425531.1| extracellular solute-binding protein [Rhodospirillum rubrum ATCC
           11170]
 gi|83574693|gb|ABC21244.1| extracellular solute-binding protein, family 3 [Rhodospirillum
           rubrum ATCC 11170]
          Length = 364

 Score =  263 bits (673), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 125/322 (38%), Positives = 186/322 (57%), Gaps = 4/322 (1%)

Query: 21  STNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQY 80
           +     L  +++RG+L CG+N  L G   V  +G W+GFD+D+CRA+++A   D  ++++
Sbjct: 43  AAEGDTLRQVRERGYLTCGVNARLTGLGSVDPDGVWRGFDIDYCRAVAAAALGDSGRVRF 102

Query: 81  LPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKK-KGISS 139
           +PL+ + R LAL S ++D+LSRNT WTL R+   G++F  ++ FDG G +  K   G   
Sbjct: 103 VPLDIRSRLLALTSGEVDLLSRNTTWTLERDAGQGISFVGVSLFDGPGLLAWKDLPGDDL 162

Query: 140 VSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDIS 199
            S    A +CVQ+  T    L     A  + +  + F  +EE   A     CD Y  D +
Sbjct: 163 ASLPPTARLCVQSAATAARVLPARMAAAGLSFTILPFRSLEEARMALFTRACDGYVADRT 222

Query: 200 ALYALK-LTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQ 258
           AL +L      RP    +LPD+++  PL PA+  GD  W++I  WT +A++ AEE G++ 
Sbjct: 223 ALASLATFEAPRPDALRLLPDLLAVEPLGPAVRDGDANWFDIARWTLFALIKAEEEGLSH 282

Query: 259 KNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQS 318
             +  V + T +P+++RFLG+D    +G  LGL   W  RI+  +G YGE+FDRNLG  S
Sbjct: 283 DRLPAVLESTQDPELRRFLGLDP--GVGAPLGLDDAWVRRIVSQVGTYGEVFDRNLGQGS 340

Query: 319 ELKIPRGYNALWSKGGLMYAPP 340
            LK+ RG NAL   GGLM APP
Sbjct: 341 PLKLERGPNALRRDGGLMVAPP 362


>gi|148555539|ref|YP_001263121.1| extracellular solute-binding protein [Sphingomonas wittichii RW1]
 gi|148500729|gb|ABQ68983.1| extracellular solute-binding protein, family 3 [Sphingomonas
           wittichii RW1]
          Length = 347

 Score =  262 bits (670), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 124/308 (40%), Positives = 201/308 (65%), Gaps = 5/308 (1%)

Query: 30  IKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERF 89
           ++ RG+++CG +    GF+    +G W+G DVD CRA++ A   D  K++++PL  ++R 
Sbjct: 38  VRSRGYVRCGASKEAPGFSGPDESGRWRGLDVDTCRAIAVAALGDREKVRFVPLTGQQRI 97

Query: 90  LALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASIC 149
            ALQ+ +ID+L R T WTL R+ + G+ F   TY+D   F++ +K G+  ++ L GAS C
Sbjct: 98  TALQTGEIDVLPRTTTWTLRRDAA-GINFTIPTYYDYTAFMVRRKVGVRDLAGLRGASAC 156

Query: 150 VQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLT-N 208
           VQ+G+ TE+ LAD  + + +   P++F+ V+    A+ + RCDA   D SAL AL+ T  
Sbjct: 157 VQSGSMTEVILADVSRKYRLALRPVIFDNVQSTRQAFLSGRCDALITDASALAALRATLP 216

Query: 209 DRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDT 268
            R  ++VILP   + +PL PA+  GD +W++IV ++  AM+  E+LGI +   +++ + +
Sbjct: 217 GRADDYVILPADSNVAPLTPAVRHGDDQWFDIVKFSIEAMIDGEQLGIGRDTADRL-RAS 275

Query: 269 TNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNA 328
            +P+V+RFLG++  +  G ALG++ D+ Y+I+R +GNYGE++D NLG++S L IPRG N 
Sbjct: 276 ADPNVRRFLGVEPGN--GRALGISDDFAYQIVRQIGNYGEVYDDNLGSRSRLNIPRGLNR 333

Query: 329 LWSKGGLM 336
           L   GGLM
Sbjct: 334 LQRDGGLM 341


>gi|87124569|ref|ZP_01080418.1| ABC transporter for amino acids, substrate binding protein
           [Synechococcus sp. RS9917]
 gi|86168141|gb|EAQ69399.1| ABC transporter for amino acids, substrate binding protein
           [Synechococcus sp. RS9917]
          Length = 343

 Score =  262 bits (670), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 133/326 (40%), Positives = 199/326 (61%), Gaps = 8/326 (2%)

Query: 23  NASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLP 82
            AS L  I++RG L+CG++  + GF+ ++ +G + G DVD C+A ++A   +   + Y P
Sbjct: 20  GASRLDLIRQRGSLRCGVSGKIPGFSYLQTDGRYFGLDVDLCKAFAAAFVPETGAVDYRP 79

Query: 83  LNAKERFLALQSKQIDILSRNTDWTLLREISLG--LAFRPITYFDGQGFIMHKKKGISSV 140
           L A ERF AL++ +ID+LSRNT   L R+ + G  L+F P+ + DGQG ++    GI  +
Sbjct: 80  LTAPERFTALRTGEIDLLSRNTTMNLSRDAAGGNGLSFAPVVFHDGQGLMVSSGSGIKRL 139

Query: 141 SQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISA 200
             L G SICV +GTTTE  L D F+A  + Y PI ++ + ++ A Y   RC A T D S 
Sbjct: 140 EDLQGKSICVGSGTTTEQNLNDAFEARGIAYTPIKYQDLNQVVAGYLQGRCQAMTSDRSQ 199

Query: 201 LYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKN 260
           L A +        H IL +++SK PLAPA + GD    + + W  YA++TAEELGITQ N
Sbjct: 200 LAAARSGFADQRNHRILEEVLSKEPLAPASVGGDQRLADAMRWVVYALITAEELGITQAN 259

Query: 261 INQ-VSKDTTNPD---VQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGN 316
           + +  ++    P+   ++RF G++  + +GE LGL  D+  ++I+  GNYGE++ RNLG 
Sbjct: 260 VQERYAEAQRRPELTRLRRFFGLN--AGLGETLGLRDDFVVQVIQATGNYGEIYARNLGP 317

Query: 317 QSELKIPRGYNALWSKGGLMYAPPIR 342
            S++ IPRG N L   GG+M APP +
Sbjct: 318 DSQVPIPRGLNRLGRDGGVMVAPPFQ 343


>gi|323165231|gb|EFZ51021.1| general L-amino acid-binding periplasmic protein aapJ [Shigella
           sonnei 53G]
          Length = 254

 Score =  260 bits (665), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 113/229 (49%), Positives = 163/229 (71%)

Query: 24  ASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPL 83
            + L  ++K+GF++CGI+ GL GF+   A+G + G DVD CR +++A+F D +K++Y PL
Sbjct: 25  GATLDAVQKKGFVQCGISDGLPGFSYADADGKFSGIDVDVCRGVAAAVFGDDTKVKYTPL 84

Query: 84  NAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQL 143
            AKERF ALQS ++D+LSRNT WT  R+  +G+AF  +T +DG GF+ H K G+ S  +L
Sbjct: 85  TAKERFTALQSGEVDLLSRNTTWTSSRDAGMGMAFTGVTDYDGIGFLTHDKAGLKSAKEL 144

Query: 144 SGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYA 203
            GA++C+QAGT TEL +ADYFKA+NMKY P+ F+R +E   A  + RCD    D S LYA
Sbjct: 145 DGATVCIQAGTDTELNVADYFKANNMKYTPVTFDRSDESAKALESGRCDTLASDQSQLYA 204

Query: 204 LKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAE 252
           L++    P+E ++LP++ISK PL P + +GD EW++IV WT +AM+ AE
Sbjct: 205 LRIKLSNPAEWIVLPEVISKEPLGPVVRRGDDEWFSIVRWTLFAMLNAE 253


>gi|317407537|gb|EFV87488.1| extracellular solute-binding protein, family 3 [Achromobacter
           xylosoxidans C54]
          Length = 329

 Score =  258 bits (659), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 125/317 (39%), Positives = 192/317 (60%), Gaps = 5/317 (1%)

Query: 22  TNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYL 81
           TN+  +  I+ RG++ CG   G  GF+    +G+WKG DVD CRA++ A+  D SK +++
Sbjct: 12  TNSPTVDQIRARGYVICGSGHGTTGFSAPDKDGNWKGLDVDTCRAIAIAVLGDASKTRFV 71

Query: 82  PLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVS 141
           PL  ++R  ALQ+ QID+L R T WTL R+ + G+ F    Y++   F++ K  GI+   
Sbjct: 72  PLTGQQRLTALQTGQIDVLPRTTSWTLRRDAN-GINFTYPNYYEYDAFMVRKDLGITQTK 130

Query: 142 QLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISAL 201
            ++GA+ICVQ G+T E+T+AD  +   +    ++F+ V     A+ + RCD    D SAL
Sbjct: 131 DMNGATICVQTGSTNEVTVADLSRKFKLGLKTVLFDNVAASRQAFFSGRCDGLITDASAL 190

Query: 202 YALKLTN-DRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKN 260
            A++ T    P ++VI P       L P++  GD  W++IV W     + AE++GITQ N
Sbjct: 191 AAVRATQAQNPDDYVIFPASGHSEALTPSVRHGDDRWFDIVKWVIQVPIAAEDMGITQAN 250

Query: 261 INQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSEL 320
           ++ + K + +P + RFLG  K    G+ALGL + W Y I++ +GNYGE+F+RN+G  S +
Sbjct: 251 VDDMLK-SDDPRIARFLG--KEPGNGKALGLDERWAYNIVKQLGNYGEIFERNVGKNSPM 307

Query: 321 KIPRGYNALWSKGGLMY 337
           K+ RG N L+  GGLMY
Sbjct: 308 KLERGMNRLYRDGGLMY 324


>gi|103487895|ref|YP_617456.1| extracellular solute-binding protein [Sphingopyxis alaskensis
           RB2256]
 gi|98977972|gb|ABF54123.1| extracellular solute-binding protein, family 3 [Sphingopyxis
           alaskensis RB2256]
          Length = 365

 Score =  252 bits (644), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 126/323 (39%), Positives = 199/323 (61%), Gaps = 6/323 (1%)

Query: 21  STNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQY 80
           +   S L  I+ RG L C I+TG +G + +   G W+GF VD+CRAL++A+  D  K+++
Sbjct: 48  AAKGSTLARIRARGTLNCAIHTGQLGMSYLDKRGRWQGFFVDYCRALAAAVLGDARKVRF 107

Query: 81  LPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSV 140
           +P+ + +RF  +Q+ + D+LSR T WTL R+  LG+ F    Y+DGQ F++ ++ G+   
Sbjct: 108 MPVASNKRFTIVQTGEADVLSRTTTWTLTRDTDLGVNFVGTMYYDGQSFLVPRRSGVRLP 167

Query: 141 SQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISA 200
           + L GASIC+  GTT+EL  A+YF+   +++  +VFE  EE   A+ A RCDA T D   
Sbjct: 168 TDLDGASICITKGTTSELNTAEYFERKGLRFLSVVFENPEEAKLAFFAGRCDAMTTDAFT 227

Query: 201 LYALKLTND-RPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQK 259
           L  ++L +   P ++V+LP+ ++K P+ P +   D +WY I  W   A+  AEE+G+T+ 
Sbjct: 228 LTVIRLADTAHPDDYVVLPERLTKEPVGPVVRSDDEQWYEINKWVLNALFAAEEMGVTRA 287

Query: 260 NINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSE 319
           N  ++   + +P+V++ LG       G++LGL  DW YR I   GNYGE+FDR++   + 
Sbjct: 288 NAARMRMASRDPEVRKMLG--GLPGFGKSLGLDDDWAYRAIEATGNYGEIFDRHI---TP 342

Query: 320 LKIPRGYNALWSKGGLMYAPPIR 342
           L + RG N L+  GGL+Y  P+R
Sbjct: 343 LGVERGQNKLYRDGGLIYPLPMR 365


>gi|254230451|ref|ZP_04923829.1| hypothetical protein VEx25_B0035 [Vibrio sp. Ex25]
 gi|151937022|gb|EDN55902.1| hypothetical protein VEx25_B0035 [Vibrio sp. Ex25]
          Length = 222

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 114/225 (50%), Positives = 153/225 (68%), Gaps = 3/225 (1%)

Query: 118 FRPITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFE 177
           F  + Y+DGQGF++ K  GISS  +L GAS+CVQ+GTTTEL LADYF+   M Y P+VF+
Sbjct: 1   FVGVNYYDGQGFMVKKDLGISSAKELDGASVCVQSGTTTELNLADYFRNSGMSYKPVVFD 60

Query: 178 RVEEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEW 237
              +    + A RCD  T D S LYAL+L    PS   +LP+IISK PL P + QGD +W
Sbjct: 61  TAAQTSKGFDAGRCDVLTTDQSGLYALRLNLKDPSSAAVLPEIISKEPLGPVVRQGDDQW 120

Query: 238 YNIVSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTY 297
           +NI  WT  AM+ AEE GI+ KN +++ K + +P+++R LG+D     G+ LG+  DW Y
Sbjct: 121 FNIAKWTLSAMINAEEYGISSKNADEMLK-SKDPNIKRILGVDGPK--GKGLGIRDDWGY 177

Query: 298 RIIRHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           ++I+ +GNYGE F+R +G  S L+I RG NALW+ GG MYAPPIR
Sbjct: 178 QVIKQVGNYGESFERTVGTGSPLEISRGVNALWNAGGFMYAPPIR 222


>gi|319782291|ref|YP_004141767.1| extracellular solute-binding protein family 3 [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
 gi|317168179|gb|ADV11717.1| extracellular solute-binding protein family 3 [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
          Length = 344

 Score =  249 bits (636), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 118/329 (35%), Positives = 195/329 (59%), Gaps = 3/329 (0%)

Query: 10  LCLIILFFTSFSTNASILGDIKKRGFLKC-GINTGLVGFAEVKANGDWKGFDVDFCRALS 68
           L L+     + +     L  +K RG L C G +   +GFAEV   G+WKG D+D CRA++
Sbjct: 13  LGLVHFAAPAEAAGGKTLEAVKARGVLNCTGHDGSYLGFAEVDDKGNWKGMDIDLCRAVA 72

Query: 69  SAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQG 128
           +A+  DP+K++ +P++  +R+ +LQS  +DI+ + +  TL R+  LGL F    Y     
Sbjct: 73  TAVLGDPAKLKVVPISWAQRWPSLQSGDVDIIIKASGGTLSRDTELGLQFSMSYYLGTTK 132

Query: 129 FIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRA 188
            + HK+  + S+   +G +IC+ AGT+ E  +A Y     +K  P++ E+ EE++ AY +
Sbjct: 133 VMAHKELNLKSLKDAAGGTICIPAGTSQEQQVAAYTAKLGIKLEPVLIEKTEELEQAYFS 192

Query: 189 HRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAM 248
            RCD Y      L   ++   +  +HVILPD+++  P    + QGD  W +I +WT   +
Sbjct: 193 GRCDLYAQWGPTLAIARIAKSKVDDHVILPDVLAVEPEVMIMRQGDDNWVDIANWTLSTL 252

Query: 249 VTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGE 308
           + AE+ GIT KN+++V    T+P V +FLG+  +  +G+ LGL  DW Y++I+++GNYGE
Sbjct: 253 IFAEQEGITSKNVDEVKAKPTSPQVAKFLGV--TPGMGKGLGLDDDWAYKVIKNVGNYGE 310

Query: 309 MFDRNLGNQSELKIPRGYNALWSKGGLMY 337
           +F+R+LG  S  K+ R    LW+ GG+++
Sbjct: 311 IFERDLGKDSPYKMDRELTNLWNNGGVLF 339


>gi|309791547|ref|ZP_07686046.1| extracellular solute-binding protein [Oscillochloris trichoides
           DG6]
 gi|308226407|gb|EFO80136.1| extracellular solute-binding protein [Oscillochloris trichoides
           DG6]
          Length = 404

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 132/336 (39%), Positives = 206/336 (61%), Gaps = 9/336 (2%)

Query: 13  IILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEV-KANGDWKGFDVDFCRALSSAI 71
           ++   T    ++ +L  +K RG L CG N  L GF       G W GFDVDFCRAL++AI
Sbjct: 72  VVAEATPTPASSGLLERVKARGKLICGTNADLPGFGFYDNVRGRWSGFDVDFCRALAAAI 131

Query: 72  FDDPSKIQYLPLNA---KERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQG 128
           F D   ++++ LN     ERF +++S ++D+L RNT WTL R++S  LAF P T+ DGQ 
Sbjct: 132 FADADAVEFVALNTSGQNERFESVRSGKVDVLFRNTTWTLGRDLSQ-LAFGPTTFHDGQT 190

Query: 129 FIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRA 188
           F++     I+S++ L+G  ICV  GTT+   L+D F A  + +  ++++   ++  AY  
Sbjct: 191 FMVRTASQITSLNDLAGKKICVSRGTTSAQNLSDDFAARGIVFEQVLYDDENQLYPAYDQ 250

Query: 189 HRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAM 248
             CDA T D S L + + T +RP +H IL + IS+ PL PA I+ D +W ++V+W  +A 
Sbjct: 251 GACDAVTSDSSQLASKRQTLERPEDHTILGERISREPLGPAFIEHDEQWRDVVTWVVFAT 310

Query: 249 VTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGE 308
           + AEEL + Q N+ Q+  ++T+P V+R LG++   + G +LGL  D+ Y+IIR +GNY +
Sbjct: 311 MYAEELRVDQTNVEQMKANSTDPRVRRLLGLE--GDFGTSLGLNNDFGYQIIRLVGNYAD 368

Query: 309 MFDRNLGNQSELKIPRGYNALWS--KGGLMYAPPIR 342
           +++RNLG  +   + RG N  W+   GG++ +PP R
Sbjct: 369 IYNRNLGPTTPFAMDRGPNKAWNLGAGGVLASPPFR 404


>gi|330899538|gb|EGH30957.1| extracellular solute-binding protein [Pseudomonas syringae pv.
           japonica str. M301072PT]
          Length = 218

 Score =  244 bits (623), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 109/220 (49%), Positives = 154/220 (70%), Gaps = 2/220 (0%)

Query: 123 YFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEI 182
           Y+DG GF+++ K G++S  +L GA+IC+QAGTTTEL ++DYF+++ +KY PI F+  +E 
Sbjct: 1   YYDGIGFLVNNKLGVNSAKELDGATICIQAGTTTELNVSDYFRSNGLKYTPITFDTSDES 60

Query: 183 DAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVS 242
             +    RCD  T D S LYA +    +P ++++LP++ISK PL P + +GD EW++IV 
Sbjct: 61  AKSLEGGRCDVLTSDQSQLYAQRSKLAKPDDYIVLPEVISKEPLGPVVRKGDEEWFSIVR 120

Query: 243 WTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRH 302
           WT +AM+ AEE  IT KN+   +K T NPDV R LG D +   G+ L L KDW  +I++ 
Sbjct: 121 WTLFAMLNAEEAKITSKNVEAEAKSTKNPDVARMLGADGT--YGQDLKLPKDWVVQIVKQ 178

Query: 303 MGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           +GNYGE+F+RNLG  + LKI RG NALW+ GG+ YAPPIR
Sbjct: 179 VGNYGEVFERNLGEGTPLKIKRGQNALWNAGGIQYAPPIR 218


>gi|224367657|ref|YP_002601820.1| AapJ2 [Desulfobacterium autotrophicum HRM2]
 gi|223690373|gb|ACN13656.1| AapJ2 [Desulfobacterium autotrophicum HRM2]
          Length = 219

 Score =  236 bits (603), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 109/222 (49%), Positives = 154/222 (69%), Gaps = 3/222 (1%)

Query: 121 ITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVE 180
           + Y+DGQGF++ KK G+    +L GA++CV  GTTTE  +ADYF+A+ MK +P+V E   
Sbjct: 1   MNYYDGQGFLISKKLGVKDAKELDGATVCVLPGTTTEQNVADYFRANGMKMNPVVIENTA 60

Query: 181 EIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNI 240
           E+  A+ A RCD  T D S L   +     P +++ILP IISK PLAPA+  GD +W ++
Sbjct: 61  ELAKAFFAGRCDCLTSDASQLAGTRAVAPNPDDYIILPTIISKEPLAPAVRHGDNKWKDV 120

Query: 241 VSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRII 300
           V+++  AM+ AEELGIT KN+++  K +T+P VQRFLG+  S   G+ALGL + + Y I+
Sbjct: 121 VNYSVLAMINAEELGITSKNVDEKLK-STDPKVQRFLGV--SPGNGKALGLDEKFAYNIV 177

Query: 301 RHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           + +GNYGEMF+RN+G  + LKI RG NALW+ GGLMY+ P +
Sbjct: 178 KQVGNYGEMFERNVGMDTPLKIERGLNALWTNGGLMYSAPFK 219


>gi|117923521|ref|YP_864138.1| extracellular solute-binding protein [Magnetococcus sp. MC-1]
 gi|117607277|gb|ABK42732.1| amino acid ABC transporter substrate-binding protein, PAAT family
           [Magnetococcus sp. MC-1]
          Length = 342

 Score =  233 bits (595), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 114/317 (35%), Positives = 182/317 (57%), Gaps = 4/317 (1%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           L  ++ RG L CG+ TG   F++ + +G W GF  D+CRAL+ A+ DD   + ++ +   
Sbjct: 29  LDKVRARGLLNCGVMTGTPAFSQQQPDGAWHGFFADWCRALAVAVLDDARAVHFIQVTPA 88

Query: 87  ERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGA 146
            RF AL   Q+D++  NT WTL RE    + F  I  +DGQ     K     +++Q + A
Sbjct: 89  TRFKALTELQVDVVMSNTTWTLSREYQYQVRFPAIYLYDGQAIATRKDTRWHTLAQANQA 148

Query: 147 SICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYA-LK 205
           ++CV+  +T+   L +Y + +N+ ++ +   + + I  A+  HRCD  T D  AL A LK
Sbjct: 149 TVCVEPNSTSHANLQEYAQRNNLNFNYLALNQ-QGIITAFLEHRCDLITDDRIALTANLK 207

Query: 206 LTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVS 265
            T     ++V+  + +S+ PLAP +   D  W  IV     A++ A+E G+++  + Q  
Sbjct: 208 TTASNDQDYVVFAETLSREPLAPMVRADDERWQRIVRMVVQALLVADEKGVSRDALKQNR 267

Query: 266 KDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRG 325
           +  ++P+VQR LG     + G+ +GL++ W  R+I  +GNYGE+F R+LG QS L++PR 
Sbjct: 268 ERLSDPEVQRLLG--SEDDPGQFVGLSRGWARRMIEAVGNYGELFARHLGAQSSLQMPRL 325

Query: 326 YNALWSKGGLMYAPPIR 342
            N  WS+GGL YAPP R
Sbjct: 326 LNRPWSRGGLFYAPPFR 342


>gi|209549223|ref|YP_002281140.1| extracellular solute-binding protein family 3 [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|209534979|gb|ACI54914.1| extracellular solute-binding protein family 3 [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 344

 Score =  233 bits (594), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 120/329 (36%), Positives = 196/329 (59%), Gaps = 6/329 (1%)

Query: 15  LFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKAN-GDWKGFDVDFCRALSSAIFD 73
           + FT+   +ASIL  +K+RG L CG +    GF  +    G  +G DVDFC+A+++++  
Sbjct: 15  MAFTATHASASILDTVKQRGVLNCGTDNTAPGFGYLNTTTGQMEGLDVDFCKAVAASVLG 74

Query: 74  DPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHK 133
           D +KI+++ +  K RF A+ + Q+D++  +T     RE S+ + F PI ++DG G ++  
Sbjct: 75  DAAKIKFITVTDKSRFDAVLTGQVDVVFAHTTIKPARESSIAIDFLPINFYDGTGLMVKA 134

Query: 134 KKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIV-FERVEEIDAAYRAHRCD 192
             GI   + L GA+IC   G+ TE  LA  FKA   K   ++ +E +E+  +A  + RC+
Sbjct: 135 DAGIKEFADLDGATICTTQGSATETVLAAAFKARGWKDSKVLTYENLEKFFSALNSGRCN 194

Query: 193 AYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAE 252
           A + D SAL A      +P++++ILPD + KSP    ++  D++W N + W  Y +  AE
Sbjct: 195 AMSTDKSALAAWAGNAPKPADYLILPDTLDKSPFGGFVVANDSKWRNALRWIEYGLFQAE 254

Query: 253 ELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDR 312
           E GITQ N+ +  K + +P VQ+FLG       G+  GL+ D+  + I+ +GNYGE +DR
Sbjct: 255 ESGITQANLAEKLK-SEDPFVQKFLG-SNGGGYGKDFGLSDDFIAQAIKAVGNYGEAYDR 312

Query: 313 NLGNQSELKIPRGY--NALWSKGGLMYAP 339
           NLG ++++ + R    NALW++GG +Y+P
Sbjct: 313 NLGPKTKMYLDRKGTPNALWTQGGAIYSP 341


>gi|144898062|emb|CAM74926.1| ABC-type amino acid transport/signal transduction systems,
           periplasmic component/domain [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 340

 Score =  231 bits (590), Expect = 9e-59,   Method: Compositional matrix adjust.
 Identities = 119/337 (35%), Positives = 196/337 (58%), Gaps = 7/337 (2%)

Query: 7   VSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRA 66
           ++ L LI    T     A  L ++  RG ++CG++        +  NG W GF  DFCRA
Sbjct: 10  LTALPLIAGLTTPPQARAGTLEEVTARGVIRCGVSEYGPALTAMNENGQWAGFYTDFCRA 69

Query: 67  LSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDG 126
            ++A   +   + ++ +++ +RF AL+ K +D+LS  + WT  R++  GLAF   +  DG
Sbjct: 70  FAAATLGNARAVDFVSVSSLDRFEALRQKAVDVLSEASTWTSERDLG-GLAFPATSMMDG 128

Query: 127 QGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAY 186
           QGF++ +  GIS + QL G  ICV +  T+   L    K  N+ +    +  ++   AA+
Sbjct: 129 QGFLVRRDGGISGLDQLKGRRICVISHATSVGGLNRVNKVRNLGFKIQEYSSIQGSFAAF 188

Query: 187 RAHRCDAYTGDISALYALKLT-NDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTH 245
              +CDA + D   L +L+      P+++V+LP+ I++ PL+P +++ D  W +I+ WT 
Sbjct: 189 FDRQCDAVSTDGIILASLRQQLAPNPADYVLLPERITREPLSPVVLKNDRRWEDIIRWTI 248

Query: 246 YAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGN 305
            A + AEELGIT  N+ Q   ++T+P+++R LG+D   ++G  LGL K W  R+I  +GN
Sbjct: 249 LATIAAEELGITSANVKQ-HLNSTDPEIRRLLGLD--GDMGARLGLDKAWAMRVIEQVGN 305

Query: 306 YGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           YGE+++RNL     L + RG NAL S+GG++++PP R
Sbjct: 306 YGEIYNRNL--TKVLGLERGQNALSSQGGILWSPPFR 340


>gi|190891654|ref|YP_001978196.1| putative amino acid ABC transporter, substrate-binding protein
           [Rhizobium etli CIAT 652]
 gi|190696933|gb|ACE91018.1| putative amino acid ABC transporter, substrate-binding protein
           [Rhizobium etli CIAT 652]
          Length = 343

 Score =  230 bits (586), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 117/327 (35%), Positives = 194/327 (59%), Gaps = 7/327 (2%)

Query: 17  FTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKAN-GDWKGFDVDFCRALSSAIFDDP 75
           FT+ + +AS+L  +K+RG L CG +    GF  +    G  +G DVDFC+A+++ +  D 
Sbjct: 17  FTAANASASVLDTVKQRGVLNCGTDNTAPGFGYLNTTTGQMEGLDVDFCKAVAAGVLGDA 76

Query: 76  SKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKK 135
           SK++++ +  K RF A+ + Q+D++  +T     RE S+ + F PI ++DG G ++    
Sbjct: 77  SKVKFITVTDKSRFDAVLTGQVDVVFAHTTIKPARESSIAIDFLPINFYDGTGLMVKTDA 136

Query: 136 GISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIV-FERVEEIDAAYRAHRCDAY 194
           GI   + L GA+IC   G+ TE  LA  FKA   K   ++ +E +E++ +A  + RC+A 
Sbjct: 137 GIKEFADLDGATICTTQGSATETVLAAAFKARGWKDSKVLTYENLEKLFSALNSGRCNAM 196

Query: 195 TGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEEL 254
           + D SAL A      +P++++ILPD + KSP    +   D++W N + W  Y +  AEE 
Sbjct: 197 STDKSALAAWAGNAPKPADYLILPDTLDKSPFGGFVAANDSKWRNALRWIEYGLFQAEES 256

Query: 255 GITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNL 314
            ITQ N+ +  K + +P +Q+FLG+      G+  GL+ D+  + I+ +GNYGE +DRNL
Sbjct: 257 EITQANLAEKLK-SEDPFIQKFLGV--GGGYGKDFGLSDDFIAQAIKAVGNYGEAYDRNL 313

Query: 315 GNQSELKIPRGY--NALWSKGGLMYAP 339
           G  +++ + R    NALW++GG +Y+P
Sbjct: 314 GPTTKMYLDRKGTPNALWTQGGAIYSP 340


>gi|110347225|ref|YP_666043.1| extracellular solute-binding protein [Mesorhizobium sp. BNC1]
 gi|110283336|gb|ABG61396.1| amino acid ABC transporter substrate-binding protein, PAAT family
           [Chelativorans sp. BNC1]
          Length = 340

 Score =  228 bits (580), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 118/332 (35%), Positives = 185/332 (55%), Gaps = 7/332 (2%)

Query: 14  ILFFTSFSTNA-SILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIF 72
           ++   + S NA SI   +++RG++ CG + G+ G +     G W GFDVD CRA+++A F
Sbjct: 13  MVLIGAGSVNAQSITDKVRQRGYVSCGASQGVPGLSRPDDKGVWTGFDVDSCRAVAAAFF 72

Query: 73  DDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMH 132
            D  K Q++PLNA +R  A+Q+ ++D+L+R T WT  R+++  + F  I   DG   ++ 
Sbjct: 73  GDSQKAQFVPLNAAQRIPAVQTGEVDVLARTTTWTYTRDVA--VRFVAINLVDGDAIMLR 130

Query: 133 KKKGISSVSQLSGASICVQAGTTTELTLADYFKAHN-MKYHPIVFERVEEIDAAYRAHRC 191
           K   + + + L G +IC+Q G +      D  +  N +K   + F+       AY   RC
Sbjct: 131 KSLNVGAAADLEGLTICLQGGGSLVENALDLIEQQNQVKVERVYFDSTILARDAYFGGRC 190

Query: 192 DAYTGDISALYALKLT-NDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVT 250
           D Y  D  A+   +      P EH I     +  PLA AI +GD  W++IV +   AMV 
Sbjct: 191 DGYMSDGFAIAGQRAAVASNPDEHAIFQSGATTEPLALAIPRGDDRWFDIVRYAFNAMVW 250

Query: 251 AEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMF 310
           AE+ GIT KN+++++   T+ + ++ LG++    IGE L L   W Y +I+ +GNYGE+F
Sbjct: 251 AEDRGITSKNVDEIAASATDGETRKALGVE--PGIGEPLKLDDKWIYNVIKQVGNYGEVF 308

Query: 311 DRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
            RNLG +S LK  R  NAL   GG+++  P +
Sbjct: 309 ARNLGEESPLKAERRLNALPRDGGILFPIPFK 340


>gi|150397299|ref|YP_001327766.1| extracellular solute-binding protein [Sinorhizobium medicae WSM419]
 gi|150028814|gb|ABR60931.1| extracellular solute-binding protein family 3 [Sinorhizobium
           medicae WSM419]
          Length = 343

 Score =  223 bits (569), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 116/329 (35%), Positives = 192/329 (58%), Gaps = 7/329 (2%)

Query: 15  LFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKAN-GDWKGFDVDFCRALSSAIFD 73
           L  T+   +AS+L  +K+RG L CG +    GF  +    G  +G DVDFCRA+++A+  
Sbjct: 15  LAVTTGQASASVLDTVKQRGTLNCGTDNTAPGFGYLNTTTGQMEGLDVDFCRAVAAAVLG 74

Query: 74  DPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHK 133
           D SK++++ +  K RF A+ + Q+D++  +T     RE S+ + F P+ ++DG G ++  
Sbjct: 75  DASKVKFVTVTDKSRFDAVLTNQVDVVFAHTTMKPARESSIAIDFLPVNFYDGTGIMVKT 134

Query: 134 KKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIV-FERVEEIDAAYRAHRCD 192
              +   + L GA+ C   G+ TE  L   FKA+  +   ++ +E +E++ AA  + RC+
Sbjct: 135 DSEVVQFADLEGATFCTTQGSVTETVLTSAFKANGWQGSKVLTYENLEKLFAALNSGRCN 194

Query: 193 AYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAE 252
           A + D SAL A    + +PS+++ILP+ + KSP A  +   D++W N + W  Y +  AE
Sbjct: 195 AMSTDKSALAAWAGNSPKPSDYLILPETLDKSPFAGFVAANDSKWRNALRWITYGLFQAE 254

Query: 253 ELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDR 312
           E  ITQ N+ +  K + +P VQ+FLG+      G+  GL  D+  + I+ MGNYGE++ R
Sbjct: 255 ESDITQANLEEKLK-SDDPFVQKFLGV--GGGYGKDFGLPDDFVAQAIKAMGNYGEIYAR 311

Query: 313 NLGNQSELKIPR--GYNALWSKGGLMYAP 339
           NLG  + + + R    NALW++GG +Y+P
Sbjct: 312 NLGPDTSMFLDRKGTPNALWTEGGAIYSP 340


>gi|117925598|ref|YP_866215.1| extracellular solute-binding protein [Magnetococcus sp. MC-1]
 gi|117609354|gb|ABK44809.1| amino acid ABC transporter substrate-binding protein, PAAT family
           [Magnetococcus sp. MC-1]
          Length = 360

 Score =  223 bits (567), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 110/320 (34%), Positives = 177/320 (55%), Gaps = 3/320 (0%)

Query: 24  ASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPL 83
            S +  IK RG L+CG+    +  + +  +G+W+GF VD C AL  A+      ++ + +
Sbjct: 43  GSTVQGIKDRGVLRCGVEQNTLTMSAMDRDGEWRGFMVDLCHALGVALLGTTQDVEIIEV 102

Query: 84  NAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQL 143
           N   R+ AL+    D+L  N+ WTL RE +LG+ F     FDGQGF+ H K+G + +S  
Sbjct: 103 NKHLRYEALKGNAYDVLMSNSTWTLTRETALGVRFVTPYLFDGQGFLAHLKQGRTRLSAY 162

Query: 144 SGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYA 203
             A+ICV   TT+   L      H   +    F  +E +  ++ +  CD  + D   L +
Sbjct: 163 DKANICVLDSTTSLTNLKALLAQHYPHFTLTSFVTLERMRESFFSGNCDMLSSDRLVLAS 222

Query: 204 LKLT-NDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNIN 262
            +L        + IL DIIS+ PL P + QGD +W++++ W    ++ AE  G+T+ N++
Sbjct: 223 EQLVRGGEQGAYHILEDIISREPLGPYVRQGDEQWFSLLRWLVQGLLLAEHKGVTRDNVD 282

Query: 263 QVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKI 322
           +++  T + ++Q  LG+    N  +ALG+   W  R+IR +GN+ E++ RNLG  ++L +
Sbjct: 283 KLAGTTEDREIQHLLGV--VGNAHQALGVDAQWMRRVIRVVGNFEEIYQRNLGALAQLGV 340

Query: 323 PRGYNALWSKGGLMYAPPIR 342
            RGYN LW KGGL Y PP +
Sbjct: 341 RRGYNGLWYKGGLHYVPPFQ 360


>gi|87119292|ref|ZP_01075190.1| ABC glutamate/glutamine/aspartate/asparagine transporter,
           periplasmic substrate-binding protein [Marinomonas sp.
           MED121]
 gi|86165683|gb|EAQ66950.1| ABC glutamate/glutamine/aspartate/asparagine transporter,
           periplasmic substrate-binding protein [Marinomonas sp.
           MED121]
          Length = 344

 Score =  221 bits (564), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 116/337 (34%), Positives = 180/337 (53%), Gaps = 13/337 (3%)

Query: 10  LCLIILFFTSFSTNASI------LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDF 63
           L L IL F++ S  A I      L  + +RG L CG+       + +   G W+GF VDF
Sbjct: 11  LTLFILSFSTLSQAAQIIKPNSTLTQVIQRGDLNCGVFPDDPSRSAINLEGQWQGFYVDF 70

Query: 64  CRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITY 123
           CRA ++A+  D   + Y+ + A  RF  L   + D++  ++ WT  RE    L F  +  
Sbjct: 71  CRATAAAVLKDQEFVNYIEVGATTRFSTLVELKTDVVMYSSTWTHSREFQYQLDFPAVYL 130

Query: 124 FDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEID 183
           FDGQGFI+     I +++ L   ++CV   T+T   L D  ++  +K   I+F      D
Sbjct: 131 FDGQGFIVRAATNIQTINDLDNKTVCVTQNTSTHQNLVDLIESRELKTK-ILFSNG---D 186

Query: 184 AAYRAHRCDAYTGDISALYALKLT-NDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVS 242
           + +R   CDAYT D   L   +    D+P  + +LPD IS+ P+ P +   D +W  I+ 
Sbjct: 187 SFFRGGPCDAYTADRMNLATNRANRTDKPENYRLLPDTISREPIGPMVRNDDAQWSRIIR 246

Query: 243 WTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRH 302
              +A++ AEE  I   N++Q    + N +VQ  LG  K   IG+ LGL   W YR I+ 
Sbjct: 247 AVVHALILAEEKNINAANVDQALTQSKNAEVQNLLG--KKGEIGQQLGLDNQWAYRAIKA 304

Query: 303 MGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAP 339
           +GNYGE+++R+ G+ S++ + RG N  W++GG++YAP
Sbjct: 305 VGNYGEVYNRHFGSHSKIGVKRGINQPWNQGGILYAP 341


>gi|209546999|ref|YP_002278917.1| family 3 extracellular solute-binding protein [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|209538243|gb|ACI58177.1| extracellular solute-binding protein family 3 [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 345

 Score =  216 bits (550), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 113/318 (35%), Positives = 189/318 (59%), Gaps = 7/318 (2%)

Query: 25  SILGDIKKRGFLKCGINTGLVGFAEVKA-NGDWKGFDVDFCRALSSAIFDDPSKIQYLPL 83
           S+L  +K+RG L CG +    GF  +       +G DVD CRA ++A+  DP K+ ++ +
Sbjct: 27  SVLDSVKQRGVLNCGTDNTTPGFGYLNPKTSKMEGVDVDLCRATAAAVLGDPDKVNFVVV 86

Query: 84  NAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQL 143
             K RF A+Q+ Q+DI+  +T     R  +L + F P  +FDG G ++    G+ S++ L
Sbjct: 87  TDKSRFNAVQTGQVDIVYAHTSVFASRAAALAVDFLPSYFFDGGGVMVTAASGVKSINDL 146

Query: 144 SGASICVQAGTTTELTLADYFKAHNMKYHPIV-FERVEEIDAAYRAHRCDAYTGDISALY 202
           SGA+IC   G+ +E TLA   KA N+    I+ F+  E++ +A  + RC+    D SAL 
Sbjct: 147 SGATICTTQGSGSEATLAQEVKARNLTNTKILTFDTSEKLFSALTSGRCNGMYTDKSALA 206

Query: 203 ALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNIN 262
           A +  + + +++VILP+ ++ +P A  I+Q D EW  +++WT YA+  AEE GIT  N++
Sbjct: 207 AWRGNSQKSADYVILPETLAVAPFAGIIVQNDPEWRKLMTWTLYALFQAEEWGITSANLS 266

Query: 263 QVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKI 322
           ++ K + +P +Q+FLG++     G    ++  +   +I+ +GNYGE++DR+LG ++ L +
Sbjct: 267 EMQK-SADPAIQKFLGVN--GGFGADFHVSDSFIADMIKGVGNYGEIYDRSLGPKTPLYL 323

Query: 323 PRG--YNALWSKGGLMYA 338
            R    NAL   GGL+Y+
Sbjct: 324 ERDKTSNALSKNGGLLYS 341


>gi|329295742|ref|ZP_08253078.1| amino-acid ABC transporter-binding protein yhdW precursor [Plautia
           stali symbiont]
          Length = 216

 Score =  215 bits (547), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 94/218 (43%), Positives = 143/218 (65%), Gaps = 2/218 (0%)

Query: 114 LGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHP 173
           +G  F  + Y+DG GF+ HKK  + S  +L GA++C+Q GT TEL +ADYFKA+ M+Y P
Sbjct: 1   MGFLFAGVNYYDGIGFLTHKKASLKSAKELDGATVCIQVGTDTELNVADYFKANKMQYTP 60

Query: 174 IVFERVEEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQG 233
           + F+R +E   A  + RCD  + D S LYA ++   +P + ++L ++ISK PL P + +G
Sbjct: 61  VTFDRSDESAKALDSGRCDTLSSDQSQLYAQRIKLGKPDDFIVLAEVISKEPLGPVVRRG 120

Query: 234 DTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTK 293
           D +W+ IV W+ +AM+ AEE+GI+ K++++++   T PD+   LG +   + G+ L L  
Sbjct: 121 DDDWFTIVKWSLFAMLNAEEMGISSKSVDEMAAKPTTPDMAHLLGAE--GDFGKDLKLDN 178

Query: 294 DWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNALWS 331
              Y II+ +GNY E+FDRN+G  S LKI RG NALW+
Sbjct: 179 KCAYNIIKQVGNYQEVFDRNVGKDSALKIARGQNALWN 216


>gi|148240911|ref|YP_001220412.1| general L-amino acid-binding periplasmic protein [Bradyrhizobium
           sp. BTAi1]
 gi|146411287|gb|ABQ39740.1| General L-amino acid-binding periplasmic protein [Bradyrhizobium
           sp. BTAi1]
          Length = 339

 Score =  209 bits (532), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 112/318 (35%), Positives = 184/318 (57%), Gaps = 7/318 (2%)

Query: 25  SILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLN 84
           S++  IK+RG++ CG + G+ G +    NG ++GFD D CR  ++AI  D  KI+++PLN
Sbjct: 25  SVVNKIKQRGYVSCGASQGVPGLSRPDENGYYRGFDSDMCRTFAAAILGDKDKIRFVPLN 84

Query: 85  AKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLS 144
           A +RF ALQ+ +ID+LSR +  TL R+  +   +  IT +D  G ++ K   I+   QL+
Sbjct: 85  AGQRFPALQTGEIDVLSRTSTITLSRDTVVRFVW--ITLYDTDGLLVRKADKITDPKQLA 142

Query: 145 GASICVQAGTT-TELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYA 203
           G ++C+Q G + TE ++ +  + + +    + F+   +   A+   RCD Y  D +A   
Sbjct: 143 GKTVCLQGGGSLTERSIEETEEEYGITMKKVYFDSTIQARDAFFGGRCDTYVTDGTAAAG 202

Query: 204 LKLTNDR-PSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNIN 262
            + +  + P ++ I+    +  P   A+ +GD + ++I  WT  A++ AE  GIT +NI+
Sbjct: 203 QRASVAKNPDDYDIIKVGHAAEPNGVAVARGDDQLFDITRWTINALLWAELHGITARNID 262

Query: 263 QVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKI 322
           +  K + + +++R LG  +    G+ LGL   W Y +++ MGNY E++D NLG  S LKI
Sbjct: 263 EKLK-SGSIEIKRVLG--QEPGFGKPLGLDDKWVYNVVKQMGNYAEIWDNNLGKSSPLKI 319

Query: 323 PRGYNALWSKGGLMYAPP 340
            RG NALW  GGL Y  P
Sbjct: 320 DRGLNALWKDGGLNYPYP 337


>gi|197104926|ref|YP_002130303.1| ABC-type amino acid transport/signal transduction systems,
           periplasmic component/domain [Phenylobacterium zucineum
           HLK1]
 gi|196478346|gb|ACG77874.1| ABC-type amino acid transport/signal transduction systems,
           periplasmic component/domain [Phenylobacterium zucineum
           HLK1]
          Length = 310

 Score =  208 bits (529), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 108/314 (34%), Positives = 183/314 (58%), Gaps = 10/314 (3%)

Query: 30  IKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERF 89
           +K R ++ CG + G+ G +     G W+GFDVD CRA ++A+  D  KI+++PLNA +R 
Sbjct: 1   MKGRDYVTCGASQGITGLSRPDERGVWRGFDVDVCRAFAAALLGDAQKIRFIPLNAAQRL 60

Query: 90  LALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASIC 149
            ALQ+ +ID+LSR T  T  R+++  + F  +T FD    I  K+ G +S + L+G ++C
Sbjct: 61  PALQTGEIDVLSRTTTMTFTRDMA--VRFVTVTQFDTDVLIFRKRLGAASPADLNGRTVC 118

Query: 150 VQA-GTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGD--ISALYALKL 206
           +Q+ G++ + TL        +++  + F+       AY + RCD Y  D  + A     +
Sbjct: 119 LQSGGSSADNTLTRVEAEAKIRFERVYFDSTITARDAYFSARCDVYVTDGFLGASQVATV 178

Query: 207 TNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSK 266
             D P +H +L  +    P   AI +GD  W+++V WT   ++ AE+ G+TQ N++++ +
Sbjct: 179 ARD-PDDHALLY-LDHLLPQGVAIARGDDRWFDVVRWTVNLLIWAEQNGVTQANVDELRR 236

Query: 267 DTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGY 326
            +   DV+R LG D +   G A+GL  DW Y++++ +GNYGE+++RNLG ++ +K  R  
Sbjct: 237 -SGPADVRRVLGADPA--FGRAIGLEPDWGYQVLKQVGNYGEIWERNLGARTRIKADRRL 293

Query: 327 NALWSKGGLMYAPP 340
           N  +  GGL++  P
Sbjct: 294 NRPYKDGGLLFPYP 307


>gi|83593850|ref|YP_427602.1| extracellular solute-binding protein [Rhodospirillum rubrum ATCC
           11170]
 gi|83576764|gb|ABC23315.1| extracellular solute-binding protein, family 3 [Rhodospirillum
           rubrum ATCC 11170]
          Length = 373

 Score =  208 bits (529), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 111/323 (34%), Positives = 171/323 (52%), Gaps = 7/323 (2%)

Query: 23  NASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLP 82
           N   L  I+ RG + CG N  + GF    ++G+W+GF +DFCRAL++A   DP+  + +P
Sbjct: 55  NGDTLTSIRDRGSVTCGTNP-IPGFGFPDSDGNWRGFFIDFCRALAAATLGDPTAFEVVP 113

Query: 83  LNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQ 142
           + +  R+ AL S   D+    + WTL R+ +LG  F  +  +DGQ F+        SV  
Sbjct: 114 VESNSRWEALNSHTTDVNVDGSTWTLSRDTALGFDFPGVLIYDGQRFLAKPSVPEGSVKA 173

Query: 143 LSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGD---IS 199
            +G  +C+  GTT E+ L D+ K ++++   I  E  E    ++   RC+ +  D   ++
Sbjct: 174 AAGLRVCIIMGTTAEVNLRDFLKKNDLEMTVIATESDEGAWTSFLKGRCELFVNDGIGLA 233

Query: 200 ALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQK 259
              AL +T   P  + ++ + ISK PL P +   D +W  I  W    ++ AEE GI+  
Sbjct: 234 LRNALHMTP--PRVNHLMTEAISKEPLGPVVRGDDHQWLEINRWVLNVLIAAEEAGISST 291

Query: 260 NINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSE 319
            +   S         R   +    +   ALGL   W  R+I  +GNYGE+FDRNLG  SE
Sbjct: 292 TLVDPSPTADLSSEDRVF-VGGPEDNAAALGLEPGWARRVIAAVGNYGEVFDRNLGKGSE 350

Query: 320 LKIPRGYNALWSKGGLMYAPPIR 342
           + + RG NALWS+GGLM +PP++
Sbjct: 351 IGLDRGVNALWSEGGLMISPPLQ 373


>gi|56697219|ref|YP_167584.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Ruegeria pomeroyi DSS-3]
 gi|56678956|gb|AAV95622.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Ruegeria pomeroyi DSS-3]
          Length = 333

 Score =  198 bits (503), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 104/315 (33%), Positives = 172/315 (54%), Gaps = 18/315 (5%)

Query: 30  IKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERF 89
           I+ RG+L CG+ +  +GFA ++ +G+W GFDVDFCRA+++A+  D + ++++PL++  R 
Sbjct: 31  IRDRGYLLCGVGSDDLGFATLRFDGEWTGFDVDFCRAVAAAMLGDATAVEFVPLDSLNRL 90

Query: 90  LALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASIC 149
             L   ++D+L R T +T  R+++  L F  ITY+D Q  +++   G  ++S L+G ++C
Sbjct: 91  EVLARGEVDVLFRTTTFTFDRDVNAALEFPAITYYDSQKVLVYADTGARTLSDLAGKTVC 150

Query: 150 VQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTND 209
             +GTT+   +     +         +        A+    C+A T D S L A+  +  
Sbjct: 151 ANSGTTSITNIRHRIDSLGGGIGIQEYASQAGRWRAFFGRECEAVTADGSDLAAMMAS-- 208

Query: 210 RPS---EHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSK 266
           RP    + V+L D I+  PL P + + D +W  IV W     + AE  GI Q        
Sbjct: 209 RPGYRDDFVLLEDEIANEPLGPVVREDDRQWEQIVRWVINLTLVAETAGIGQ-------- 260

Query: 267 DTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGY 326
             ++P+    L +   ++    LG+   W   +IR +GNY ++F RNLG+ SEL++ RG 
Sbjct: 261 -VSDPEEIARLALPAGAD----LGVVDTWGAEVIRQVGNYDDIFRRNLGDGSELRMERGR 315

Query: 327 NALWSKGGLMYAPPI 341
           NALW+ GGLMY  P+
Sbjct: 316 NALWTDGGLMYPLPM 330


>gi|67923106|ref|ZP_00516597.1| Hemolysin-type calcium-binding region:Bacterial extracellular
           solute-binding protein, family 3 [Crocosphaera watsonii
           WH 8501]
 gi|67855059|gb|EAM50327.1| Hemolysin-type calcium-binding region:Bacterial extracellular
           solute-binding protein, family 3 [Crocosphaera watsonii
           WH 8501]
          Length = 712

 Score =  197 bits (501), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 113/324 (34%), Positives = 182/324 (56%), Gaps = 14/324 (4%)

Query: 26  ILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNA 85
           +L +IK RG LK GIN    GF+    NG + GFDVD  +A++ A+F+D +KI+++    
Sbjct: 212 LLQEIKDRGILKLGINGQKPGFSFPDENGSYIGFDVDLGKAIAVAVFNDSNKIEFVERED 271

Query: 86  KERFLA-LQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLS 144
           +  +L  + +  +D+ +      L+R+   G+ F     + GQGF++ K  GI +++ L+
Sbjct: 272 RVTWLTNVANGVVDVTAAQVTQNLVRDGKAGVDFISPYLYTGQGFLVRKDSGILNLATLN 331

Query: 145 GASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYAL 204
           G  + + +GTT E  L D  K +   + P+ ++ ++E+ A Y     DA   D+  L  L
Sbjct: 332 GHEVGLFSGTTAEQNLQDAMKEYGGTFIPVYYDNLDEMLAGYAQGDIDAIINDLPLLGGL 391

Query: 205 KLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQV 264
             T   P EH++L D+ISK PL+  + +  ++W + VSW  Y ++ AEE GITQ NI+Q+
Sbjct: 392 IDTFSNPDEHLLLDDVISKEPLSMVVDENQSDWKDAVSWVQYGLLQAEEYGITQDNIDQI 451

Query: 265 SKDTT--NPD------VQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGN 316
             D T  NPD       + FLGI+   N GE LGL  D+   +I+ +GNYGE+++R+   
Sbjct: 452 LADNTDSNPDNDSDISTRIFLGIE--GNAGELLGLENDYMVNVIKAVGNYGEIYERHF-- 507

Query: 317 QSELKIPRGYNALWSKGGLMYAPP 340
            S++ +PR +N L    GL    P
Sbjct: 508 DSDI-LPRDFNQLSGDFGLQIPYP 530



 Score =  120 bits (302), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 70/196 (35%), Positives = 107/196 (54%), Gaps = 15/196 (7%)

Query: 153 GTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTNDRPS 212
           G+T    L     ++ +++ P  +E    + A Y A   DA + D S +Y    T   P 
Sbjct: 4   GSTALTNLEILLSSNGVEFEPRFYESTSAMFADYDAGNIDALSTDRSLIYGRLDTLSEPD 63

Query: 213 EHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQ---VSKDT- 268
            H IL    S  P+A  + + D++W N+V W   A + AEELG+   NI Q   V+KD  
Sbjct: 64  AHHILDVEFSSEPIAMVLPEDDSQWNNVVKWVINATIEAEELGLNSDNIEQILAVNKDEN 123

Query: 269 ----TNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPR 324
               ++P ++RFLGI+  S +GEALGL  D+ Y I++ +GNY E++DR+  +     + R
Sbjct: 124 PNNDSDPAIRRFLGIE--SQLGEALGLPNDFAYNIVKLVGNYDEIYDRHFPD-----LER 176

Query: 325 GYNALWSKGGLMYAPP 340
             N L+S GGL+Y+PP
Sbjct: 177 DRNLLYSDGGLLYSPP 192


>gi|144897558|emb|CAM74422.1| ABC-type amino acid transport/signal transduction systems,
           periplasmic component/domain [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 335

 Score =  197 bits (500), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 117/320 (36%), Positives = 172/320 (53%), Gaps = 16/320 (5%)

Query: 26  ILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNA 85
           +L  +  RG + CG++    GF      G   G +VD CRA+++AI  +P  IQ   +  
Sbjct: 29  VLDRVLTRGKVVCGVDQ-TPGFGGFDDRGVPVGLEVDLCRAIAAAILKNPQAIQVQRVTT 87

Query: 86  KERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSG 145
           K +F AL   ++D+    T WT  R+ ++  +F  I ++DGQGF+   K    +    + 
Sbjct: 88  KYKFHALAEGELDVAFGMTTWTFDRDTTMMASFPAIAFYDGQGFM---KWADIADPWAAT 144

Query: 146 ASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALK 205
           ++ICVQ+GTT+   LA+Y          +     EE  +A+   RC A TGD + L   K
Sbjct: 145 STICVQSGTTSANNLAEYLSRRKSAAKVLALSSSEEKFSAFAERRCTAVTGDSTELAVQK 204

Query: 206 LTNDRPSEH---VILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNIN 262
             N R +     V+L  IIS+ PL PAI   D EW++IV W+    + AE  G+ + N+ 
Sbjct: 205 --NRRSATQPSWVLLETIISREPLGPAIFNNDPEWFSIVRWSMLIPIIAEARGLGRYNLE 262

Query: 263 QVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKI 322
            V    T+ +++R LG  +    G  L L + W  RII  +GNYGE+F RNL   + L I
Sbjct: 263 SVP--ATDAELRRLLG--EEPGFGANLRLDQAWARRIIASVGNYGEIFARNL---APLGI 315

Query: 323 PRGYNALWSKGGLMYAPPIR 342
            RG NALWS+GGL+YAPP+R
Sbjct: 316 VRGQNALWSEGGLLYAPPLR 335


>gi|256376161|ref|YP_003099821.1| extracellular solute-binding protein family 3 [Actinosynnema mirum
           DSM 43827]
 gi|255920464|gb|ACU35975.1| extracellular solute-binding protein family 3 [Actinosynnema mirum
           DSM 43827]
          Length = 319

 Score =  196 bits (497), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 100/325 (30%), Positives = 172/325 (52%), Gaps = 7/325 (2%)

Query: 17  FTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPS 76
            T+ ++ +  +  I++RG L+ G++TG+ G +     G  +G DVD  RA+++A+F +P 
Sbjct: 1   MTTSASLSPTVSAIRRRGHLRLGVSTGIRGLSWTDDAGVRRGLDVDTGRAVAAALFGEPG 60

Query: 77  KIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKG 136
           +I+Y  ++ ++R  A+ S  +D+L+ N  WT  RE    +AF   T +D    ++ +  G
Sbjct: 61  RIEYTEIDPEDRIRAVTSDAVDLLACNATWTFSRECDANVAFVLTTCYDEGAILVRRDSG 120

Query: 137 ISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTG 196
           I+S   L G ++ +  GT++E  L  +F       H   +       AAY +     Y  
Sbjct: 121 IASADDLDGHTLGMCEGTSSEEALRAWFGPRGRAVHCKHYASPAAALAAYASGEVTGYVA 180

Query: 197 DISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGI 256
           D   +   +     PS+HV+LP+ +S  P+ P +   D +W     W  +A++ AE  G+
Sbjct: 181 DGVVVAGERTRLATPSDHVVLPERVSVEPMGPVVKDDDPQWVKTARWVFFALIAAEAAGV 240

Query: 257 TQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGN 316
           T   +   + +  +P +     +   S +    GL   W   ++  +GNYGE+++RNLG+
Sbjct: 241 TSHQVRAGTAE--DPPL-----LKDQSRLAAKAGLHPRWISAVVGEVGNYGEIYERNLGD 293

Query: 317 QSELKIPRGYNALWSKGGLMYAPPI 341
            S L+IPRGYN LW +GGLMYAPP+
Sbjct: 294 ASGLRIPRGYNELWLRGGLMYAPPL 318


>gi|254464335|ref|ZP_05077746.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Rhodobacterales bacterium Y4I]
 gi|206685243|gb|EDZ45725.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [Rhodobacterales bacterium Y4I]
          Length = 333

 Score =  194 bits (493), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 111/344 (32%), Positives = 181/344 (52%), Gaps = 25/344 (7%)

Query: 6   FVSILCLIILFFTSFSTNASILGD----IKKRGFLKCGINTGLVGFAEVKANGDWKGFDV 61
           F+S L L +    +    A   GD    I+ RG+L CG+ +  +GFA ++ +G+W GFDV
Sbjct: 4   FLSALTLGLWLAGALGAEAG-EGDTGAAIRDRGYLLCGVGSDDLGFATLRYDGEWTGFDV 62

Query: 62  DFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPI 121
           DFCRA+++A+  D + ++++PL++  R   L   ++D+L R T +T  R+++  L F  I
Sbjct: 63  DFCRAVAAAMLGDATAVEFVPLDSLNRLEVLARGEVDVLFRTTTFTFDRDVNAALEFPAI 122

Query: 122 TYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEE 181
           T++D Q  +++   G  +++ L+G ++C  +GTT+   +     +         +     
Sbjct: 123 TFYDSQKVLVYADTGARTLADLAGKTVCANSGTTSITNIRHRIDSLGGGIGIQEYASQAG 182

Query: 182 IDAAYRAHRCDAYTGDISALYALKLTNDRPS---EHVILPDIISKSPLAPAIIQGDTEWY 238
              A+    C+A T D S L A+  +  RP    + V+L D I+  PL P + + D +W 
Sbjct: 183 RWRAFFGRECEAVTADGSDLAAMLAS--RPGYRDDFVLLEDEIANEPLGPVVREDDRQWE 240

Query: 239 NIVSWTHYAMVTAEELGITQKNINQVSKDTTNP-DVQRFLGIDKSSNIGEALGLTKDWTY 297
            IV W     + AE  GI Q         T+ P ++ R          G  LG+   W  
Sbjct: 241 QIVRWVINLTLVAEAAGIGQ---------TSGPAEIARL-----PLPAGADLGVAGTWGA 286

Query: 298 RIIRHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPI 341
            +IR +GNY ++F RNLG+ SEL++ RG NALW+ GGLMY  P+
Sbjct: 287 DVIRQVGNYDDIFSRNLGDGSELRMARGRNALWTDGGLMYPLPM 330


>gi|288962134|ref|YP_003452429.1| ABC transporter amino-acid binding protein [Azospirillum sp. B510]
 gi|288914400|dbj|BAI75885.1| ABC transporter amino-acid binding protein [Azospirillum sp. B510]
          Length = 352

 Score =  193 bits (490), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 108/328 (32%), Positives = 172/328 (52%), Gaps = 10/328 (3%)

Query: 19  SFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKI 78
           +++ +   L  I  RGFL CG+ +G+ G +     G   GF VD CR  ++A   +   I
Sbjct: 31  AWAGDGDTLERIHGRGFLICGLRSGVSGISFSDPQGHLDGFLVDVCRVFAAATLGNAQAI 90

Query: 79  QYLPLNAK-ERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKK-KG 136
           + + L  K + F A++  ++D+    T WT  R++S  + F      DGQGF +H     
Sbjct: 91  RVVRLPEKPQEFQAVEKHEVDVALTTTTWTFSRDLSNDIEFLMPLLHDGQGFAIHSDGTP 150

Query: 137 ISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTG 196
              + +L   ++CV+  TTT   L D+ +  ++ +    F+ ++E   A+ AH CD  T 
Sbjct: 151 PPPLDRLGPRTVCVKTATTTVRNLEDHIRKSDLPWTMRTFQTLDEALQAFLAHECDLLTT 210

Query: 197 DISALYALKLTNDRPSEH--VILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEEL 254
           D + L    L   R +     I PD+IS+ PL P I +GD  WY++  W  +A+V A+  
Sbjct: 211 DRTVLVT-SLAGYRKAGMGIYIYPDVISREPLTPYIARGDRNWYDVTRWILHAIVLADAR 269

Query: 255 GITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNL 314
           G+T  ++ Q  +   +P++ R LG   S N    LGL  DW  + +  +GNYGE+F+RNL
Sbjct: 270 GVTSADV-QAGRVPDDPELHRMLG--HSGNAARMLGLPDDWALQALAQVGNYGEIFERNL 326

Query: 315 GNQSELKIPRGYNALWSKGGLMYAPPIR 342
           G    +   RG N  W++GGL+Y+PP R
Sbjct: 327 GIPYGMD--RGPNKPWTQGGLLYSPPFR 352


>gi|119488696|ref|ZP_01621705.1| extracellular solute-binding protein, family 3 [Lyngbya sp. PCC
           8106]
 gi|119455119|gb|EAW36260.1| extracellular solute-binding protein, family 3 [Lyngbya sp. PCC
           8106]
          Length = 607

 Score =  190 bits (482), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 104/324 (32%), Positives = 181/324 (55%), Gaps = 17/324 (5%)

Query: 23  NASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQY-L 81
           N ++L ++  RGF++ G+     G    + NG+  GFDVD  RAL++++F DP+ +++ +
Sbjct: 293 NRNVLQEVLDRGFVRVGVRNDAQGLGFAEENGNLTGFDVDLGRALAASLFGDPNAVEFVI 352

Query: 82  PLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVS 141
                +RF  + +  +D+ SRN    L R+  LG+ F PI  +D Q  +     GI+++ 
Sbjct: 353 QTTGSQRFSDVANGVVDVTSRNATHNLRRDALLGVDFAPINTYDAQFVVTPTASGITTLE 412

Query: 142 QLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGD---- 197
           QL+G  I V AGTT+E  L +   A  +    +  +  + I  +Y     DA TGD    
Sbjct: 413 QLAGGRIGVSAGTTSETRLQEKLSAAGINAEVVALDNFQTIFDSYINGELDAITGDGGLI 472

Query: 198 ISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGIT 257
           IS+L  L +  ++ S+H   P+++ + PLA  + +  ++W ++VS   YA+  A ELG+T
Sbjct: 473 ISSLLTLPV--EQRSQHQPFPEVLGEEPLAMVVDENQSQWKDVVSGVTYAVTEALELGLT 530

Query: 258 QKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNL-GN 316
            +N+     +++NP ++RFLG++   N+GE+LGL  D+    I  +GNY EM +RN  G 
Sbjct: 531 SENVT-AELESSNPVIRRFLGVE--GNVGESLGLPNDFALNAISAVGNYREMTERNFPGI 587

Query: 317 QSELKIPRGYNALWSKGGLMYAPP 340
           + E  +P      +++GG +++ P
Sbjct: 588 ELEGILP------YTEGGTLFSVP 605



 Score =  170 bits (431), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 94/282 (33%), Positives = 158/282 (56%), Gaps = 9/282 (3%)

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
           +D+ RAL++A+FD+P+ ++++ + A E F ++ S  +DI +     ++LR+ +LG+ F P
Sbjct: 3   IDYSRALATALFDNPNSVEFVVVEAGEDFNSVASGTVDIAATLPTHSVLRDATLGVDFSP 62

Query: 121 ITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVE 180
             +FD QG ++    GI+SV QL   ++ V AGT ++  L D  +   +  +   F   +
Sbjct: 63  TVFFDTQGVLVRGDSGINSVEQLQETTVGVLAGTRSQQNLEDAAQRAGITLNIQTFPSQD 122

Query: 181 EIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNI 240
           ++ AAY A    + + +   L     T   P   VIL + I K PLA  + + ++E+ ++
Sbjct: 123 DLFAAYDAGEIGSVSINRGVLSNRIPTLSNPGNQVILEENIGKEPLAFIVPENESEFADV 182

Query: 241 VSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRII 300
           V W   A + AE  GI  +N+N+      N D++RFLG+  S N+GE+LG+  D+   II
Sbjct: 183 VRWVVNAPIQAEFFGINSQNVNEFLDG--NSDIKRFLGV--SGNLGESLGIDNDFALNII 238

Query: 301 RHMGNYGEMFDRNLGNQSELKIPRGYNALW--SKGGLMYAPP 340
           + +GNY E+++RN     E  +PR  N L     GGL+Y PP
Sbjct: 239 QQVGNYEEIYNRNF---DETALPRNLNELMFVEPGGLVYYPP 277


>gi|7381255|gb|AAF61456.1|AF139661_1 putative amino acid ABC transporter binding protein [Azospirillum
           brasilense]
          Length = 236

 Score =  190 bits (482), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 97/236 (41%), Positives = 138/236 (58%), Gaps = 4/236 (1%)

Query: 108 LLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLS-GASICVQAGTTTELTLADYFKA 166
           L R+ + G+ F  +  FDGQGFI H+ +GI+ +S L  GAS+CV   TTT   L D+   
Sbjct: 1   LQRDATFGIDFPAVYLFDGQGFIAHRAQGIARLSDLPPGASVCVIEQTTTLRNLEDWMAR 60

Query: 167 HNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTNDRPSE-HVILPDIISKSP 225
             +++        E   +A+  H CD YT D   L+A +L      E +VILP+ ISK P
Sbjct: 61  TGLRFRLKPVRSTEGALSAFFNHHCDLYTSDRIGLHAQRLLKAPEREDYVILPEAISKEP 120

Query: 226 LAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNI 285
           L P +   +  W+++V W   A V AEE GIT  N  ++ ++  +P+V+RFLG   ++ +
Sbjct: 121 LGPMVRPDERRWFDVVRWVFLATVLAEEKGITTANAARLKEEAQDPEVRRFLG--ATAGV 178

Query: 286 GEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPI 341
           G  LGL   W +R++  +GNYGE+FDR+LG  S L I RG N LW  GGL YAPP+
Sbjct: 179 GWGLGLDDGWAFRVVTQVGNYGEIFDRHLGAASPLGIDRGMNGLWMNGGLHYAPPL 234


>gi|300721866|ref|YP_003711144.1| putative Amino-acid binding protein [Xenorhabdus nematophila ATCC
           19061]
 gi|297628361|emb|CBJ88926.1| putative Amino-acid binding protein [Xenorhabdus nematophila ATCC
           19061]
          Length = 323

 Score =  187 bits (476), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 105/320 (32%), Positives = 170/320 (53%), Gaps = 7/320 (2%)

Query: 24  ASILGDIKKRGFLKCGINTGLVGFA-EVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLP 82
           ++++  IK    L  G++ G  G +     N  W+GFD+D  +A++ A+  +  KI ++P
Sbjct: 4   SAVIQRIKTHNILNAGVSLGFRGLSFRDNYNSQWEGFDIDLAKAVAIAVLGNSKKINFIP 63

Query: 83  LNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQ 142
           L +  RF AL+   ID+   N+  T   E    ++F     FDG+  + H+   I++VS+
Sbjct: 64  LQSGNRFQALKDNIIDLGCFNSSITFQSESEYNVSFAHPMLFDGEVLMTHENNLINNVSE 123

Query: 143 LSGA---SICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDIS 199
                   I    G+TT+  L  YF    +  + ++FE  ++   AY+   C+ Y  D  
Sbjct: 124 ARSTKKREIAAMRGSTTQENLERYFAELGLNCNIMLFESPQDAREAYQKGICNIYCLDSY 183

Query: 200 ALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQK 259
            L   ++  + P +H+ L D IS   ++PA+   D +W+  VSW   A++ AE LGIT+ 
Sbjct: 184 LLAGERIQLEAPEKHLFLKDRISLEAMSPAVSLHDPQWHASVSWIMKALIEAENLGITRN 243

Query: 260 NINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSE 319
           N+N     +T   + +FL    S  +   LGL  ++TY+IIR +GNYGE+F+RNLG  S 
Sbjct: 244 NVNDKYNISTGY-INKFL--KPSEELCNNLGLQTEFTYKIIRELGNYGEIFERNLGKSSI 300

Query: 320 LKIPRGYNALWSKGGLMYAP 339
           L   R  N  WSKGG++Y+P
Sbjct: 301 LNQERKDNKPWSKGGMLYSP 320


>gi|113478121|ref|YP_724182.1| Na-Ca exchanger/integrin-beta4 [Trichodesmium erythraeum IMS101]
 gi|110169169|gb|ABG53709.1| Na-Ca exchanger/integrin-beta4 [Trichodesmium erythraeum IMS101]
          Length = 3427

 Score =  187 bits (474), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 116/324 (35%), Positives = 174/324 (53%), Gaps = 13/324 (4%)

Query: 26   ILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNA 85
            +L  IK+RG LK G+     GFA   +NG+++GFDVD  +A+++AIF DP K++    + 
Sbjct: 2868 LLAKIKERGVLKLGLPDNEPGFAVKMSNGEYEGFDVDLGKAIAAAIFGDPEKLEVKTQSF 2927

Query: 86   KERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSG 145
            K+ F    +  +DI +      L+R+ SLG+ F PI  + GQG ++    GI+ +  L+G
Sbjct: 2928 KDSFANTANGVVDISAMGITHNLVRDASLGIDFGPIYLYTGQGVLVRNDSGITVLPALNG 2987

Query: 146  ASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALK 205
              + V  G T+   + D          P  F   +E+ AAY     DA   D++ L    
Sbjct: 2988 RRVGVLEGATSLQNIQDTITELGGDIIPAEFTTNDEMFAAYDDGDIDAVITDMTILNGRV 3047

Query: 206  LTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVS 265
                 P EH IL DI+SK PL   I +  +EW ++V W   A+V AEE  IT KNI ++ 
Sbjct: 3048 QNLSNPKEHKILDDILSKEPLGLIIDENQSEWSDVVRWVTNALVQAEEYDITSKNIKRLM 3107

Query: 266  KDTTNPD--------VQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQ 317
             +  + D        V++FLGI+   NIG+ LGL  D+   +I+ +GNYGE+++R     
Sbjct: 3108 ANNLDDDPNNDSDPVVRQFLGIE--GNIGKVLGLPNDFVPNVIKAVGNYGEIYERYF--D 3163

Query: 318  SELKIPRGYNALWSKGGLMYAPPI 341
            S L +PR  N L+S  GL YA P+
Sbjct: 3164 SNL-LPREQNELFSNFGLQYALPL 3186



 Score =  175 bits (443), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 106/324 (32%), Positives = 168/324 (51%), Gaps = 27/324 (8%)

Query: 25   SILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLN 84
            +IL DI KRG +K  I+            G    FD++F   +++A+F D SK++ +   
Sbjct: 2546 TILDDIIKRGQIKVAIS------------GSGNEFDLEFAEVIAAAVFGDASKVKSITSK 2593

Query: 85   AKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLS 144
              + F  +   + D+ ++    TL R+  L + F P   FD Q  I+     I++VS L+
Sbjct: 2594 FSKSFELVADGKADLAAQRITATLGRDGELNVDFAPTYLFDYQTVIVPNDSDITNVSHLN 2653

Query: 145  GASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYAL 204
              +I V  GTT  + L +  +   +K+ P +FE  EE+ AAY A   DAY+ D S +   
Sbjct: 2654 EQTIGVIEGTTALINLQNQLEVEGIKFTPKLFETAEEMIAAYDAGEVDAYSHDRSLILEN 2713

Query: 205  KLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQV 264
                 +P  H +L   +SK P++ A+ + D++W ++V W  Y  + AEE GI+ +NI + 
Sbjct: 2714 LDQLSQPENHRLLDVELSKEPISLALPENDSQWADVVRWAGYVPIQAEEFGISSQNIAEF 2773

Query: 265  ----SKDTTNPD----VQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGN 316
                + D    D    ++RFLGI+   N+GE LGL  D+   II  +GNY E++DR+   
Sbjct: 2774 IALNTDDNPTNDSSLGIRRFLGIE--GNLGETLGLPNDFAVNIINQVGNYSEIYDRHFSG 2831

Query: 317  QSELKIPRGYNALWSKGGLMYAPP 340
                 I    N+LWS GG +Y+PP
Sbjct: 2832 -----IEGDRNSLWSDGGFLYSPP 2850


>gi|327395693|dbj|BAK13115.1| general L-amino acid-binding periplasmic protein AapJ precursor
           [Pantoea ananatis AJ13355]
          Length = 323

 Score =  186 bits (472), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 110/321 (34%), Positives = 166/321 (51%), Gaps = 11/321 (3%)

Query: 25  SILGDIKKRGFLKCGINTGLVGFAEVKA-NGDWKGFDVDFCRALSSAIFDDPSKIQYLPL 83
           +++  I++   L  G++ G  G ++    N  W GFD+D  RA++ ++  D  KI ++PL
Sbjct: 5   AVIKRIEQHDVLNVGVSLGFKGLSQRDPLNNSWNGFDIDLARAVAISVLGDGGKIHFIPL 64

Query: 84  NAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQ- 142
            + +RF AL+   ID+ + N   T  RE   G+ F     FDG+  +  +        Q 
Sbjct: 65  QSADRFQALRDGVIDLGTFNASVTFQREAEYGINFLHPMLFDGEVLMTPRSNLTEETPQA 124

Query: 143 --LSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISA 200
                  I    G+TTE  L  YF   N+    ++F+  ++   AY +  CD Y  D   
Sbjct: 125 RFTRQRRIAAMRGSTTEENLTRYFDELNLPCEILLFDSPQQARQAYESGECDIYCLDGYL 184

Query: 201 LYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKN 260
           L          S+H+IL D IS   +APA+   D++WY    W   A++ AE LGITQKN
Sbjct: 185 LAGEHHQLTDSSQHLILDDRISLEAMAPAVSASDSQWYIATKWVMRALIEAENLGITQKN 244

Query: 261 INQVSKDTTNPD--VQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQS 318
           I + S    NP+  ++ FL  D   N+   LGL  D+   IIR +GNYGE+F+RNLG  S
Sbjct: 245 ILEKSD---NPEGYLKTFLYPD--VNLCSQLGLQPDFIREIIRKIGNYGEIFERNLGKNS 299

Query: 319 ELKIPRGYNALWSKGGLMYAP 339
           ELK  R  N  W++GG++++P
Sbjct: 300 ELKQQRRDNKPWAEGGMLWSP 320


>gi|282899859|ref|ZP_06307820.1| hypothetical protein CRC_01252 [Cylindrospermopsis raciborskii
            CS-505]
 gi|281195129|gb|EFA70065.1| hypothetical protein CRC_01252 [Cylindrospermopsis raciborskii
            CS-505]
          Length = 9381

 Score =  184 bits (466), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 106/329 (32%), Positives = 171/329 (51%), Gaps = 17/329 (5%)

Query: 25   SILGDIKKRGFLKCGI----NTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQY 80
            ++L +I+ RGF+K G+     +G  GFAE+ + G +KGFDVD  +A+++A+F DPSK++Y
Sbjct: 8644 NLLAEIQNRGFIKYGLPQITGSGFPGFAEIDSQGQYKGFDVDLSKAIAAAVFGDPSKVEY 8703

Query: 81   LPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSV 140
                    F    +  +D+ +      L+R+  LG+ + P+    GQG +  K  GI+ +
Sbjct: 8704 TQQAFANSFANTANGLVDVSAAGYTGNLMRDAGLGVDYSPVYIHTGQGILTRKDSGITGI 8763

Query: 141  SQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISA 200
            + L+G++I      T    L+D  K          F+   ++ AAY     DA   D + 
Sbjct: 8764 ATLNGSTIGALTTVTAIENLSDLTKKFGSTIIITPFDDKNKMYAAYEKGEIDAVYNDKTL 8823

Query: 201  LYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKN 260
            L  +  T   P  H ILP+  SK PL   + +  ++W ++V W   ++V AEE GIT  N
Sbjct: 8824 LAGIIPTLSDPQAHEILPETFSKEPLTLILDENQSDWADVVRWVMNSLVQAEEYGITSTN 8883

Query: 261  INQV-----SKDTTN---PDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDR 312
            I+ +       D  N    ++Q FLG+    N G +LGL+ D+  ++I+ +GNYGE++ R
Sbjct: 8884 IDDIIAKNRDNDPNNNSIKEIQAFLGL--QGNPGASLGLSSDFVVKMIKAVGNYGEIYAR 8941

Query: 313  NLGNQSELKIPRGYNALWSKGGLMYAPPI 341
            N        +PR  N L+   GL YA P+
Sbjct: 8942 NFDTN---ILPREKNDLYHFSGLQYALPL 8967



 Score =  152 bits (385), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 96/329 (29%), Positives = 172/329 (52%), Gaps = 29/329 (8%)

Query: 25   SILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLN 84
            ++L +I++RG+++         F+  +++     FD  F RA+++AIF D +++  +P  
Sbjct: 8315 NLLAEIQQRGYIR---------FSGGRSDSISGVFDYQFVRAIAAAIFGDANRVDQVPGT 8365

Query: 85   AKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLS 144
              E F  + +KQ+D+ +R+    L+R+  L + F P+ Y+D    ++  K GI     L+
Sbjct: 8366 FSESFSQVANKQVDLSTRHITQNLVRDGELNVDFGPVYYYDFLSVLVRNKSGIQGAKDLN 8425

Query: 145  GASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALY-A 203
            G  I V   TT    L +   +  +++   VF+   ++ AAY     DA   D   +Y A
Sbjct: 8426 GKKIGVVKNTTALTNLDNLLDSIGVQFTAEVFDTQNDLYAAYNLGEVDAIASDKGIIYDA 8485

Query: 204  LK---LTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKN 260
            L+   L N +  EH  L    SK P+   I + ++EW ++V W  Y  + AEE GI  +N
Sbjct: 8486 LEREILENKQ--EHRFLDIQFSKEPIGLVIPENESEWGDVVRWVVYTTIQAEEYGINSQN 8543

Query: 261  INQV--------SKDTTNPDVQRFLGIDK-SSNIGEALGLTKDWTYRIIRHMGNYGEMFD 311
            I+++        SK+ ++P ++RFLG++    ++G AL L +D+  ++I+ +GNYGE++ 
Sbjct: 8544 IDRLLADNTDDNSKNDSDPAIRRFLGLEGLEGSLGSALELPQDFVVQVIKQVGNYGEIYQ 8603

Query: 312  RNLGNQSELKIPRGYNALWSKGGLMYAPP 340
            R+        + R  N L   GGL+ + P
Sbjct: 8604 RSFP-----SLTRDLNLLSLTGGLLESLP 8627


>gi|256395455|ref|YP_003117019.1| extracellular solute-binding protein family 3 [Catenulispora
           acidiphila DSM 44928]
 gi|256361681|gb|ACU75178.1| extracellular solute-binding protein family 3 [Catenulispora
           acidiphila DSM 44928]
          Length = 321

 Score =  182 bits (462), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 100/315 (31%), Positives = 161/315 (51%), Gaps = 19/315 (6%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           L   +  G ++  ++ G+ G +   A G W+G D D  RA+++A   D   + +L     
Sbjct: 25  LAAARATGTVRAVVSRGIRGLSSPDAAGVWRGLDTDMARAVAAAAIGDGEAVSWLSTEPA 84

Query: 87  ERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGA 146
            R   L + + D++  N  WTL RE + G+ F  +T +DG+GF++    GI+  +QL+G 
Sbjct: 85  ARLDRLVAGEADLVVSNLTWTLGRETA-GVLFAGVTCYDGEGFLVRASDGITDPAQLAGR 143

Query: 147 SICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKL 206
            +  QAGTT+   LA +F +  +   PI +    +  A Y +  C AY  D  AL   + 
Sbjct: 144 QVATQAGTTSAANLAAWFGSRGLAVTPIAYPTPADALAGYASGDCAAYVLDCVALAGERA 203

Query: 207 TNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSK 266
             D P EH IL   IS+ P+A A+   D EW+ +  W    ++ AE      ++  + ++
Sbjct: 204 ALDDPGEHRILDTTISREPMAMAVRDDDAEWFRLCRWVLQFLIAAEH----AEDPAEAAR 259

Query: 267 DTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGY 326
           D              +   G ALGL ++W  R++  +G YG+++ RNLG  S L +PRG 
Sbjct: 260 D--------------AGRHGPALGLDENWAARVLDAVGTYGDVYARNLGPASGLDVPRGL 305

Query: 327 NALWSKGGLMYAPPI 341
           NALW++GGL Y  P+
Sbjct: 306 NALWTEGGLHYPMPL 320


>gi|291619370|ref|YP_003522112.1| AapJ [Pantoea ananatis LMG 20103]
 gi|291154400|gb|ADD78984.1| AapJ [Pantoea ananatis LMG 20103]
          Length = 323

 Score =  182 bits (462), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 108/321 (33%), Positives = 164/321 (51%), Gaps = 11/321 (3%)

Query: 25  SILGDIKKRGFLKCGINTGLVGFAEVKA-NGDWKGFDVDFCRALSSAIFDDPSKIQYLPL 83
           +++  I++   L  G++ G  G ++    N  W GFD+D  RA++ ++  D  KI ++PL
Sbjct: 5   AVIKRIEQHDVLNVGVSLGFKGLSQRDPLNNSWNGFDIDLARAVAISVLGDGGKIHFIPL 64

Query: 84  NAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQ- 142
            + +RF AL+   ID+ + N   T  RE   G+ F     FDG+  +  +        Q 
Sbjct: 65  QSADRFQALRDGVIDLGTFNASVTFQREAEYGINFLHPMLFDGEVLMTPRSNLTEETPQA 124

Query: 143 --LSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISA 200
                  I    G+TTE  L  YF   N+    ++F+  ++   AY +  CD Y  D   
Sbjct: 125 RFTRQRRIAAMRGSTTEENLTRYFDELNLPCEILLFDSPQQARQAYESGECDIYCLDGYL 184

Query: 201 LYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKN 260
           L          S+H+IL D IS   +APA+   D++WY    W   A++ AE LGITQK 
Sbjct: 185 LAGEHHQLTDSSQHLILDDRISLEAMAPAVSASDSQWYIATKWVMRALIEAENLGITQKT 244

Query: 261 INQVSKDTTNPD--VQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQS 318
             + S    NP+  ++ FL  D   N+   LGL  D+   IIR +GNYGE+F+RNLG  S
Sbjct: 245 FLEKSD---NPEGYLKTFLYPD--VNLCSQLGLQPDFIREIIRKIGNYGEIFERNLGKNS 299

Query: 319 ELKIPRGYNALWSKGGLMYAP 339
           ELK  R  N  W++GG++++P
Sbjct: 300 ELKQQRRDNKPWAEGGMLWSP 320


>gi|260223278|emb|CBA33680.1| General L-amino acid-binding periplasmic protein aapJ [Curvibacter
           putative symbiont of Hydra magnipapillata]
          Length = 173

 Score =  181 bits (460), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 85/175 (48%), Positives = 118/175 (67%), Gaps = 3/175 (1%)

Query: 169 MKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALK-LTNDRPSEHVILPDIISKSPLA 227
           M   PIVFE++E  + AY + RC AYT D S L + +      P++HVILP++ISK PL 
Sbjct: 1   MNIKPIVFEKLEAAEGAYFSGRCVAYTTDASGLASTRNKVAKNPADHVILPELISKEPLG 60

Query: 228 PAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGE 287
           P + +GD EW  IV WT Y ++ AEE G+TQ N++ +  +T +P V R LG   + + G+
Sbjct: 61  PMVRRGDDEWTAIVKWTVYGLLEAEENGVTQANVDDLKANTKDPVVGRLLGT--TEDTGK 118

Query: 288 ALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
            LGL K+W  R I+  GNYGE+F+RN+G +S L++PRG N LWSKGG+ YAPP+R
Sbjct: 119 LLGLDKEWLARAIKTTGNYGEIFERNVGPKSPLQLPRGLNNLWSKGGVQYAPPVR 173


>gi|262165601|ref|ZP_06033338.1| amino acid ABC transporter amino acid-binding protein [Vibrio
           mimicus VM223]
 gi|262025317|gb|EEY43985.1| amino acid ABC transporter amino acid-binding protein [Vibrio
           mimicus VM223]
          Length = 166

 Score =  181 bits (460), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 82/169 (48%), Positives = 115/169 (68%), Gaps = 3/169 (1%)

Query: 174 IVFERVEEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQG 233
           +VF+   +    + A RCD  T D S LYAL+L  ++P   ++LP+IISK PL P + Q 
Sbjct: 1   MVFDTAAQTSKGFDAGRCDVLTTDQSGLYALRLNLEKPDSALVLPEIISKEPLGPVVRQD 60

Query: 234 DTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTK 293
           D +W+N+  W  YAMV AEE GIT KN++++ K + NP+V+R LG+D     G  LG+  
Sbjct: 61  DDKWFNVAKWVLYAMVNAEEYGITSKNVDEMMK-SDNPEVKRILGLDGPK--GTGLGIRD 117

Query: 294 DWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           DW+Y+I++ +GNYGE F+R +G+ S L+I RG NALW+ GG MYAPPIR
Sbjct: 118 DWSYQIVKQVGNYGESFERTVGSGSPLQIDRGVNALWNAGGFMYAPPIR 166


>gi|71735465|ref|YP_276122.1| amino-acid binding protein [Pseudomonas syringae pv. phaseolicola
           1448A]
 gi|71556018|gb|AAZ35229.1| amino-acid binding protein, putative [Pseudomonas syringae pv.
           phaseolicola 1448A]
          Length = 317

 Score =  179 bits (454), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 108/318 (33%), Positives = 175/318 (55%), Gaps = 6/318 (1%)

Query: 23  NASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLP 82
           +AS+  DIKKRG+L+ G++ GL+G +   + G+W GFDVD  RA+S AIF D   I+Y P
Sbjct: 2   DASVF-DIKKRGYLRVGVSLGLIGLSSKNSEGEWSGFDVDLARAVSVAIFGDDQCIEYFP 60

Query: 83  LNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQ 142
           L + +RF ALQ   ID+   N+  T  RE    + F     FDG+  +M K  G  S   
Sbjct: 61  LASNDRFDALQQNIIDLGCFNSSITFSRETISEVKFCHPMLFDGE-MLMTKSAGGMSRPI 119

Query: 143 LSGA-SICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISAL 201
           +SG   +    G+TT   L  YF+  N+K    +++  ++   AY    C+ Y  D   L
Sbjct: 120 VSGEIRVAALEGSTTGDNLNRYFREQNLKGVVHLYKTFDDARNAYNLDVCNYYCLDGYLL 179

Query: 202 YALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNI 261
              +       +HVIL  +IS+  ++PA +   T+  + V+W   +++ +E +GI   N+
Sbjct: 180 SGEQTKLRDSRDHVILEQMISREAMSPATLSSKTQLTSAVTWVLRSIIESENIGINSHNL 239

Query: 262 NQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELK 321
           N    +  N  ++++L  D    I   LG++  +T  +++++GNY E+F+R+LG++S L+
Sbjct: 240 NAF-YELENWYIRKYLHPDP--RISSKLGISPSFTADVVKNVGNYEEIFERHLGSKSILR 296

Query: 322 IPRGYNALWSKGGLMYAP 339
             R  N L S GGL+Y+P
Sbjct: 297 QTRRENRLRSVGGLLYSP 314


>gi|193083904|gb|ACF09583.1| amino acid ABC transporter periplasmic amino acid-binding protein
           [uncultured marine group II euryarchaeote KM3-72-G3]
          Length = 470

 Score =  179 bits (454), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 117/363 (32%), Positives = 178/363 (49%), Gaps = 46/363 (12%)

Query: 21  STNASILGDIKKRGFLKCGINTGLVGFAEVKAN-GDWKGFDVDFCRALSSAIFDDP-SKI 78
           +T  S L  I  RG +KCG+     G   + A  G   G D+ +CRA+++A+  +P + +
Sbjct: 113 ATPVSTLDTIVDRGSMKCGVKESQYGMGYLDAGTGVRSGLDISYCRAVAAALGLNPDTDV 172

Query: 79  QYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKK--- 135
           +Y+P +  +RF  L S  ID+L R T WT  R+  L   F  + +FDGQG ++       
Sbjct: 173 EYIPASGSDRFDKLASGTIDVLIRTTTWTTSRDADLNADFAGMNFFDGQGILVRSDAYEY 232

Query: 136 GISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYT 195
           G  S  QL+ A ICV  GTTTE  + D+F + N+++  +      E  A +    CDA+T
Sbjct: 233 GTGSADQLNNAEICVGIGTTTEGNMVDWFSSRNIQFTSVPVADAAEATAKFIDGSCDAFT 292

Query: 196 GDISALYALKLTNDRPSEHV----------ILPDIISKSPLAPAIIQGDTEWYNIVSWTH 245
           GD+SA+ A K   D  +  V          I  +++SK PL  A    D+++ ++V+W  
Sbjct: 293 GDMSAMVAKKWQLDGDASMVDDNGDPVSIWIAQELMSKEPLGAATRDMDSDFKDVVAWVW 352

Query: 246 YAMVTAEELGIT----------QKNINQVSKDTTNPDVQRFLGIDKSSNIGEALG---LT 292
           Y MVTAEE+G+T             +N+    T++P + R L    + N+G       L 
Sbjct: 353 YGMVTAEEMGVTAANAADSAATACALNEGGA-TSDPGMCRLL----TENLGLGTATNPLA 407

Query: 293 KDWTYRIIRHMGNYGEMFDRNLGN-----------QSELKIPRG--YNALWSKGGLMYAP 339
            DW   ++   GNYGE +D    +            S   I R    NAL S+GG+ YAP
Sbjct: 408 GDWMQAVLATAGNYGEAYDDAFCDGTYDGVSGSDAMSGCLISRSGTLNALVSEGGIQYAP 467

Query: 340 PIR 342
            +R
Sbjct: 468 AMR 470


>gi|320106917|ref|YP_004182507.1| family 3 extracellular solute-binding protein [Terriglobus
           saanensis SP1PR4]
 gi|319925438|gb|ADV82513.1| extracellular solute-binding protein family 3 [Terriglobus
           saanensis SP1PR4]
          Length = 336

 Score =  177 bits (450), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 106/339 (31%), Positives = 179/339 (52%), Gaps = 9/339 (2%)

Query: 7   VSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRA 66
           VS+L L +    +     + L  ++  G L CG+      +     +G   GFD+D C+A
Sbjct: 4   VSLLLLAVCSSLTLGAQQT-LQKVRAAGVLTCGVIAEDAEYNTEDDHGSRGGFDLDLCKA 62

Query: 67  LSSAIFDDPSKIQYLP-LNAKERFLALQSKQIDILSR-NTDWTLLREISLGLAFRPITYF 124
           ++ A   + ++ + +  L+ K    AL + +ID+++  + D++     SLG +  P+ Y 
Sbjct: 63  VAVAALGEKAQTKVITFLDDKSGVDALIAGKIDLIATLSADFSHTTNASLGES-APVLY- 120

Query: 125 DGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDA 184
           DG GF++ +K GI+  + L+   +C  A T  E  L  +F   ++   P  F+   E++A
Sbjct: 121 DGVGFLVLRKSGIAHAADLTHRKVCFLAETNVETALQAWFTRQHLDLLPFPFQEEGEMEA 180

Query: 185 AYRAHRCDAYTGDISALYALKLT-NDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSW 243
           AY    C A  GD++ L   + +   +  +H+ILP++I+  PLA A    D +W  IV W
Sbjct: 181 AYITKNCAAIAGDLTRLAQTRASFETQAPDHMILPEVIAADPLAFAYRSSDPQWGRIVDW 240

Query: 244 THYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHM 303
           T   +   E LG+T  NI+ +S  + +P V+  LG   +  +G  LGL++DW   ++R +
Sbjct: 241 TAQVLFHGEALGVTSANID-ISAKSADPAVRHLLG--ATHAVGTPLGLSEDWAASVLRSV 297

Query: 304 GNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           GNY E+FDR  G  S L + RG N L S+GGL+   P++
Sbjct: 298 GNYREVFDRTFGEASTLSLTRGRNRLTSEGGLILPLPLK 336


>gi|161170240|gb|ABX59211.1| substrate-binding protein [uncultured marine group II euryarchaeote
           EF100_57A08]
          Length = 439

 Score =  177 bits (450), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 121/349 (34%), Positives = 183/349 (52%), Gaps = 40/349 (11%)

Query: 30  IKKRGFLKCGINTGLVGFAEV-KANGDWKGFDVDFCRALSSAIFDDP-SKIQYLPLNAKE 87
           I +RG LKCG+     G   +  A G   G D+ +CRAL++AI  DP + I+++P ++++
Sbjct: 95  ILERGMLKCGVKESQYGMGYLDSATGVRSGLDISYCRALAAAIGLDPMTDIEFVPASSQD 154

Query: 88  RFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKK---KGIS-SVSQL 143
           RF  L S +ID+L R T WT  R+  L   F  + +FDGQG ++ +    +G++ + + L
Sbjct: 155 RFEKLASGEIDVLIRTTTWTTSRDADLNADFAGMNFFDGQGILIREDTYPQGLTQTATML 214

Query: 144 SGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYA 203
           + A +CV  GTTTE  LAD+  ++++    I      E  A  ++  CDA+TGD+SA+ A
Sbjct: 215 TSAKVCVGTGTTTEGNLADFDTSNSVGMDIIGVVDAAEGTAKLQSGECDAFTGDMSAMVA 274

Query: 204 LK--LTND--------RPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEE 253
            K  L ND         P    I P+I+SK PL  A    D +W ++V+W  Y MVTAEE
Sbjct: 275 KKWALDNDGTVVDDNGDPVGLWIAPEILSKEPLGAATRDNDDDWNDVVAWVWYGMVTAEE 334

Query: 254 LGITQKNINQVSKDTT----NPDVQRFLGIDKSSNIG---EALGLTKDWTYRIIRHMGNY 306
            GIT  N   ++ D      NP   R +    ++N+G   +A  L   W   ++  +GNY
Sbjct: 335 YGITSANYMTMASDAAAEGGNPGHNRLM----NTNLGLGTDANPLADTWMQAVMGAVGNY 390

Query: 307 GEMFDRNLGNQSE-------------LKIPRGYNALWSKGGLMYAPPIR 342
           GE +D    + +              L      NAL S+GGL +APP+R
Sbjct: 391 GEAYDDAFCDGTYDGSSGSDTMTGCLLDRAGTANALVSEGGLQFAPPMR 439


>gi|193083731|gb|ACF09418.1| amino acid ABC transporter periplasmic amino acid-binding protein
           [uncultured marine group II euryarchaeote
           SAT1000-15-B12]
          Length = 374

 Score =  177 bits (448), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 115/334 (34%), Positives = 173/334 (51%), Gaps = 25/334 (7%)

Query: 25  SILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLN 84
           S L  I  RG +KCG+     G   +  +G + G D+++C+AL++AI  D   I+Y+   
Sbjct: 50  STLDTIIARGSMKCGVKDSQFGMGFLNDDGTYSGLDIEYCKALAAAIGVD--SIEYILAT 107

Query: 85  AKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKK----GISSV 140
              RF  L S +ID+L R T WT  R+  L   F  + ++DGQG +++       G +S 
Sbjct: 108 GSNRFELLASHEIDVLIRTTTWTTSRDAGLNADFAGMNFYDGQGMLVNTGPDHFPGATSA 167

Query: 141 SQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISA 200
             L GA+ICV  GTTTE  L DY++ + M+   I  E        +    C  +TGD+SA
Sbjct: 168 LDLDGANICVGIGTTTEGNLLDYYELNQMQMTTINTENAAAAQENFLDGSCGVWTGDMSA 227

Query: 201 LYA-LKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQK 259
           + A +    D      I+P+++SK PL  A    D +W ++V+W  Y M+TAEE GI   
Sbjct: 228 MVARMYGLRDEGMSLAIMPELLSKEPLGAATRDNDDDWNDVVAWVWYGMITAEEFGIDGS 287

Query: 260 NINQVSKDTTNPDVQRFLGIDKSSNIGEALG-----LTKDWTYRIIRHMGNYGEMFDRNL 314
           N      ++ NP + R L    +SN+G  LG     L+  W   ++  +GNY + +DR+ 
Sbjct: 288 NYMDF-VNSENPGINRLL----NSNLG--LGTDDNPLSDTWMQSVLGAVGNYHDAYDRSF 340

Query: 315 ----GNQSELKIPRG--YNALWSKGGLMYAPPIR 342
               G  +   I R    NAL S+GG+ YAPP+R
Sbjct: 341 CDGDGGMNNCLISRAGTLNALVSEGGIQYAPPMR 374


>gi|320327184|gb|EFW83198.1| amino-acid binding protein, putative [Pseudomonas syringae pv.
           glycinea str. race 4]
          Length = 317

 Score =  177 bits (448), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 107/318 (33%), Positives = 175/318 (55%), Gaps = 6/318 (1%)

Query: 23  NASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLP 82
           +AS+  DIKKRG+L+ G++ GL+G +   + G+W GFDVD  RA+S AIF D   I+Y P
Sbjct: 2   DASVF-DIKKRGYLRVGVSLGLIGLSSKNSEGEWSGFDVDLARAVSVAIFGDDQCIEYFP 60

Query: 83  LNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQ 142
           L + +RF ALQ   ID+   N+  T  RE    + F     FDG+  +M K  G  S   
Sbjct: 61  LASNDRFDALQQNIIDLGCFNSSITFSRETISEVKFCHPMLFDGE-MLMTKSAGGMSRPI 119

Query: 143 LSGA-SICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISAL 201
           +SG   +    G+TT   L  YF+  ++K    +++  ++   AY    C+ Y  D   L
Sbjct: 120 VSGEIRVAALEGSTTGDNLNRYFREQHLKGVVHLYKTFDDARNAYNLDVCNYYCLDGYLL 179

Query: 202 YALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNI 261
              +       +HVIL  +IS+  ++PA +   T+  + V+W   +++ +E +GI   N+
Sbjct: 180 SGEQTKLRDSRDHVILEQMISREAMSPATLSSKTQLTSAVTWVLRSIIESENIGINSHNL 239

Query: 262 NQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELK 321
           N    +  N  ++++L  D    I   LG++  +T  +++++GNY E+F+R+LG++S L+
Sbjct: 240 NAF-YELENWYIRKYLHPDP--RISSKLGISPSFTADVVKNVGNYEEIFERHLGSKSILR 296

Query: 322 IPRGYNALWSKGGLMYAP 339
             R  N L S GGL+Y+P
Sbjct: 297 QTRRENRLRSVGGLLYSP 314


>gi|320325529|gb|EFW81591.1| amino-acid binding protein, putative [Pseudomonas syringae pv.
           glycinea str. B076]
          Length = 346

 Score =  177 bits (448), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 107/318 (33%), Positives = 174/318 (54%), Gaps = 6/318 (1%)

Query: 23  NASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLP 82
           +AS+  DIKKRG+L+ G++ GL+G +   + G+W GFDVD  RA+S AIF D   I+Y P
Sbjct: 31  DASVF-DIKKRGYLRVGVSLGLIGLSSKNSEGEWSGFDVDLARAVSVAIFGDDQCIEYFP 89

Query: 83  LNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQ 142
           L + +RF ALQ   ID+   N+  T  RE    + F     FDG+  +M K  G  S   
Sbjct: 90  LASNDRFDALQQNIIDLGCFNSSITFSRETISEVKFCHPMLFDGE-MLMTKSAGGMSRPI 148

Query: 143 LSGA-SICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISAL 201
           +SG   +    G+TT   L  YF+  N+K    +++  ++   AY    C+ Y  D   L
Sbjct: 149 VSGEIRVAALEGSTTGDNLNRYFREQNLKGVVHLYKTFDDARNAYNLDVCNYYCLDGYLL 208

Query: 202 YALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNI 261
              +       +HVIL  +IS+  ++PA +    +  + V+W   +++ +E +GI   N+
Sbjct: 209 SGEQTKLRDSRDHVILEQMISREAMSPATLSSKIQLTSAVTWVLRSIIESENIGINSHNL 268

Query: 262 NQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELK 321
           N    +  N  ++++L  D    I   LG++  +T  +++++GNY E+F+R+LG++S L+
Sbjct: 269 NAF-YELENWYIRKYLHPDP--RISSKLGISPSFTADVVKNVGNYEEIFERHLGSKSILR 325

Query: 322 IPRGYNALWSKGGLMYAP 339
             R  N L S GGL+Y+P
Sbjct: 326 QTRRENRLRSVGGLLYSP 343


>gi|297192982|ref|ZP_06910380.1| ABC transporter amino acid-binding protein [Streptomyces
           pristinaespiralis ATCC 25486]
 gi|197723387|gb|EDY67295.1| ABC transporter amino acid-binding protein [Streptomyces
           pristinaespiralis ATCC 25486]
          Length = 352

 Score =  176 bits (447), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 100/317 (31%), Positives = 162/317 (51%), Gaps = 19/317 (5%)

Query: 25  SILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLN 84
           + L   K RG ++  ++ G+ G +     G W G D D  RA+++A  +D   I ++P+ 
Sbjct: 54  ATLRSAKVRGAVRVAVSQGVRGLSLRTPAGRWTGLDTDIARAVAAAALEDAEAIDWVPVR 113

Query: 85  AKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLS 144
           A +R   L+S + D+   N  WT+ RE +  + F  IT +DG+GF++    G++  + L+
Sbjct: 114 ATDRLRTLESGRADLTVCNLTWTMGREATGAVLFAGITCYDGEGFLVRAADGLADPADLA 173

Query: 145 GASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYAL 204
           G  + V  G TT + L  ++    ++  P+ F+   +  AAY    C AY  D +AL   
Sbjct: 174 GRRLAVHNGCTTVVNLESWYGPLGLEVEPVGFDDPADALAAYACGDCAAYVLDRTALAGA 233

Query: 205 KLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQV 264
           +    RP +H ILP  IS+ P+A A+ + D  W+ +V W    +V AE  G         
Sbjct: 234 RACLPRPQDHRILPVSISREPMAAAVHEADPHWFRLVRWVLQLLVAAEHEG--------- 284

Query: 265 SKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPR 324
                 P+    L    +   G + GL + W  R++  +G YG++++RNLG  S L +PR
Sbjct: 285 ------PEAAARL----AGPHGPSAGLDEKWADRVLSAVGTYGDVYERNLGAASGLDVPR 334

Query: 325 GYNALWSKGGLMYAPPI 341
           G N LW+ GGL YA P+
Sbjct: 335 GVNELWTAGGLHYAVPL 351


>gi|193084366|gb|ACF10022.1| amino acid ABC transporter periplasmic amino acid-binding protein
           [uncultured marine group II euryarchaeote AD1000-18-D2]
          Length = 394

 Score =  176 bits (447), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 117/353 (33%), Positives = 178/353 (50%), Gaps = 35/353 (9%)

Query: 21  STNASILGDIKKRGFLKCGINTGLVGFAEVKAN-GDWKGFDVDFCRALSSAIFDDP-SKI 78
           +T  S L  I  RG +KCG+     G   + A  G   G D+ +CRA+++A+  +P + +
Sbjct: 46  ATPVSTLDTIIDRGSMKCGVKESQYGMGYLDAGTGVRSGLDISYCRAVAAALGLNPDTDV 105

Query: 79  QYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKK--- 135
           +Y+P +  +RF  L S  ID+L R T WT  R+  L   F  + +FDGQG ++ +     
Sbjct: 106 EYIPASGSDRFDKLASGTIDVLIRTTTWTTSRDADLNADFAGMNFFDGQGILVREDAYSA 165

Query: 136 --GISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDA 193
               +S   L GA+ICV  GTTTE  + D+F + N+ +  +      E  A +    CDA
Sbjct: 166 AGAGNSAGGLDGANICVGIGTTTEGNMVDWFSSRNIAFTSVPVADAAEATAKFIDGSCDA 225

Query: 194 YTGDISALYALK--LTNDRPSEHV---ILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAM 248
           +TGD+SA+ A K  L  D     V   I  +++SK PL  A    D+++ ++V+W  Y M
Sbjct: 226 FTGDMSAMVAKKWQLDGDGSMNGVDIWIAQELMSKEPLGAATRDMDSDFKDVVAWVWYGM 285

Query: 249 VTAEELGITQKNINQVSK---DTTNPDVQRFLGIDKSSNIG---EALGLTKDWTYRIIRH 302
           VTAEE+G+T  N    +    D ++P + R L    + N+G    A  L  DW   ++  
Sbjct: 286 VTAEEMGVTAANAADSAAAACDGSDPGMCRLL----TENLGLGTAANPLAGDWMQAVLAT 341

Query: 303 MGNYGEMFDRNLGN-----------QSELKIPRG--YNALWSKGGLMYAPPIR 342
            GNYGE +D    +            +   I R    NAL S+GG+ YAP +R
Sbjct: 342 AGNYGEAYDDAFCDGTYDGVSGSDAMTGCLISRSGTLNALVSEGGIQYAPAMR 394


>gi|193084292|gb|ACF09951.1| amino acid ABC transporter periplasmic amino acid-binding protein
           [uncultured marine group II euryarchaeote KM3-130-D10]
          Length = 394

 Score =  176 bits (445), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 117/353 (33%), Positives = 178/353 (50%), Gaps = 35/353 (9%)

Query: 21  STNASILGDIKKRGFLKCGINTGLVGFAEVKAN-GDWKGFDVDFCRALSSAIFDDP-SKI 78
           +T  S L  I  RG +KCG+     G   + A  G   G D+ +CRA+++A+  +P + +
Sbjct: 46  ATPVSTLDTIIDRGSMKCGVKESQYGMGYLDAGTGVRSGLDISYCRAVAAALGLNPDTDV 105

Query: 79  QYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKK---- 134
           +Y+P +  +RF  L S  ID+L R T WT  R+  L   F  + +FDGQG ++ +     
Sbjct: 106 EYIPASGSDRFDKLASGTIDVLIRTTTWTTSRDADLNADFAGMNFFDGQGILVREDVFPA 165

Query: 135 -KGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDA 193
               +S   L GA+ICV  GTTTE  + D+F + N+ +  +      E  A +    CDA
Sbjct: 166 AAAGNSAGGLDGANICVGIGTTTEGNMVDWFSSRNIAFTSVPVADAAEATAKFIDGSCDA 225

Query: 194 YTGDISALYALK--LTNDRPSEHV---ILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAM 248
           +TGD+SA+ A K  L  D     V   I  +++SK PL  A    D+++ ++V+W  Y M
Sbjct: 226 FTGDMSAMVAKKWQLDGDDSMGGVDIWIASELMSKEPLGAATRDMDSDFKDVVAWVWYGM 285

Query: 249 VTAEELGITQKNINQVSK---DTTNPDVQRFLGIDKSSNIG---EALGLTKDWTYRIIRH 302
           VTAEE+G+T  N    +    D ++P + R L    + N+G    A  L  DW   ++  
Sbjct: 286 VTAEEMGVTAANAAASAAAACDGSDPGMCRLL----TENLGLGTAANPLAGDWMQAVLAT 341

Query: 303 MGNYGEMFDRNLGN-----------QSELKIPR--GYNALWSKGGLMYAPPIR 342
            GNYGE +D    +            +   I R    NAL S+GG+ YAP +R
Sbjct: 342 AGNYGEAYDDAFCDGTYDGVSGSAAMTGCLISRVGTLNALVSEGGIQYAPAMR 394


>gi|170516837|gb|ACB15239.1| hypothetical protein [uncultured marine group II euryarchaeote
           DeepAnt-15E7]
          Length = 393

 Score =  173 bits (439), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 113/362 (31%), Positives = 180/362 (49%), Gaps = 46/362 (12%)

Query: 21  STNASILGDIKKRGFLKCGINTGLVGFAEVKAN-GDWKGFDVDFCRALSSAIFDDP-SKI 78
           +T  S L  I  RG +KCG+     G   + A  G   G D+ +CR +++A+  +P + +
Sbjct: 38  ATPVSTLDTIIARGSMKCGVKESQYGMGYLDAGTGVRSGLDISYCRGVAAALGLNPDTDV 97

Query: 79  QYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHK----- 133
           +Y+P +  +RF  L S  ID+L R T WT  R+  L   F  + +FDGQG ++ +     
Sbjct: 98  EYIPASGSDRFDKLASGTIDVLIRTTTWTTSRDADLNADFAGMNFFDGQGILVREDAFGA 157

Query: 134 KKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDA 193
           +   +S S L+GA+ICV  GTTTE  + D+F +  + +  +      E  A +    CDA
Sbjct: 158 EASGNSASALNGANICVGIGTTTEGNMVDWFSSRGIAFTSVPVADAAEATAKFIDGSCDA 217

Query: 194 YTGDISALYALK--------LTNDRPSEHV---ILPDIISKSPLAPAIIQGDTEWYNIVS 242
           +TGD+SA+ A K        +  D   + +   I  +++SK PL  A    D+++ ++V+
Sbjct: 218 FTGDMSAMVAKKWQLDGDASMGVDENGDAIGIWIASELMSKEPLGAATRDMDSDFKDVVA 277

Query: 243 WTHYAMVTAEELGITQKNINQVSK----DTTNPDVQRFLGIDKSSNIGEALG-----LTK 293
           W  Y MVTAEE+G+T  N    +     D ++P + R L    + N+G  LG     L  
Sbjct: 278 WVWYGMVTAEEMGVTAANAAASATAACADGSDPGMCRLL----TENLG--LGTATNPLAG 331

Query: 294 DWTYRIIRHMGNYGEMFDRNLGNQSELKIPRG-------------YNALWSKGGLMYAPP 340
           DW   ++   GNYGE +D    + +   +                 NAL S+GG+ YAP 
Sbjct: 332 DWMQAVLATAGNYGEAYDDAFCDGTYDGVSGSAAMTGCLISRVGTLNALVSEGGIQYAPA 391

Query: 341 IR 342
           +R
Sbjct: 392 MR 393


>gi|288962967|ref|YP_003453261.1| general L-amino acid transport system substrate-binding protein
           [Azospirillum sp. B510]
 gi|288915233|dbj|BAI76717.1| general L-amino acid transport system substrate-binding protein
           [Azospirillum sp. B510]
          Length = 353

 Score =  173 bits (439), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 101/327 (30%), Positives = 166/327 (50%), Gaps = 12/327 (3%)

Query: 18  TSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSK 77
           ++ +T+  +L +I++RG ++CG++    GFA     G   GF VD CRAL++A+      
Sbjct: 31  SARATDRPVLAEIERRGVVRCGVSFN-PGFAANDDGGRPVGFMVDLCRALAAAVLGKADA 89

Query: 78  IQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGI 137
           I+   L+  + F A+ + ++D+    T WTL R+++  + F P  ++D QG    +    
Sbjct: 90  IEIRRLSKPQEFDAVAAGEVDVSFAQTSWTLTRDVTHAVDFGPPVFYDVQGIAAWRLPDG 149

Query: 138 SSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGD 197
            S       ++C+ AGTTT+  +          +    F    +   A+ +  C A   D
Sbjct: 150 GSALDGGELTVCMPAGTTTQAEMESLIAGGKRPWKLRSFPGWPDALEAFLSRDCAALGAD 209

Query: 198 ----ISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEE 253
                +AL+ L L  D  S  +    + S+ PLAP     D  W   V WT +A+  A++
Sbjct: 210 RAQLTTALHMLGLPPD--SLEITDAPLASREPLAPMTPNSDRNWMAAVRWTMFALFLADD 267

Query: 254 LGITQKNINQVSKDTTNPDVQRFL-GIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDR 312
            G++  N N   + T   +++R L GI +   +    GL  DW Y+ +  +GNYGE+FDR
Sbjct: 268 AGVSGANAN-FQRITGGSEMRRLLSGIPE---VAAKAGLRPDWAYQAVVQVGNYGEIFDR 323

Query: 313 NLGNQSELKIPRGYNALWSKGGLMYAP 339
           NLG +S  K+ RG N  W++GGL+YAP
Sbjct: 324 NLGARSPFKLERGLNRPWTQGGLLYAP 350


>gi|159904020|ref|YP_001551364.1| hypothetical protein P9211_14791 [Prochlorococcus marinus str. MIT
           9211]
 gi|159889196|gb|ABX09410.1| Hypothetical protein P9211_14791 [Prochlorococcus marinus str. MIT
           9211]
          Length = 215

 Score =  172 bits (435), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 88/215 (40%), Positives = 131/215 (60%), Gaps = 6/215 (2%)

Query: 130 IMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAH 189
           ++ K   ISS+  L    ICV +GTTTE  + D F+A ++ Y PI ++ + ++ A Y   
Sbjct: 1   MVKKNSSISSIDDLVNQPICVGSGTTTEQNINDAFEARSIPYTPIKYQDLNQVVAGYLQG 60

Query: 190 RCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMV 249
           RC A T D S L A +     P EH+IL DI+SK PLAPA +  D +  + + W  Y+++
Sbjct: 61  RCAAMTSDRSQLAAARSGFSNPKEHIILKDILSKEPLAPASLGADQKLGDAMRWVIYSLI 120

Query: 250 TAEELGITQKNINQVSKDT-TNPDVQ---RFLGIDKSSNIGEALGLTKDWTYRIIRHMGN 305
           +AEE GIT+ NIN+  K    NP ++   RFLG++   ++GE +GL   +   +IR  GN
Sbjct: 121 SAEEKGITKVNINEKLKTAKANPQLKPLRRFLGVE--GDLGEKIGLDNSFVVNVIRATGN 178

Query: 306 YGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPP 340
           YGE+++R+LG  S + IPRG N L+ KGG+  +PP
Sbjct: 179 YGEIYNRHLGPNSNVPIPRGLNELYIKGGVQISPP 213


>gi|47079429|gb|AAT10172.1| periplasmic substrate binding protein [uncultured marine group II
           euryarchaeote DeepAnt-JyKC7]
          Length = 373

 Score =  167 bits (423), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 106/311 (34%), Positives = 164/311 (52%), Gaps = 26/311 (8%)

Query: 21  STNASILGDIKKRGFLKCGINTGLVGFAEVKAN-GDWKGFDVDFCRALSSAIFDDP-SKI 78
           +T  S L  I  RG +KCG+     G   + A  G   G D+ +CR +++A+  +P + I
Sbjct: 46  ATPVSTLDTIIARGSMKCGVKESQYGMGYLDAGTGVRSGLDISYCRGVAAALGLNPDTDI 105

Query: 79  QYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKK---- 134
           +Y+P +  +RF  L S  ID+L R T WT  R+  L   F  + +FDGQG ++ +     
Sbjct: 106 EYIPASGSDRFDKLASGTIDVLIRTTTWTTSRDADLNADFAGMNFFDGQGILVREDVFPA 165

Query: 135 -KGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDA 193
               +S + L+GA+ICV  GTTTE  + D+F + N+ +  +      E  A +    CDA
Sbjct: 166 ADAGNSAAGLNGANICVGIGTTTEGNMVDWFSSRNIAFTSVPVADAAEATAKFIDGSCDA 225

Query: 194 YTGDISALYALK--LTNDRPSEHV---ILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAM 248
           +TGD+SA+ A K  L  D     V   I  +++SK PL  A    D+++ ++V+W  Y M
Sbjct: 226 FTGDMSAMVAKKWQLDGDDSMGGVGIWIAQELMSKEPLGAATRDMDSDFKDVVAWVWYGM 285

Query: 249 VTAEELGITQKNINQVSK---DTTNPDVQRFLGIDKSSNIGEALGLTKD-----WTYRII 300
           VTAEE G+T  N   ++    D ++P V R L    + N+G  LG T +     W   ++
Sbjct: 286 VTAEENGVTAANAADMAAAACDGSDPGVCRLL----TENLG--LGTTDNPLAGTWMQAVL 339

Query: 301 RHMGNYGEMFD 311
           +  GNYGE +D
Sbjct: 340 QAAGNYGEAYD 350


>gi|261883825|ref|ZP_06007864.1| Solute-binding protein/glutamate receptor [Campylobacter fetus
           subsp. venerealis str. Azul-94]
          Length = 173

 Score =  151 bits (382), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 99/155 (63%)

Query: 65  RALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYF 124
           RA+S+A+F DP K+ ++PL+ KERF ALQS  +D+LS  T WTL R+  +G+ F    Y+
Sbjct: 1   RAVSAAVFGDPDKVSFIPLSTKERFTALQSGTVDLLSCQTTWTLSRDAGMGIHFVGTAYY 60

Query: 125 DGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDA 184
           DGQGF++ K  G+ S  +L GASIC + GTTTE  +ADY  AHN+KY P+V +  + +  
Sbjct: 61  DGQGFMIRKDLGVDSALKLDGASICTEQGTTTEQNVADYCGAHNIKYEPVVIDSADGLLK 120

Query: 185 AYRAHRCDAYTGDISALYALKLTNDRPSEHVILPD 219
           A+   R D YT D  ALYA +L    P  + +  +
Sbjct: 121 AFETGRGDVYTTDALALYAQRLILAEPDAYGVFSE 155


>gi|153869943|ref|ZP_01999447.1| Lysine-arginine-ornithine-binding periplasmic protein [Beggiatoa
           sp. PS]
 gi|152073594|gb|EDN70556.1| Lysine-arginine-ornithine-binding periplasmic protein [Beggiatoa
           sp. PS]
          Length = 224

 Score =  133 bits (334), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 77/206 (37%), Positives = 116/206 (56%), Gaps = 5/206 (2%)

Query: 30  IKKRGFLKCGINT---GLVG-FAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNA 85
           I+KR  L CG+ +   GL G F  +   G   GFDVDFCRA+++AI ++P+ +  + +  
Sbjct: 4   IEKRTVLVCGVGSDVNGLKGGFTFINEKGQVAGFDVDFCRAVAAAILNNPNALSPVLVRQ 63

Query: 86  KERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSG 145
            +R   L    +D+L+  T WT  RE + G  F  IT++DGQGFI+ K   I+++ QL G
Sbjct: 64  SDRPGTLAPGNVDLLTATTTWTSTREANWG-NFTWITFYDGQGFIVKKDTSITTLEQLEG 122

Query: 146 ASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALK 205
            +ICV  GTTT   L + F   ++ +  + F    E  AAY   +C AYT D S L +  
Sbjct: 123 KNICVVEGTTTLANLKEVFAQRSISFTLLTFPEATEEFAAYEQEQCTAYTSDRSTLASWI 182

Query: 206 LTNDRPSEHVILPDIISKSPLAPAII 231
            +++ P  HV + + ISK+PL P  +
Sbjct: 183 FSSNTPDAHVFIDETISKNPLRPQCL 208


>gi|218507985|ref|ZP_03505863.1| polar amino acid ABC transport substrate-binding protein, aapJ-2
           [Rhizobium etli Brasil 5]
          Length = 189

 Score =  132 bits (331), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 65/170 (38%), Positives = 96/170 (56%), Gaps = 1/170 (0%)

Query: 24  ASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPL 83
              L  IK+RG +K G+ T   GF    + G W+GF VDF RAL+  +F+D  K+++   
Sbjct: 21  GQTLDKIKERGVIKVGVGT-TPGFFTPDSTGRWQGFFVDFGRALAVTVFNDDDKVEFTNS 79

Query: 84  NAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQL 143
           + ++R  ALQ+ + DIL      T+ R   LG  F P+ ++DGQG ++ K  G++   +L
Sbjct: 80  SPQQRLPALQAGEFDILLSGVTETITRAFKLGFHFGPVVFYDGQGLLVRKDLGVAKGEEL 139

Query: 144 SGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDA 193
            GA+I VQ+GTT EL +AD+F+    K+ PI  E   E   A    R DA
Sbjct: 140 DGATIGVQSGTTGELNIADFFRKTGKKFTPITIEETSEFTKALDTGRVDA 189


>gi|322435380|ref|YP_004217592.1| hypothetical protein AciX9_1764 [Acidobacterium sp. MP5ACTX9]
 gi|321163107|gb|ADW68812.1| hypothetical protein AciX9_1764 [Acidobacterium sp. MP5ACTX9]
          Length = 311

 Score =  124 bits (312), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 86/304 (28%), Positives = 139/304 (45%), Gaps = 13/304 (4%)

Query: 12  LIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAI 71
           LIIL   S    A  +  I+    L+C I+     +     +G    FD++ C A++ AI
Sbjct: 6   LIILATLSLPACAQSIETIRTTKLLRCAIDQEPPEYTTEDLHGPRVAFDLELCHAVALAI 65

Query: 72  FDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIM 131
             D      L  +  E    L+++  D L+      L    + GL        DG GF++
Sbjct: 66  GPDIKVQPILVSDEAEAISVLKARHAD-LAPTLSLNLTNATTPGLWLGLPIVLDGTGFMV 124

Query: 132 HKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRC 191
                   V  LSG  IC  A T TE  L  +F  +++ + P  F    E+DAAY    C
Sbjct: 125 --PTATLDVKSLSGKKICFFAETETETILKTWFTQNHLDFLPYPFSEEGEMDAAYTTGNC 182

Query: 192 DAYTGDISALYALKLTNDR-PSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVT 250
            A  GD++ L + +    R  + + +LP +I+ +PLAPA    D     + +WT+  ++ 
Sbjct: 183 AAMAGDLTRLASTRQNYGRAAARYKLLPTLIASAPLAPA--STDPTLTQLATWTNQLLLN 240

Query: 251 AEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMF 310
           AE L     NI  + + + +P +QR LG  ++  +G  L L   W  R++  +GNY +++
Sbjct: 241 AEAL-----NITHIPEHSQDPAIQRLLG--QTHELGPRLHLDDAWPIRVLTTLGNYADLY 293

Query: 311 DRNL 314
            R L
Sbjct: 294 ARTL 297


>gi|331007193|ref|ZP_08330404.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [gamma proteobacterium IMCC1989]
 gi|330418988|gb|EGG93443.1| amino acid ABC transporter, periplasmic amino acid-binding protein
           [gamma proteobacterium IMCC1989]
          Length = 120

 Score =  123 bits (308), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 58/127 (45%), Positives = 84/127 (66%), Gaps = 11/127 (8%)

Query: 220 IISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTT----NPDVQR 275
           +ISK PL P + QGD  W+N+V W+  AM+ AE L     N++  S DT     +P+ +R
Sbjct: 1   MISKEPLGPVVRQGDDAWFNVVRWSLMAMIEAEFL-----NVDSASADTAKASGSPEQKR 55

Query: 276 FLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGL 335
            LG +  +  GE LGL++DW + I++ +GNY E F+RN+G+ S LKI RG NA W+KGG+
Sbjct: 56  LLGAEGGA--GEKLGLSEDWAFNIVKQVGNYSESFERNVGSGSALKIARGLNAQWNKGGI 113

Query: 336 MYAPPIR 342
           +Y+ PIR
Sbjct: 114 LYSSPIR 120


>gi|330901940|gb|EGH33281.1| extracellular solute-binding protein [Pseudomonas syringae pv.
           japonica str. M301072PT]
          Length = 132

 Score =  122 bits (305), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 57/130 (43%), Positives = 81/130 (62%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFD 60
           M K     +  L        +   + L  IKK+GF++CG++ GL GF+   + G   G D
Sbjct: 3   MLKSTLAVVTALAAFGVIGAANAGTTLDAIKKKGFIQCGVSDGLPGFSVPDSTGKITGID 62

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
            D CRA+++A+F D +K+++  LNAKERF ALQS +IDILSRNT WT  R+  +GL F  
Sbjct: 63  ADVCRAVAAAVFGDATKVKFSQLNAKERFTALQSGEIDILSRNTTWTSSRDAGMGLVFTG 122

Query: 121 ITYFDGQGFI 130
           +TY+DG GF+
Sbjct: 123 VTYYDGIGFL 132


>gi|224367658|ref|YP_002601821.1| AapJ1 [Desulfobacterium autotrophicum HRM2]
 gi|223690374|gb|ACN13657.1| AapJ1 [Desulfobacterium autotrophicum HRM2]
          Length = 119

 Score =  110 bits (275), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 73/113 (64%)

Query: 6   FVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCR 65
           FV +L +  LF T+    A  L D+K +GF++ G+N  L GF +    G W+G DVD  R
Sbjct: 6   FVGVLLMAALFLTAGMATADTLEDVKAKGFIQAGVNGDLFGFGKPDEKGVWRGLDVDTAR 65

Query: 66  ALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAF 118
           A+++A+F D +K+++ PL AK RF ALQS +ID+L+RN   TL R+  LGL F
Sbjct: 66  AVAAAVFGDANKVKFTPLTAKTRFTALQSGEIDVLTRNCTQTLTRDTDLGLDF 118


>gi|153869942|ref|ZP_01999446.1| Lysine-arginine-ornithine-binding periplasmic protein [Beggiatoa
           sp. PS]
 gi|152073593|gb|EDN70555.1| Lysine-arginine-ornithine-binding periplasmic protein [Beggiatoa
           sp. PS]
          Length = 110

 Score =  104 bits (260), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 49/110 (44%), Positives = 73/110 (66%), Gaps = 3/110 (2%)

Query: 233 GDTEWYNIVSWTHYAMVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLT 292
           GD +W  I+    + ++ AEELGITQ N++ +   + NP V+R LG++ S    E +GL 
Sbjct: 4   GDEQWVKIIRTILFGLINAEELGITQANVDTM-MSSDNPQVRRLLGVEGSFGQAE-IGLE 61

Query: 293 KDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
            D   R +R +GNYGE+++RNLG+   + +PRG N LW+ GGL+YAPP+R
Sbjct: 62  PDAIARAVRAVGNYGEIYERNLGSGG-IGMPRGLNRLWTDGGLIYAPPLR 110


>gi|146281563|ref|YP_001171716.1| hypothetical protein PST_1179 [Pseudomonas stutzeri A1501]
 gi|145569768|gb|ABP78874.1| conserved hypothetical protein [Pseudomonas stutzeri A1501]
          Length = 197

 Score =  103 bits (258), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 64/79 (81%)

Query: 61  VDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRP 120
           +D CRA+++A+F D +K++Y PL AKERF ALQS ++D+LSRNT WT  R+ ++GL F  
Sbjct: 1   MDVCRAVAAAVFGDATKVKYSPLTAKERFTALQSGEVDVLSRNTTWTSSRDAAMGLNFTG 60

Query: 121 ITYFDGQGFIMHKKKGISS 139
           +TY+DGQGF+++K+ G+SS
Sbjct: 61  VTYYDGQGFLVNKELGVSS 79


>gi|323165232|gb|EFZ51022.1| general L-amino acid-binding periplasmic aapJ domain protein
           [Shigella sonnei 53G]
          Length = 93

 Score =  100 bits (250), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 43/95 (45%), Positives = 64/95 (67%), Gaps = 2/95 (2%)

Query: 248 MVTAEELGITQKNINQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYG 307
           M+ AEE+GI  +N+++ + +   PD+   LG  K  + G+ L L   W Y II+ +GNY 
Sbjct: 1   MLNAEEMGINSQNVDEKAANPATPDMAHLLG--KEGDYGKDLKLDNKWAYNIIKQVGNYS 58

Query: 308 EMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           E+F+RN+G++S LKI RG N LW+ GG+ YAPP+R
Sbjct: 59  EIFERNVGSESPLKIKRGQNNLWNNGGIQYAPPVR 93


>gi|218458308|ref|ZP_03498399.1| general L-amino acid ABC transporter, substrate-binding protein
           [Rhizobium etli Kim 5]
          Length = 62

 Score = 91.3 bits (225), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 37/60 (61%), Positives = 49/60 (81%)

Query: 283 SNIGEALGLTKDWTYRIIRHMGNYGEMFDRNLGNQSELKIPRGYNALWSKGGLMYAPPIR 342
           + IG  LGLT +W Y I++++GNYGE+F+RN+G  S+LKI RG NALWSKGG+ YAPP+R
Sbjct: 3   TKIGTDLGLTNEWAYNIVKNVGNYGEVFERNIGQGSQLKIDRGLNALWSKGGIQYAPPVR 62


>gi|150017371|ref|YP_001309625.1| extracellular solute-binding protein [Clostridium beijerinckii
           NCIMB 8052]
 gi|149903836|gb|ABR34669.1| extracellular solute-binding protein, family 3 [Clostridium
           beijerinckii NCIMB 8052]
          Length = 290

 Score = 88.2 bits (217), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 69/228 (30%), Positives = 107/228 (46%), Gaps = 19/228 (8%)

Query: 19  SFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKI 78
           S   ++S L DIKKRG +K G+ +    F  V + G  +GFDV   +  +  +  D SK+
Sbjct: 35  SNKASSSSLEDIKKRGTIKIGVFSDKAPFGYVDSEGKNQGFDVYVAKRFAKDLLGDESKV 94

Query: 79  QYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGIS 138
           +++ ++A  R   L+SK++DI+  N  +T+  E    + F         G +      I+
Sbjct: 95  EFVLVDAASRVSYLESKKVDIIMAN--FTVTDERKEKVDFANPYMKVSLGVVSPDGAKIT 152

Query: 139 SVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIV----FERVEEIDAAYRAHRCDAY 194
           S  QL G  + V  GTT E  +         K HP V    +E+  EI  A +  R DA 
Sbjct: 153 SEDQLKGKKVIVAKGTTAETYMT--------KNHPDVELVKYEQYSEIFQALKDKRGDAI 204

Query: 195 TGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTE---WYN 239
             D + + A     D P   V +P + S   +APA+ +G+TE   W N
Sbjct: 205 LSDNTEVIA--WAKDNPGFSVGIPSLGSTDTIAPAVTKGNTELRDWIN 250


>gi|193084269|gb|ACF09931.1| periplasmic substrate binding protein [uncultured marine group III
           euryarchaeote KM3-28-E8]
          Length = 270

 Score = 87.4 bits (215), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 70/126 (55%), Gaps = 5/126 (3%)

Query: 81  LPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHK-----KK 135
           +P ++++RF  L S +ID+L R T WT  R+  L   F  + ++DGQG ++ +       
Sbjct: 1   MPASSQDRFEKLASGEIDVLIRTTTWTTSRDAELNADFAGMNFYDGQGILIREDAFPAAN 60

Query: 136 GISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYT 195
             +SVS L GA+ICV  GTTTE  L DYF +H + +         E    +    CDA+T
Sbjct: 61  ANNSVSGLDGATICVGTGTTTEGNLQDYFTSHGIAFTAEPVGDAAEATQKFIDGACDAFT 120

Query: 196 GDISAL 201
           GD+SA+
Sbjct: 121 GDMSAM 126


>gi|159904021|ref|YP_001551365.1| hypothetical protein P9211_14801 [Prochlorococcus marinus str. MIT
           9211]
 gi|159889197|gb|ABX09411.1| Hypothetical protein P9211_14801 [Prochlorococcus marinus str. MIT
           9211]
          Length = 109

 Score = 87.4 bits (215), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 43/98 (43%), Positives = 67/98 (68%), Gaps = 1/98 (1%)

Query: 18  TSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSK 77
           T+   + S LG IK+R  L CGI+  + GF+ ++++G+++G D+D C+A ++A   D   
Sbjct: 10  TTNENDVSRLGLIKERNELICGISGKIPGFSFLESDGNYQGIDIDICKAFAAAFTGDSDN 69

Query: 78  IQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLG 115
           +QY PL A ERF A+++ +ID+LSRNT  TL R+ SLG
Sbjct: 70  VQYRPLTAAERFTAVRTGEIDLLSRNTTLTLSRD-SLG 106


>gi|219670584|ref|YP_002461019.1| extracellular solute-binding protein family 3 [Desulfitobacterium
           hafniense DCB-2]
 gi|219540844|gb|ACL22583.1| extracellular solute-binding protein family 3 [Desulfitobacterium
           hafniense DCB-2]
          Length = 297

 Score = 85.1 bits (209), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 62/218 (28%), Positives = 105/218 (48%), Gaps = 8/218 (3%)

Query: 22  TNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYL 81
           ++A  L +IK+RG L+ G+ +    F  V ANG  +GFDV+  R  +  +  D SK++++
Sbjct: 45  SSAGSLEEIKQRGTLRIGVFSDKPPFGYVDANGQNQGFDVEIARRFAKDLLGDESKVEFV 104

Query: 82  PLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVS 141
            + A  R   L+S ++DI+  N  +T+  E    + F         G +      I+S+ 
Sbjct: 105 LVEAANRVPYLESNKVDIIMAN--FTVTEERKQKVDFANPYMKVALGIVSPNGALITSID 162

Query: 142 QLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISAL 201
           QL G  + V  GTT +    DY   ++     + +++  E   A +  R  A   D + +
Sbjct: 163 QLQGQKVIVNKGTTAQ----DYLTKNHPDLELLKYDQNTEAFEALKDGRGAALAHDNTEV 218

Query: 202 YALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYN 239
            A   +N  P   V +P + S   +APA+ +GDTE  N
Sbjct: 219 LAWAKSN--PGFTVGVPTLGSTDTIAPAVKKGDTELLN 254


>gi|225019520|ref|ZP_03708712.1| hypothetical protein CLOSTMETH_03473 [Clostridium methylpentosum
           DSM 5476]
 gi|224947741|gb|EEG28950.1| hypothetical protein CLOSTMETH_03473 [Clostridium methylpentosum
           DSM 5476]
          Length = 282

 Score = 85.1 bits (209), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 66/238 (27%), Positives = 115/238 (48%), Gaps = 12/238 (5%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           L  IK+RG ++ G+ +    F  + +NG+ +G+DV   + L+  +  D SK++++ + A 
Sbjct: 35  LESIKERGTIRIGVFSDKPPFGYIDSNGENQGYDVYLAKRLAKDLLGDESKVEFVLVEAA 94

Query: 87  ERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGA 146
            R   LQS ++D+L  N  +T+ +E +  + F         G ++ K  GI+SV QL G 
Sbjct: 95  SRVEYLQSNKVDLLLAN--FTVTKERAEQVDFANPYMKVALGIVL-KDGGITSVDQLKGK 151

Query: 147 SICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKL 206
           ++ V  GTT E     YF  +    + + F++  E   A +  R DA   D + L+A   
Sbjct: 152 TLAVNKGTTAET----YFTENYPDINLLKFDQNTETFQALKDGRADALAHDNTLLFAWAN 207

Query: 207 TNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELGITQKNINQV 264
            ND     V +  + S   +APA+ +G+ E   + SW +  +    E     KN  + 
Sbjct: 208 END--GFEVGVSSLGSHDTIAPAVKKGNDE---LRSWVNDELAKLGEEKFMHKNYQET 260


>gi|320547237|ref|ZP_08041530.1| amino acid ABC superfamily ATP binding cassette transporter,
           binding protein [Streptococcus equinus ATCC 9812]
 gi|320448125|gb|EFW88875.1| amino acid ABC superfamily ATP binding cassette transporter,
           binding protein [Streptococcus equinus ATCC 9812]
          Length = 279

 Score = 84.3 bits (207), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 56/191 (29%), Positives = 96/191 (50%), Gaps = 10/191 (5%)

Query: 16  FFTSFSTNASILGD----IKKRGFLKCGINTGLVGFAEVKA-NGDWKGFDVDFCRALSSA 70
           FFT+  T A    +    I+  G LK G+   +  F    A +G ++G ++D  + ++  
Sbjct: 29  FFTASKTFADTTSEQIKKIQDAGVLKVGVKQDVPNFGYYSAESGKYEGMEIDLAKKIAKT 88

Query: 71  IFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFI 130
           +     K+ Y  +  + R   L + QID+L     +T+  E     A     Y+D  GF+
Sbjct: 89  L---GVKVAYTAVTTQTREALLDNGQIDLLIAT--YTITDERKASYAISNPYYYDEIGFL 143

Query: 131 MHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHR 190
           ++  KG+ ++S L G +I V  G+TT+LT+ +Y KAHN+K+  +      E+  +  A R
Sbjct: 144 VNTGKGLKTISDLDGKTIGVAQGSTTKLTIEEYGKAHNLKFKFVQLGSFPELAISLHAKR 203

Query: 191 CDAYTGDISAL 201
            DA++ D S L
Sbjct: 204 IDAFSVDKSIL 214


>gi|121610312|ref|YP_998119.1| extracellular solute-binding protein [Verminephrobacter eiseniae
           EF01-2]
 gi|121554952|gb|ABM59101.1| extracellular solute-binding protein, family 3 [Verminephrobacter
           eiseniae EF01-2]
          Length = 278

 Score = 83.6 bits (205), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 58/194 (29%), Positives = 95/194 (48%), Gaps = 7/194 (3%)

Query: 6   FVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCR 65
            V++L L+ + FTS + +A  L D+ KRG+L  G       F      G+ +GFDVD  R
Sbjct: 10  LVAVLTLLGMCFTSLA-HADKLADVLKRGYLIVGTTGSSPPFGFKDEKGELQGFDVDMSR 68

Query: 66  ALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFD 125
            ++ A+F DP K++++ L  + R+ ALQ+ Q+D++++    T  R + +G   R   YFD
Sbjct: 69  LIAKALFGDPQKVKFVLLGNEARWTALQTDQVDMVAQFATITPERLVRVGFTPR---YFD 125

Query: 126 -GQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDA 184
            G   ++ K   I S + L  A + +   T  E    D  K          F  V++   
Sbjct: 126 TGMTVVVRKDSKIKSFADLDSADVTIATLTVPEQI--DLVKRMAPNARVASFATVDQQFL 183

Query: 185 AYRAHRCDAYTGDI 198
           A R+ R  A+  D+
Sbjct: 184 ALRSGRVQAFLVDL 197


>gi|89897433|ref|YP_520920.1| hypothetical protein DSY4687 [Desulfitobacterium hafniense Y51]
 gi|89336881|dbj|BAE86476.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 276

 Score = 83.6 bits (205), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 61/213 (28%), Positives = 102/213 (47%), Gaps = 8/213 (3%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           L +IK+RG L+ G+ +    F  V ANG  +GFDV+  R  +  +  D SK++++ + A 
Sbjct: 29  LEEIKQRGTLRIGVFSDKPPFGYVDANGQNQGFDVEIARRFAKDLLGDESKVEFVLVEAA 88

Query: 87  ERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGA 146
            R   L+S ++DI+  N  +T+  E    + F         G +      I+S+ QL G 
Sbjct: 89  NRVPYLESNKVDIIMAN--FTVTEERKQKVDFANPYMKVALGIVSPDGALITSIDQLQGK 146

Query: 147 SICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKL 206
            + V  GTT +    DY   ++     + +++  E   A +  R  A   D + + A   
Sbjct: 147 KVIVNKGTTAQ----DYLTKNHPDLELLKYDQNTEAFEALKDGRGAALAHDNTEVLAWAK 202

Query: 207 TNDRPSEHVILPDIISKSPLAPAIIQGDTEWYN 239
           +N  P   V +P + S   +APA+ +GDTE  N
Sbjct: 203 SN--PGFTVGVPALGSTDTIAPAVKKGDTELLN 233


>gi|77408339|ref|ZP_00785080.1| amino acid ABC transporter, amino acid-binding protein
           [Streptococcus agalactiae COH1]
 gi|77173020|gb|EAO76148.1| amino acid ABC transporter, amino acid-binding protein
           [Streptococcus agalactiae COH1]
          Length = 266

 Score = 83.2 bits (204), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 55/198 (27%), Positives = 98/198 (49%), Gaps = 7/198 (3%)

Query: 5   FFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGD-WKGFDVDF 63
           + +S + + +LF+ + ST+A+ L +IKK G LK G+   +  F    A  + ++G ++D 
Sbjct: 10  YLLSXIFIFLLFYPN-STSANQLSEIKKSGVLKVGVKQDVPNFGYYNAETNQYEGMEIDI 68

Query: 64  CRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITY 123
            + ++ ++   P    ++P  A+ R   + + QIDIL     +T+  E           Y
Sbjct: 69  AKKIAKSLGVKPV---FVPTTAQTREPLMDNGQIDILI--ATYTITPERKANYNISKAYY 123

Query: 124 FDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEID 183
            D  GF++ K   I ++ +L G  I V  G TT++ L  Y K H +K+         E+ 
Sbjct: 124 HDEIGFLVRKNSHIKTIKELDGKHIGVAQGATTKVNLEKYAKEHKLKFSYAQLGSFPELA 183

Query: 184 AAYRAHRCDAYTGDISAL 201
            +  A+R DA++ D S L
Sbjct: 184 ISLYANRIDAFSVDKSIL 201


>gi|222823699|ref|YP_002575273.1| amino acid ABC transporter, periplasmic solute-binding lipoprotein
           [Campylobacter lari RM2100]
 gi|222538921|gb|ACM64022.1| amino acid ABC transporter, periplasmic solute-binding lipoprotein
           [Campylobacter lari RM2100]
          Length = 275

 Score = 82.8 bits (203), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 65/245 (26%), Positives = 118/245 (48%), Gaps = 13/245 (5%)

Query: 1   MYKDFFVSILCLIILFFTSFS---TNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWK 57
           M K F +S L  + LFF + S   +N + +  IK++G ++ G+      F  + A G  +
Sbjct: 1   MKKIFLLSFL--MALFFGACSNSGSNENSIEKIKQQGVIRIGVFGDKPPFGYLDAQGKNQ 58

Query: 58  GFDVDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLA 117
           G+DV F + ++  +  D SKIQ++ + A  R   LQS ++D++  N   T  RE+ +  A
Sbjct: 59  GYDVYFAKRIAKELLGDESKIQFVLVEAANRVEFLQSNKVDLILANFTKTPEREVVVDFA 118

Query: 118 FRPITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFE 177
              +      G +  K   I ++  L   ++ +  GTT +     YF  +  +   I F+
Sbjct: 119 LPYMKV--ALGVVAPKNSDIKTIDDLKSKTLILNKGTTADA----YFTKNMPEIKTIKFD 172

Query: 178 RVEEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEW 237
           +  E  AA    R DA + D + L+A    N  P+  V++ ++ +   +APA+ +GD   
Sbjct: 173 QNTETFAALIGKRGDALSHDNALLFAWAKEN--PNFEVVIKELGNHDVIAPAVKKGDEAM 230

Query: 238 YNIVS 242
              ++
Sbjct: 231 LKFIN 235


>gi|22536881|ref|NP_687732.1| amino acid ABC transporter, amino acid-binding protein
           [Streptococcus agalactiae 2603V/R]
 gi|76788013|ref|YP_329465.1| polar amino acid ABC transporter amino acid-binding protein
           [Streptococcus agalactiae A909]
 gi|76798186|ref|ZP_00780437.1| amino acid ABC transporter, amino acid-binding protein
           [Streptococcus agalactiae 18RS21]
 gi|22533731|gb|AAM99604.1|AE014224_7 amino acid ABC transporter, amino acid-binding protein
           [Streptococcus agalactiae 2603V/R]
 gi|76563070|gb|ABA45654.1| polar amino acid uptake (PAAT) family ABC transporter, amino
           acid-binding protein [Streptococcus agalactiae A909]
 gi|76586449|gb|EAO62956.1| amino acid ABC transporter, amino acid-binding protein
           [Streptococcus agalactiae 18RS21]
          Length = 266

 Score = 82.8 bits (203), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 56/198 (28%), Positives = 94/198 (47%), Gaps = 6/198 (3%)

Query: 5   FFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGD-WKGFDVDF 63
           F++     I L F   ST+A+ L +IKK G LK G+   +  F    A  + ++G ++D 
Sbjct: 9   FYLLSCIFIFLLFYPNSTSANQLSEIKKSGVLKVGVKQDVPNFGYYNAETNQYEGMEIDI 68

Query: 64  CRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITY 123
            + ++ ++   P    ++P  A+ R   + + QIDIL     +T+  E           Y
Sbjct: 69  AKKIAKSLGVKPV---FVPTTAQTREPLMDNGQIDILI--ATYTITPERKANYNISKAYY 123

Query: 124 FDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEID 183
            D  GF++ K   I ++ +L G  I V  G TT++ L  Y K H +K+         E+ 
Sbjct: 124 HDEIGFLVRKNSHIKTIKELDGKHIGVAQGATTKVNLEKYAKEHKLKFSYAQLGSFPELA 183

Query: 184 AAYRAHRCDAYTGDISAL 201
            +  A+R DA++ D S L
Sbjct: 184 ISLYANRIDAFSVDKSIL 201


>gi|257095474|ref|YP_003169115.1| family 3 extracellular solute-binding protein [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
 gi|257047998|gb|ACV37186.1| extracellular solute-binding protein family 3 [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
          Length = 285

 Score = 82.4 bits (202), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 62/191 (32%), Positives = 92/191 (48%), Gaps = 12/191 (6%)

Query: 25  SILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAI---FDDPS-KIQY 80
           S+L  IK+ G LK G     + F+ V  +   +G+ VD CR ++  +    D P   +++
Sbjct: 26  SVLARIKQSGTLKLGYRENSMPFSFVGDDKQPRGYSVDLCRIVAEDLGKQLDLPKLDVRW 85

Query: 81  LPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSV 140
           +P+ A+ RF AL+S  ID+   NT  TL R       F  +T+ DG G +    +  SS+
Sbjct: 86  VPVTAQSRFEALKSGAIDLECGNTTQTLARRADFD--FSLMTFIDGAGLLFLDGEVPSSL 143

Query: 141 SQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHR---CDAYTGD 197
               G  + V AGTTTE TL D   A  +  + I   +V + DAA RA +     AY  D
Sbjct: 144 EATKGQRVAVVAGTTTEKTLEDLIAAGKLGVYLI---KVPDHDAALRALKDKTATAYAAD 200

Query: 198 ISALYALKLTN 208
            + L    L  
Sbjct: 201 RTVLITTALVR 211


>gi|257094459|ref|YP_003168100.1| family 3 extracellular solute-binding protein [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
 gi|257046983|gb|ACV36171.1| extracellular solute-binding protein family 3 [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
          Length = 284

 Score = 82.4 bits (202), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 62/234 (26%), Positives = 107/234 (45%), Gaps = 7/234 (2%)

Query: 9   ILCLII-LFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRAL 67
           +LC+   L F   +  A  L  IK    +  G     + F+    +    G+ VD C  +
Sbjct: 7   LLCVATALSFPLSALAAGTLDKIKASRTISLGYREASIPFSYTGDDNQPWGYSVDLCTRV 66

Query: 68  SSAIFD----DPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITY 123
           ++AI      +  ++Q++P+  + R   L+S  ID+   +T  +L R   +   F  +T+
Sbjct: 67  AAAIVKQLGLEELQLQWVPVTPETRVAKLKSGAIDLECGSTTSSLARMQEVD--FSLLTF 124

Query: 124 FDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEID 183
            DG  ++  K  GI  +  L+G  I V AGTT+E T+A+    H +    +     ++  
Sbjct: 125 VDGGSYLTRKASGIKRLDDLAGKRIAVAAGTTSERTIAEALTQHQVGAQLVKVSDHQQGL 184

Query: 184 AAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEW 237
           AA    + DAY  D S L  L L +   S+ V+ P+  S  P A  + + D ++
Sbjct: 185 AAMVQGKVDAYASDRSLLIGLALDSGNQSDWVLGPETFSYEPYALMMRRNDADF 238


>gi|227488162|ref|ZP_03918478.1| conserved hypothetical protein [Corynebacterium glucuronolyticum
           ATCC 51867]
 gi|227091880|gb|EEI27192.1| conserved hypothetical protein [Corynebacterium glucuronolyticum
           ATCC 51867]
          Length = 80

 Score = 81.6 bits (200), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 34/79 (43%), Positives = 53/79 (67%), Gaps = 1/79 (1%)

Query: 185 AYRAHRCDAYTGDISALYALKLTN-DRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSW 243
           A+ A RCD ++ D S L +++++    P ++V+LP+IISK PL P + QGD  W N+V W
Sbjct: 2   AFAAGRCDVFSTDASGLASIRISKLQNPDDYVVLPEIISKEPLGPFVRQGDDAWLNVVRW 61

Query: 244 THYAMVTAEELGITQKNIN 262
           +  AM+ AEE G+T  N++
Sbjct: 62  SLSAMIEAEEYGVTSANVD 80


>gi|240168877|ref|ZP_04747536.1| putative glutamine-binding lipoprotein [Mycobacterium kansasii ATCC
           12478]
          Length = 328

 Score = 81.3 bits (199), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 63/213 (29%), Positives = 100/213 (46%), Gaps = 18/213 (8%)

Query: 16  FFTSFSTNASILGDIKKRGFLKCGINTG--LVGFAEVKANGDWKGFDVDFCRALSSAIFD 73
           F T    +A++  +I +RG L  G++ G  L  F +    GD  GFDVD    ++  IF 
Sbjct: 75  FRTKAEADAAV-ANIHERGRLIVGLDIGSNLFSFRD-PITGDITGFDVDIAGEVARDIFG 132

Query: 74  DPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDG-QGFIMH 132
            PS ++Y  L+A ER  ALQ+ Q+D++ +    T  R   +  +     Y D  Q  +  
Sbjct: 133 SPSHVEYRILSAAERITALQTSQVDVVVKTMTITCERRKLVNFS---TVYLDANQRILAP 189

Query: 133 KKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDA--AYRAHR 190
           +   IS VS LSG  +CV  GTT+        +   +   P++   V   D   A +  +
Sbjct: 190 RDSSISKVSDLSGKRVCVARGTTS------LRRIREIAPPPVIVSVVNWADCLVAMQQRQ 243

Query: 191 CDAYTGDISALYALKLTNDRPSEHVILPDIISK 223
            DA + D S L    L  + P  H++ PD+ ++
Sbjct: 244 IDAVSTDDSILAG--LVEEDPYLHIVGPDMANQ 274


>gi|24379909|ref|NP_721864.1| putative ABC transporter, glutamine binding protein [Streptococcus
           mutans UA159]
 gi|24377888|gb|AAN59170.1|AE014984_5 putative ABC transporter, glutamine binding protein [Streptococcus
           mutans UA159]
          Length = 270

 Score = 81.3 bits (199), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 57/209 (27%), Positives = 105/209 (50%), Gaps = 16/209 (7%)

Query: 3   KDFFVSILCLIILFFTSFSTNASILGD---------IKKRGFLKCGINTGLVGFAEVKA- 52
           K F +S+  LI++  TS S  + +  D         IK+ G LK G+   +  F    A 
Sbjct: 4   KKFLISLAALIMIA-TSLSGLSKVNADNVTSPQVKKIKRAGVLKVGVKQDVPNFGYYNAE 62

Query: 53  NGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREI 112
            G ++G ++D  R ++ +I     K++ +P+  + R   + + Q+D++      T  R+ 
Sbjct: 63  TGKYEGMEIDIARKIAKSI---GVKLELVPVTTQTREPLMDNGQVDLVIATYTITPERQA 119

Query: 113 SLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYH 172
           S  ++ +P  Y+D  GF++ +   IS +S L G +I V  G TT++ L  Y K H++K++
Sbjct: 120 SYSIS-KPY-YYDQIGFLVRQSSKISKISDLDGLTIGVSQGATTKVNLEAYAKKHHLKFN 177

Query: 173 PIVFERVEEIDAAYRAHRCDAYTGDISAL 201
            +      E+  +  + R DA++ D S L
Sbjct: 178 YVQLGSFPELAISLYSKRIDAFSVDKSIL 206


>gi|25010745|ref|NP_735140.1| hypothetical protein gbs0690 [Streptococcus agalactiae NEM316]
 gi|77410777|ref|ZP_00787135.1| amino acid ABC transporter, amino acid-binding protein
           [Streptococcus agalactiae CJB111]
 gi|23095099|emb|CAD46334.1| unknown [Streptococcus agalactiae NEM316]
 gi|77163156|gb|EAO74109.1| amino acid ABC transporter, amino acid-binding protein
           [Streptococcus agalactiae CJB111]
 gi|319744751|gb|EFV97093.1| polar amino acid ABC superfamily ATP binding cassette transporter,
           binding protein [Streptococcus agalactiae ATCC 13813]
          Length = 266

 Score = 80.9 bits (198), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 55/198 (27%), Positives = 97/198 (48%), Gaps = 7/198 (3%)

Query: 5   FFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGD-WKGFDVDF 63
           + +S + + +LF+ + ST+A+ L +IKK G LK G+   +  F    A  + ++G ++D 
Sbjct: 10  YLLSCIFIFLLFYPN-STSANQLSEIKKSGVLKVGVKQDVPNFGYYNAETNQYEGMEIDI 68

Query: 64  CRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITY 123
            + ++ ++   P    ++P  A+ R   + + QIDIL     +T+  E           Y
Sbjct: 69  AKKIAKSLGVKPV---FVPTTAQTREPLMDNGQIDILI--ATYTITPERKANYNISKAYY 123

Query: 124 FDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEID 183
            D  GF++ K   I ++ +L G  I V  G TT+  L  Y K H +K+         E+ 
Sbjct: 124 HDEIGFLVRKNSHIKTIKELDGKHIGVAQGATTKGNLEKYAKEHKLKFSYAQLGSFPELA 183

Query: 184 AAYRAHRCDAYTGDISAL 201
            +  A+R DA++ D S L
Sbjct: 184 ISLYANRIDAFSVDKSIL 201


>gi|223999121|ref|XP_002289233.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gi|220974441|gb|EED92770.1| predicted protein [Thalassiosira pseudonana CCMP1335]
          Length = 871

 Score = 80.5 bits (197), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 72/305 (23%), Positives = 133/305 (43%), Gaps = 55/305 (18%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           L  +++RG+++CG+          +   + + F  D CR++++ +  DP  I    ++  
Sbjct: 358 LAIVQERGYVRCGL---------FQKKTEARNFRRDLCRSVAAVVLLDPDSIIETDVHVN 408

Query: 87  ERFLALQSKQIDILSRNTDWTLLREIS-----LGLAFRPITYFDGQGF--------IMHK 133
            RF  L  + +D+L+    +TL RE++      G +F    Y+DG  F           +
Sbjct: 409 NRFPMLYDRAVDLLAAGETYTLEREVNEPTTGAGFSFTTPYYYDGMVFGGNSTSVYCAEE 468

Query: 134 KKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDA 193
           +K     + L    ICVQ  TT    ++  F A    ++  V   + E    +   +C+A
Sbjct: 469 RKRYDECANLK---ICVQESTTHYSYVSANFAA---GFYTSV-RSLSESAVFFLQDKCNA 521

Query: 194 YTGD-ISALYALKLTNDRPSEHVILPD-IISKSPLAPAIIQGDTEWYNIVSWTHYAMVTA 251
           + G+ +  L ++ + N   +  V++ +   +  PL+ A    D EW +IV+W   A++  
Sbjct: 522 FAGERMEILSSVSIQNLTETNAVVIGNKTYTSEPLSIATRNDDQEWSDIVNWVIQALIFG 581

Query: 252 EELGITQKNI---NQVSKDTTNPDVQRFLGIDKSSNIGEALGLTKDWTYRIIRHMGNYGE 308
           EE G+ + +    N    DTTN  +  FL                      +  +GNYG+
Sbjct: 582 EENGLVKNSSLCENSTIVDTTNTGLN-FLNS--------------------VYCVGNYGQ 620

Query: 309 MFDRN 313
           +F RN
Sbjct: 621 LFARN 625


>gi|322372851|ref|ZP_08047387.1| polar amino acid uptake (PAAT) family ABC transporter, amino
           acid-binding protein [Streptococcus sp. C150]
 gi|321277893|gb|EFX54962.1| polar amino acid uptake (PAAT) family ABC transporter, amino
           acid-binding protein [Streptococcus sp. C150]
          Length = 277

 Score = 80.1 bits (196), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 50/180 (27%), Positives = 90/180 (50%), Gaps = 6/180 (3%)

Query: 23  NASILGDIKKRGFLKCGINTGLVGFAEVKANGD-WKGFDVDFCRALSSAIFDDPSKIQYL 81
           N+  +  I KRG L  G+   +  F    A  + ++G +VD  + ++  +     K+ Y+
Sbjct: 38  NSKAVQKIVKRGTLNVGVKQDVPNFGYYSAKTNTYEGMEVDLAKKIADEL---KVKVNYI 94

Query: 82  PLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVS 141
           P+  + R   + +  ID+L     +T+  E     A     Y+D  GF++ K  GI+ +S
Sbjct: 95  PVTTQTREPLMDNGTIDLLIGT--YTINDERKASYAISSPYYYDQIGFLVLKDSGINKIS 152

Query: 142 QLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISAL 201
            L+G +I V  G +T+  L +Y  AHN+K++ +      E+  +  AHR +A++ D S L
Sbjct: 153 DLNGKTIGVSQGASTKAALQEYASAHNLKFNYVQLGSFPELAVSLYAHRVNAFSVDKSIL 212


>gi|228476953|ref|ZP_04061593.1| ABC-type amino acid transport/signal transduction system,
           periplasmic component/domain [Streptococcus salivarius
           SK126]
 gi|228251372|gb|EEK10533.1| ABC-type amino acid transport/signal transduction system,
           periplasmic component/domain [Streptococcus salivarius
           SK126]
          Length = 224

 Score = 80.1 bits (196), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 59/204 (28%), Positives = 98/204 (48%), Gaps = 15/204 (7%)

Query: 8   SILCLIILFFTSFSTNA---SILGDIK------KRGFLKCGINTGLVGFAEVKANGD-WK 57
           S+  L I   TS  T A   S L D K      KRG L  G+   +  F    A  + ++
Sbjct: 14  SLAILTIFLITSHKTKAEDTSKLLDSKAVQKIVKRGTLNVGVKQDVPNFGYYSAKTNTYE 73

Query: 58  GFDVDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLA 117
           G +VD  + ++  +     K+ Y+P+  + R   + +  ID+L     +T+  E     A
Sbjct: 74  GMEVDLAKKIADEL---KVKVNYIPVTTQTREPLMDNGTIDLLIAT--YTINDERKASYA 128

Query: 118 FRPITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFE 177
                Y+D  GF++ K  GI+ +S L+G +I V  G +T+  L +Y  A+N+K++ +   
Sbjct: 129 ISTPYYYDQIGFLVLKDSGINKISDLNGKTIGVSQGASTKAALQEYASANNLKFNYVQLG 188

Query: 178 RVEEIDAAYRAHRCDAYTGDISAL 201
              E+  +  AHR DA++ D S L
Sbjct: 189 SFPELAVSLYAHRVDAFSVDKSIL 212


>gi|312862723|ref|ZP_07722963.1| ABC transporter, substrate-binding protein, family 3 [Streptococcus
           vestibularis F0396]
 gi|311101583|gb|EFQ59786.1| ABC transporter, substrate-binding protein, family 3 [Streptococcus
           vestibularis F0396]
          Length = 277

 Score = 80.1 bits (196), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 61/217 (28%), Positives = 107/217 (49%), Gaps = 22/217 (10%)

Query: 1   MYKDF--FVSILCLIIL---FFTSFSTNA---SILGDIK------KRGFLKCGINTGL-- 44
           ++K F  ++++ CL I+     +S+ T A   S L D K      KRG L  G+   +  
Sbjct: 2   IFKKFLRYLTVACLAIVTIFLISSYKTKAEDTSKLLDSKAVQKIVKRGTLNVGVKQDVPN 61

Query: 45  VGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNT 104
            G+   K N  ++G +VD  + ++  +     K+ Y+P+  + R   + +  ID+L    
Sbjct: 62  FGYYSAKTNS-YEGMEVDLAKKIADEL---KVKVNYIPVTTQTREPLMDNGTIDLLIGT- 116

Query: 105 DWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYF 164
            +T+  E     A     Y D  GF++ K  GI+ +S L+G +I V  G +T+  L +Y 
Sbjct: 117 -YTINDERKASYAISDPYYHDQIGFLVLKNSGINKISDLNGKTIGVSQGASTKAALQEYA 175

Query: 165 KAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISAL 201
            AHN+K++ +      E+  +  AHR +A++ D S L
Sbjct: 176 SAHNLKFNYVQLGSFPELAVSLYAHRVNAFSVDKSIL 212


>gi|290580111|ref|YP_003484503.1| putative ABC transporter glutamine binding protein [Streptococcus
           mutans NN2025]
 gi|254997010|dbj|BAH87611.1| putative ABC transporter glutamine binding protein [Streptococcus
           mutans NN2025]
          Length = 270

 Score = 79.3 bits (194), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 56/209 (26%), Positives = 104/209 (49%), Gaps = 16/209 (7%)

Query: 3   KDFFVSILCLIILFFTSFSTNASILGD---------IKKRGFLKCGINTGLVGFAEVKA- 52
           K F +S+  LI++  T  S  + +  D         IK+ G LK G+   +  F    A 
Sbjct: 4   KKFLISLAALIMIA-TGLSGLSKVNADNVTSPQVKKIKRAGVLKVGVKQDVPNFGYYNAE 62

Query: 53  NGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREI 112
            G ++G ++D  R ++ +I     K++ +P+  + R   + + Q+D++      T  R+ 
Sbjct: 63  TGKYEGMEIDIARKIAKSI---GVKLELVPVTTQTREPLMDNGQVDLVIATYTITPERQA 119

Query: 113 SLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYH 172
           S  ++ +P  Y+D  GF++ +   IS +S L G +I V  G TT++ L  Y K H++K++
Sbjct: 120 SYSIS-KPY-YYDQIGFLVRQSSKISKISDLDGLTIGVSQGATTKVNLEAYAKKHHLKFN 177

Query: 173 PIVFERVEEIDAAYRAHRCDAYTGDISAL 201
            +      E+  +  + R DA++ D S L
Sbjct: 178 YVQLGSFPELAISLYSKRIDAFSVDKSIL 206


>gi|325121846|gb|ADY81369.1| putative ABC transporter, periplasmic binding protein, amino acid
           [Acinetobacter calcoaceticus PHEA-2]
          Length = 286

 Score = 79.3 bits (194), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 66/249 (26%), Positives = 117/249 (46%), Gaps = 11/249 (4%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           L  +KK G L+  +      F  V + G+ +GFDV   + ++  +  D  K++++   A 
Sbjct: 41  LEQVKKNGVLRVAVFADDPPFGYVDSAGNNQGFDVALAKRVTKDLLGDEKKVEFIVTEAS 100

Query: 87  ERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQ-GFIMHKKKGISSVSQLSG 145
            R   L+S + D++      T  R+  +  A  P  Y  G  G +  K K I+ ++QL G
Sbjct: 101 NRVEFLKSNRADVVFATFTVTPERKEVVDFA-EP--YLKGAFGIVSPKAKPITDIAQLEG 157

Query: 146 ASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALK 205
            ++ V  GT+++     YF  H  K + + FER  +   A    R DA + D  + YAL 
Sbjct: 158 KTLIVNKGTSSDT----YFTKHYPKVNLLKFERNSDAFKALTDGRGDAISQD--STYALA 211

Query: 206 LTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELG-ITQKNINQV 264
                PS    +  I  +  +APA+ +G+T+  N ++     + T+ E+  I  + +  +
Sbjct: 212 WAAKNPSYVAGIQSIGDQEFIAPAVKKGNTQLLNWLNTEIKQLRTSGEINKIYDETLKPI 271

Query: 265 SKDTTNPDV 273
             D+ NP+V
Sbjct: 272 YGDSVNPNV 280


>gi|154148477|ref|YP_001406034.1| antigenic protein [Campylobacter hominis ATCC BAA-381]
 gi|153804486|gb|ABS51493.1| antigenic protein [Campylobacter hominis ATCC BAA-381]
          Length = 266

 Score = 79.3 bits (194), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 60/227 (26%), Positives = 110/227 (48%), Gaps = 10/227 (4%)

Query: 24  ASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPL 83
            S L +IK+   +K G+   L  F+    +G+++GF++   +A+ ++I     +IQ + L
Sbjct: 10  GSTLEEIKQSKVIKIGVRLNLPPFSNQNEHGEFEGFEISLAKAIGASILGKNGEIQLVGL 69

Query: 84  NAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQL 143
           NAK+R   LQ+  +D++  N   T  R  S+  A   ++  + QG +  K + I S+SQL
Sbjct: 70  NAKDRIPYLQNGTVDLILANFSKTEERAKSVDFATPYLS--NTQGILTKKSENIRSISQL 127

Query: 144 SGASICVQAGTTTELTLADYFKAHNMKY--HPIVFERVEEIDAAYRAHRCDAYTGDISAL 201
           +G  I    GTTT+    DY KA+  K    P+  + V +   + +    D Y      +
Sbjct: 128 AGKKILFIKGTTTD----DYLKANAAKLGITPVECQSVNKCFQSLQKGEADGYMHTSILI 183

Query: 202 YALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAM 248
             L+L +D     + + +I S   + P + +G+      V+ + Y +
Sbjct: 184 AFLQLLDDNI--EMGIQNIGSIEFICPGVKKGNEALLEAVNASIYNL 228


>gi|77415016|ref|ZP_00791094.1| amino acid ABC transporter, amino acid-binding protein
           [Streptococcus agalactiae 515]
 gi|77158934|gb|EAO70167.1| amino acid ABC transporter, amino acid-binding protein
           [Streptococcus agalactiae 515]
          Length = 200

 Score = 79.3 bits (194), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 52/192 (27%), Positives = 95/192 (49%), Gaps = 7/192 (3%)

Query: 5   FFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGD-WKGFDVDF 63
           + +S + + +LF+ + ST+A+ L +IKK G LK G+   +  F    A  + ++G ++D 
Sbjct: 10  YLLSCIFIFLLFYPN-STSANQLSEIKKSGVLKVGVKQDVPNFGYHNAETNQYEGMEIDI 68

Query: 64  CRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITY 123
            + ++ ++   P    ++P  A+ R   + + QIDIL     +T+  E           Y
Sbjct: 69  AKKIAKSLGVKPV---FVPTTAQTREPLMDNGQIDILI--ATYTITPERKANYNISKAYY 123

Query: 124 FDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEID 183
            D  GF++ K   I ++ +L G  I V  G TT++ L  Y K H +K+         E+ 
Sbjct: 124 HDEIGFLVRKNSHIKTIKELDGKHIGVAQGATTKVNLEKYAKEHKLKFSYAXLGSFPELA 183

Query: 184 AAYRAHRCDAYT 195
            +  A+R DA++
Sbjct: 184 ISLYANRIDAFS 195


>gi|167628301|ref|YP_001678800.1| glutamine abc transporter, glutamine-binding protein
           [Heliobacterium modesticaldum Ice1]
 gi|167591041|gb|ABZ82789.1| glutamine abc transporter, glutamine-binding protein
           [Heliobacterium modesticaldum Ice1]
          Length = 282

 Score = 79.0 bits (193), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 60/222 (27%), Positives = 107/222 (48%), Gaps = 10/222 (4%)

Query: 22  TNASILGDIKKRGFLKCGINTGLVGFAEVKANGDW-KGFDVDFCRALSSAIFDDPSKIQY 80
           T+   +  IK RG+L  G+   +  F ++K+  D  +GF+VD  + L+  +F D SK++ 
Sbjct: 44  TSGDYIQTIKNRGYLIAGVKNDVPLFGQLKSGADKPEGFEVDIMKELAKKLFGDESKVKL 103

Query: 81  LPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSV 140
             + ++ R   LQ+ QIDI++  T  T+  E    + F  + +  GQ  ++ K   I SV
Sbjct: 104 EKVESQTRIPMLQNGQIDIVAGTT--TITEERKKQIDFSDVYFKAGQSLLVKKGSPIKSV 161

Query: 141 SQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISA 200
           + L G ++    G+T+   + +  KA + K     +    E   A +  R DA T D S 
Sbjct: 162 TDLKGKTVSTVRGSTSAKNIRE--KAPDAKVDE--YATYTEAFQALKLGRSDAMTTDNSI 217

Query: 201 LYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVS 242
           L  +   N+ P+  ++   + ++ P      +G  EW N V+
Sbjct: 218 L--MGFANEDPNFELV-GGLFTEEPYGFGFQKGHPEWVNYVN 256


>gi|260550584|ref|ZP_05824793.1| ArtI protein [Acinetobacter sp. RUH2624]
 gi|260406295|gb|EEW99778.1| ArtI protein [Acinetobacter sp. RUH2624]
          Length = 286

 Score = 79.0 bits (193), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 66/249 (26%), Positives = 117/249 (46%), Gaps = 11/249 (4%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           L  +KK G L+  +      F  V + G+ +GFDV   + ++  +  D  K++++   A 
Sbjct: 41  LEQVKKNGVLRVAVFADDPPFGYVDSAGNNQGFDVALAKRVTKDLLGDEKKVEFIVTEAS 100

Query: 87  ERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQ-GFIMHKKKGISSVSQLSG 145
            R   L+S + D++      T  R+  +  A  P  Y  G  G +  K K I+ ++QL G
Sbjct: 101 NRVEFLKSNRADVVFATFTVTPERKEVVDFA-EP--YLKGAFGIVSPKAKPITDIAQLEG 157

Query: 146 ASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALK 205
            ++ V  GT+++     YF  H  K + + FER  +   A    R DA + D  + YAL 
Sbjct: 158 KTLIVNKGTSSDT----YFTKHYPKVNLLKFERNSDAFKALTDGRGDAISQD--STYALA 211

Query: 206 LTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEEL-GITQKNINQV 264
                PS    +  I  +  +APA+ +G+T+  N ++     + T+ E+  I  + +  +
Sbjct: 212 WAAKNPSYVAGIQSIGDQEFIAPAVKKGNTQLLNWLNTEIKQLRTSGEIKKIYDETLKPI 271

Query: 265 SKDTTNPDV 273
             D+ NP+V
Sbjct: 272 YGDSVNPNV 280


>gi|239503576|ref|ZP_04662886.1| Glutamine-binding protein precursor (GlnBP) [Acinetobacter
           baumannii AB900]
          Length = 286

 Score = 79.0 bits (193), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 66/249 (26%), Positives = 117/249 (46%), Gaps = 11/249 (4%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           L  +KK G L+  +      F  V + G+ +GFDV   + ++  +  D  K++++   A 
Sbjct: 41  LEQVKKNGVLRVAVFADDPPFGYVDSAGNNQGFDVALAKRVTKDLLGDEKKVEFIVTEAS 100

Query: 87  ERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQ-GFIMHKKKGISSVSQLSG 145
            R   L+S + D++      T  R+  +  A  P  Y  G  G +  K K I+ ++QL G
Sbjct: 101 NRVEFLKSNRADVVLATFTVTPERKEVVDFA-EP--YLKGAFGIVSPKAKPITDIAQLEG 157

Query: 146 ASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALK 205
            ++ V  GT+++     YF  H  K + + FER  +   A    R DA + D  + YAL 
Sbjct: 158 KTLIVNKGTSSDT----YFTKHYPKVNLLKFERNSDAFKALTDGRGDAISQD--STYALA 211

Query: 206 LTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEEL-GITQKNINQV 264
                PS    +  I  +  +APA+ +G+T+  N ++     + T+ E+  I  + +  +
Sbjct: 212 WAAKNPSYVAGIQSIGDQEFIAPAVKKGNTQLLNWLNTEIKQLRTSGEIKKIYDETLKPI 271

Query: 265 SKDTTNPDV 273
             D+ NP+V
Sbjct: 272 YGDSVNPNV 280


>gi|258406149|ref|YP_003198891.1| extracellular solute-binding protein family 3 [Desulfohalobium
           retbaense DSM 5692]
 gi|257798376|gb|ACV69313.1| extracellular solute-binding protein family 3 [Desulfohalobium
           retbaense DSM 5692]
          Length = 275

 Score = 78.6 bits (192), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 65/252 (25%), Positives = 116/252 (46%), Gaps = 20/252 (7%)

Query: 6   FVSILCLIILFFTSFSTNASILG----DIKKRGFLKCGINTGLVGFAEVKANGDWKGFDV 61
           F  IL L ++F   FS  A + G     + K   ++ G+ T  +  A    + +W GFDV
Sbjct: 3   FGKILFLAVIF-ALFSAQAVLAGPTYDQVMKDKVIRAGLMTDSIPGAFYNKDNEWVGFDV 61

Query: 62  DFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPI 121
           D  + ++  +     +++ +P+  K R   +Q  +ID+   N   T  RE    + F   
Sbjct: 62  DIAKEIAKRL---DCELKRVPVTNKTRIAFVQQGRIDMSVANM--THKRERDKSIDFSIT 116

Query: 122 TYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKA---HNMKYHPIVFER 178
            +FDGQ  ++ KK   ++  ++ G  I    GTT+E+ L +  +     N   + I F++
Sbjct: 117 YFFDGQKLLV-KKGSFANWDEIVGQKIATMQGTTSEVNLKNKLEELGDTNADDNVISFQK 175

Query: 179 VEEIDAAYRAHRCDAYTGDISAL--YALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTE 236
             E   A    R   ++ D + L  YA K    RP E+ ++ D IS  P    + + D++
Sbjct: 176 ESECFQALEMGRVAGWSTDSTILLGYAAK----RPGEYELIGDFISDEPYGIGLPEDDSK 231

Query: 237 WYNIVSWTHYAM 248
           W + +++T   M
Sbjct: 232 WRDTINFTIQDM 243


>gi|218888235|ref|YP_002437556.1| extracellular solute-binding protein family 3 [Desulfovibrio
           vulgaris str. 'Miyazaki F']
 gi|218759189|gb|ACL10088.1| extracellular solute-binding protein family 3 [Desulfovibrio
           vulgaris str. 'Miyazaki F']
          Length = 271

 Score = 78.6 bits (192), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 58/237 (24%), Positives = 112/237 (47%), Gaps = 15/237 (6%)

Query: 10  LCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEV-KANGDWKGFDVDFCRALS 68
           LC+++   T    +A  + DIK RG L CG+    V F  + + +    GFD+D C+A++
Sbjct: 11  LCVVL---TGTMAHAGKIEDIKARGALVCGVKDSTVPFGYIDEQSKQIVGFDIDICKAVA 67

Query: 69  SAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYF-DGQ 127
             +     K++   + +  R   L    +D+++        R+  +  +   ITYF DGQ
Sbjct: 68  DKL---GVKLELKTVTSATRIPMLTQGSVDMVAATMTHKFERDDVIDFS---ITYFMDGQ 121

Query: 128 GFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYR 187
             ++ K  G+ S + L G  +    G+T+E  +    KA   +   + F+   +   A +
Sbjct: 122 KLLVKKGGGVKSAADLKGKKVATAKGSTSEKNI----KAAQPEATVVSFDEYPQAFLALK 177

Query: 188 AHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWT 244
             + +A T D + L  L+ ++  P +  I+ D IS  P    + + D+++ ++V+ T
Sbjct: 178 QGKAEAVTTDSTILLGLRNSDPEPDKWEIVGDYISPEPYGLGLAENDSKFRDLVNRT 234


>gi|260555372|ref|ZP_05827593.1| ArtI protein [Acinetobacter baumannii ATCC 19606]
 gi|260411914|gb|EEX05211.1| ArtI protein [Acinetobacter baumannii ATCC 19606]
          Length = 286

 Score = 78.6 bits (192), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 66/249 (26%), Positives = 117/249 (46%), Gaps = 11/249 (4%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           L  +KK G L+  +      F  V + G+ +GFDV   + ++  +  D  K++++   A 
Sbjct: 41  LEQVKKNGVLRVAVFADDPPFGYVDSAGNNQGFDVALAKRVTKDLLGDEKKVEFIVTEAS 100

Query: 87  ERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQ-GFIMHKKKGISSVSQLSG 145
            R   L+S + D++      T  R+  +  A  P  Y  G  G +  K K I+ ++QL G
Sbjct: 101 NRVEFLKSNRADVVFATFTVTPERKEVVDFA-EP--YLKGAFGIVSPKAKPITDIAQLEG 157

Query: 146 ASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALK 205
            ++ V  GT+++     YF  H  K + + FER  +   A    R DA + D  + YAL 
Sbjct: 158 KTLIVNKGTSSDT----YFTKHYPKVNLLKFERNSDAFKALTDGRGDAISQD--STYALA 211

Query: 206 LTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEEL-GITQKNINQV 264
                PS    +  I  +  +APA+ +G+T+  N ++     + T+ E+  I  + +  +
Sbjct: 212 WAAKNPSYVAGIQSIGDQEFIAPAVKKGNTQLLNWLNTEIKQLRTSGEIKKIYDETLKPI 271

Query: 265 SKDTTNPDV 273
             D+ NP+V
Sbjct: 272 YGDSVNPNV 280


>gi|289744107|ref|ZP_06503485.1| glutamine-binding lipoprotein glnH [Mycobacterium tuberculosis
           02_1987]
 gi|289684635|gb|EFD52123.1| glutamine-binding lipoprotein glnH [Mycobacterium tuberculosis
           02_1987]
          Length = 337

 Score = 78.6 bits (192), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 62/210 (29%), Positives = 96/210 (45%), Gaps = 18/210 (8%)

Query: 16  FFTSFSTNASILGDIKKRGFLKCGINTG--LVGFAEVKANGDWKGFDVDFCRALSSAIFD 73
           F T    +A++  DI+ RG L  G++ G  L  F +    G+  GFDVD    ++  IF 
Sbjct: 84  FATKAEADAAV-ADIRARGRLIVGLDIGSNLFSFRD-PITGEITGFDVDIAGEVARDIFG 141

Query: 74  DPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDG-QGFIMH 132
            PS ++Y  L+A ER  ALQ  Q+DI+ +    T  R   +  +     Y D  Q  +  
Sbjct: 142 VPSHVEYRILSAAERVTALQKSQVDIVVKTMSITCERRKLVNFS---TVYLDANQRILAP 198

Query: 133 KKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDA--AYRAHR 190
           +   I+ VS LSG  +CV  GTT+        +   +   P++   V   D   A +   
Sbjct: 199 RDSPITKVSDLSGKRVCVARGTTS------LRRIREIAPPPVIVSVVNWADCLVALQQRE 252

Query: 191 CDAYTGDISALYALKLTNDRPSEHVILPDI 220
            DA + D + L    L  + P  H++ PD+
Sbjct: 253 IDAVSTDDTILAG--LVEEDPYLHIVGPDM 280


>gi|323721082|gb|EGB30144.1| glutamine-binding lipoprotein glnH [Mycobacterium tuberculosis
           CDC1551A]
          Length = 329

 Score = 78.6 bits (192), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 62/210 (29%), Positives = 96/210 (45%), Gaps = 18/210 (8%)

Query: 16  FFTSFSTNASILGDIKKRGFLKCGINTG--LVGFAEVKANGDWKGFDVDFCRALSSAIFD 73
           F T    +A++  DI+ RG L  G++ G  L  F +    G+  GFDVD    ++  IF 
Sbjct: 76  FATKAEADAAV-ADIRARGRLIVGLDIGSNLFSFRD-PITGEITGFDVDIAGEVARDIFG 133

Query: 74  DPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDG-QGFIMH 132
            PS ++Y  L+A ER  ALQ  Q+DI+ +    T  R   +  +     Y D  Q  +  
Sbjct: 134 VPSHVEYRILSAAERVTALQKSQVDIVVKTMSITCERRKLVNFS---TVYLDANQRILAP 190

Query: 133 KKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDA--AYRAHR 190
           +   I+ VS LSG  +CV  GTT+        +   +   P++   V   D   A +   
Sbjct: 191 RDSPITKVSDLSGKRVCVARGTTS------LRRIREIAPPPVIVSVVNWADCLVALQQRE 244

Query: 191 CDAYTGDISALYALKLTNDRPSEHVILPDI 220
            DA + D + L    L  + P  H++ PD+
Sbjct: 245 IDAVSTDDTILAG--LVEEDPYLHIVGPDM 272


>gi|193077069|gb|ABO11827.2| ArtI protein [Acinetobacter baumannii ATCC 17978]
          Length = 286

 Score = 78.6 bits (192), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 66/249 (26%), Positives = 117/249 (46%), Gaps = 11/249 (4%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           L  +KK G L+  +      F  V + G+ +GFDV   + ++  +  D  K++++   A 
Sbjct: 41  LEQVKKNGVLRVAVFADDPPFGYVDSAGNNQGFDVALAKRVTKDLLGDEKKVEFIVTEAS 100

Query: 87  ERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQ-GFIMHKKKGISSVSQLSG 145
            R   L+S + D++      T  R+  +  A  P  Y  G  G +  K K I+ ++QL G
Sbjct: 101 NRVEFLKSNRADVVFATFTVTPERKEVVDFA-EP--YLKGAFGIVSPKAKPITDIAQLEG 157

Query: 146 ASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALK 205
            ++ V  GT+++     YF  H  K + + FER  +   A    R DA + D  + YAL 
Sbjct: 158 KTLIVNKGTSSDT----YFTKHYPKVNLLKFERNSDAFKALTDGRGDAISQD--STYALA 211

Query: 206 LTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEEL-GITQKNINQV 264
                PS    +  I  +  +APA+ +G+T+  N ++     + T+ E+  I  + +  +
Sbjct: 212 WAAKNPSYVAGIQSIGDQEFIAPAVKKGNTQLLNWLNTEIKQLRTSGEIKKIYDETLKPI 271

Query: 265 SKDTTNPDV 273
             D+ NP+V
Sbjct: 272 YGDSVNPNV 280


>gi|215402161|ref|ZP_03414342.1| glutamine-binding lipoprotein glnH [Mycobacterium tuberculosis
           02_1987]
          Length = 329

 Score = 78.6 bits (192), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 62/210 (29%), Positives = 96/210 (45%), Gaps = 18/210 (8%)

Query: 16  FFTSFSTNASILGDIKKRGFLKCGINTG--LVGFAEVKANGDWKGFDVDFCRALSSAIFD 73
           F T    +A++  DI+ RG L  G++ G  L  F +    G+  GFDVD    ++  IF 
Sbjct: 76  FATKAEADAAV-ADIRARGRLIVGLDIGSNLFSFRD-PITGEITGFDVDIAGEVARDIFG 133

Query: 74  DPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDG-QGFIMH 132
            PS ++Y  L+A ER  ALQ  Q+DI+ +    T  R   +  +     Y D  Q  +  
Sbjct: 134 VPSHVEYRILSAAERVTALQKSQVDIVVKTMSITCERRKLVNFS---TVYLDANQRILAP 190

Query: 133 KKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDA--AYRAHR 190
           +   I+ VS LSG  +CV  GTT+        +   +   P++   V   D   A +   
Sbjct: 191 RDSPITKVSDLSGKRVCVARGTTS------LRRIREIAPPPVIVSVVNWADCLVALQQRE 244

Query: 191 CDAYTGDISALYALKLTNDRPSEHVILPDI 220
            DA + D + L    L  + P  H++ PD+
Sbjct: 245 IDAVSTDDTILAG--LVEEDPYLHIVGPDM 272


>gi|308369386|ref|ZP_07666727.1| glutamine-binding lipoprotein glnH [Mycobacterium tuberculosis
           SUMu002]
 gi|308370400|ref|ZP_07666925.1| glutamine-binding lipoprotein glnH [Mycobacterium tuberculosis
           SUMu003]
 gi|308372885|ref|ZP_07667473.1| glutamine-binding lipoprotein glnH [Mycobacterium tuberculosis
           SUMu005]
 gi|308375151|ref|ZP_07442886.2| glutamine-binding lipoprotein glnH [Mycobacterium tuberculosis
           SUMu007]
 gi|308327701|gb|EFP16552.1| glutamine-binding lipoprotein glnH [Mycobacterium tuberculosis
           SUMu002]
 gi|308332063|gb|EFP20914.1| glutamine-binding lipoprotein glnH [Mycobacterium tuberculosis
           SUMu003]
 gi|308339455|gb|EFP28306.1| glutamine-binding lipoprotein glnH [Mycobacterium tuberculosis
           SUMu005]
 gi|308347232|gb|EFP36083.1| glutamine-binding lipoprotein glnH [Mycobacterium tuberculosis
           SUMu007]
          Length = 308

 Score = 78.6 bits (192), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 62/210 (29%), Positives = 96/210 (45%), Gaps = 18/210 (8%)

Query: 16  FFTSFSTNASILGDIKKRGFLKCGINTG--LVGFAEVKANGDWKGFDVDFCRALSSAIFD 73
           F T    +A++  DI+ RG L  G++ G  L  F +    G+  GFDVD    ++  IF 
Sbjct: 55  FATKAEADAAV-ADIRARGRLIVGLDIGSNLFSFRD-PITGEITGFDVDIAGEVARDIFG 112

Query: 74  DPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDG-QGFIMH 132
            PS ++Y  L+A ER  ALQ  Q+DI+ +    T  R   +  +     Y D  Q  +  
Sbjct: 113 VPSHVEYRILSAAERVTALQKSQVDIVVKTMSITCERRKLVNFS---TVYLDANQRILAP 169

Query: 133 KKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDA--AYRAHR 190
           +   I+ VS LSG  +CV  GTT+        +   +   P++   V   D   A +   
Sbjct: 170 RDSPITKVSDLSGKRVCVARGTTS------LRRIREIAPPPVIVSVVNWADCLVALQQRE 223

Query: 191 CDAYTGDISALYALKLTNDRPSEHVILPDI 220
            DA + D + L    L  + P  H++ PD+
Sbjct: 224 IDAVSTDDTILAG--LVEEDPYLHIVGPDM 251


>gi|15607552|ref|NP_214925.1| glutamine-binding lipoprotein [Mycobacterium tuberculosis H37Rv]
 gi|15839797|ref|NP_334834.1| amino acid ABC transporter, amino acid-binding protein
           [Mycobacterium tuberculosis CDC1551]
 gi|31791589|ref|NP_854082.1| glutamine-binding lipoprotein [Mycobacterium bovis AF2122/97]
 gi|121636325|ref|YP_976548.1| putative glutamine-binding lipoprotein glnH [Mycobacterium bovis
           BCG str. Pasteur 1173P2]
 gi|148660176|ref|YP_001281699.1| amino acid ABC transporter substrate-binding protein [Mycobacterium
           tuberculosis H37Ra]
 gi|148821607|ref|YP_001286361.1| glutamine-binding lipoprotein glnH [Mycobacterium tuberculosis F11]
 gi|167970774|ref|ZP_02553051.1| glutamine-binding lipoprotein glnH [Mycobacterium tuberculosis
           H37Ra]
 gi|215409923|ref|ZP_03418731.1| glutamine-binding lipoprotein glnH [Mycobacterium tuberculosis
           94_M4241A]
 gi|215429231|ref|ZP_03427150.1| glutamine-binding lipoprotein glnH [Mycobacterium tuberculosis
           EAS054]
 gi|215444497|ref|ZP_03431249.1| glutamine-binding lipoprotein glnH [Mycobacterium tuberculosis T85]
 gi|218752041|ref|ZP_03530837.1| glutamine-binding lipoprotein glnH [Mycobacterium tuberculosis GM
           1503]
 gi|219556230|ref|ZP_03535306.1| glutamine-binding lipoprotein glnH [Mycobacterium tuberculosis T17]
 gi|224988797|ref|YP_002643484.1| putative glutamine-binding lipoprotein [Mycobacterium bovis BCG
           str. Tokyo 172]
 gi|253797334|ref|YP_003030335.1| glutamine-binding lipoprotein glnH [Mycobacterium tuberculosis KZN
           1435]
 gi|254363375|ref|ZP_04979421.1| glutamine-binding lipoprotein glnH [Mycobacterium tuberculosis str.
           Haarlem]
 gi|254549356|ref|ZP_05139803.1| glutamine-binding lipoprotein glnH [Mycobacterium tuberculosis
           '98-R604 INH-RIF-EM']
 gi|260185276|ref|ZP_05762750.1| glutamine-binding lipoprotein glnH [Mycobacterium tuberculosis
           CPHL_A]
 gi|260199407|ref|ZP_05766898.1| glutamine-binding lipoprotein glnH [Mycobacterium tuberculosis T46]
 gi|260203559|ref|ZP_05771050.1| glutamine-binding lipoprotein glnH [Mycobacterium tuberculosis K85]
 gi|289441790|ref|ZP_06431534.1| glutamine-binding lipoprotein glnH [Mycobacterium tuberculosis T46]
 gi|289445950|ref|ZP_06435694.1| glutamine-binding lipoprotein glnH [Mycobacterium tuberculosis
           CPHL_A]
 gi|289552660|ref|ZP_06441870.1| glutamine-binding lipoprotein glnH [Mycobacterium tuberculosis KZN
           605]
 gi|289568326|ref|ZP_06448553.1| glutamine-binding lipoprotein glnH [Mycobacterium tuberculosis T17]
 gi|289572996|ref|ZP_06453223.1| glutamine-binding lipoprotein glnH [Mycobacterium tuberculosis K85]
 gi|289752440|ref|ZP_06511818.1| glutamine-binding lipoprotein glnH [Mycobacterium tuberculosis
           EAS054]
 gi|289756480|ref|ZP_06515858.1| glutamine-binding lipoprotein glnH [Mycobacterium tuberculosis T85]
 gi|289760527|ref|ZP_06519905.1| glutamine-binding lipoprotein glnH [Mycobacterium tuberculosis GM
           1503]
 gi|294995916|ref|ZP_06801607.1| glutamine-binding lipoprotein glnH [Mycobacterium tuberculosis 210]
 gi|297632893|ref|ZP_06950673.1| glutamine-binding lipoprotein glnH [Mycobacterium tuberculosis KZN
           4207]
 gi|297729868|ref|ZP_06958986.1| glutamine-binding lipoprotein glnH [Mycobacterium tuberculosis KZN
           R506]
 gi|298523887|ref|ZP_07011296.1| amino acid ABC transporter, amino acid-binding protein
           [Mycobacterium tuberculosis 94_M4241A]
 gi|306774505|ref|ZP_07412842.1| glutamine-binding lipoprotein glnH [Mycobacterium tuberculosis
           SUMu001]
 gi|306787410|ref|ZP_07425732.1| glutamine-binding lipoprotein glnH [Mycobacterium tuberculosis
           SUMu004]
 gi|306796149|ref|ZP_07434451.1| glutamine-binding lipoprotein glnH [Mycobacterium tuberculosis
           SUMu006]
 gi|306966414|ref|ZP_07479075.1| glutamine-binding lipoprotein glnH [Mycobacterium tuberculosis
           SUMu009]
 gi|306970609|ref|ZP_07483270.1| glutamine-binding lipoprotein glnH [Mycobacterium tuberculosis
           SUMu010]
 gi|307078335|ref|ZP_07487505.1| glutamine-binding lipoprotein glnH [Mycobacterium tuberculosis
           SUMu011]
 gi|307082893|ref|ZP_07492006.1| glutamine-binding lipoprotein glnH [Mycobacterium tuberculosis
           SUMu012]
 gi|313657197|ref|ZP_07814077.1| glutamine-binding lipoprotein glnH [Mycobacterium tuberculosis KZN
           V2475]
 gi|1817677|emb|CAB06581.1| PROBABLE GLUTAMINE-BINDING LIPOPROTEIN GLNH (GLNBP) [Mycobacterium
           tuberculosis H37Rv]
 gi|13879927|gb|AAK44648.1| amino acid ABC transporter, amino acid-binding protein
           [Mycobacterium tuberculosis CDC1551]
 gi|31617175|emb|CAD93282.1| PROBABLE GLUTAMINE-BINDING LIPOPROTEIN GLNH (GLNBP) [Mycobacterium
           bovis AF2122/97]
 gi|121491972|emb|CAL70435.1| Probable glutamine-binding lipoprotein glnH [Mycobacterium bovis
           BCG str. Pasteur 1173P2]
 gi|134148889|gb|EBA40934.1| glutamine-binding lipoprotein glnH [Mycobacterium tuberculosis str.
           Haarlem]
 gi|148504328|gb|ABQ72137.1| amino acid ABC transporter substrate-binding protein [Mycobacterium
           tuberculosis H37Ra]
 gi|148720134|gb|ABR04759.1| glutamine-binding lipoprotein glnH [Mycobacterium tuberculosis F11]
 gi|224771910|dbj|BAH24716.1| putative glutamine-binding lipoprotein [Mycobacterium bovis BCG
           str. Tokyo 172]
 gi|253318837|gb|ACT23440.1| glutamine-binding lipoprotein glnH [Mycobacterium tuberculosis KZN
           1435]
 gi|289414709|gb|EFD11949.1| glutamine-binding lipoprotein glnH [Mycobacterium tuberculosis T46]
 gi|289418908|gb|EFD16109.1| glutamine-binding lipoprotein glnH [Mycobacterium tuberculosis
           CPHL_A]
 gi|289437292|gb|EFD19785.1| glutamine-binding lipoprotein glnH [Mycobacterium tuberculosis KZN
           605]
 gi|289537427|gb|EFD42005.1| glutamine-binding lipoprotein glnH [Mycobacterium tuberculosis K85]
 gi|289542079|gb|EFD45728.1| glutamine-binding lipoprotein glnH [Mycobacterium tuberculosis T17]
 gi|289693027|gb|EFD60456.1| glutamine-binding lipoprotein glnH [Mycobacterium tuberculosis
           EAS054]
 gi|289708033|gb|EFD72049.1| glutamine-binding lipoprotein glnH [Mycobacterium tuberculosis GM
           1503]
 gi|289712044|gb|EFD76056.1| glutamine-binding lipoprotein glnH [Mycobacterium tuberculosis T85]
 gi|298493681|gb|EFI28975.1| amino acid ABC transporter, amino acid-binding protein
           [Mycobacterium tuberculosis 94_M4241A]
 gi|308216857|gb|EFO76256.1| glutamine-binding lipoprotein glnH [Mycobacterium tuberculosis
           SUMu001]
 gi|308335878|gb|EFP24729.1| glutamine-binding lipoprotein glnH [Mycobacterium tuberculosis
           SUMu004]
 gi|308343320|gb|EFP32171.1| glutamine-binding lipoprotein glnH [Mycobacterium tuberculosis
           SUMu006]
 gi|308355813|gb|EFP44664.1| glutamine-binding lipoprotein glnH [Mycobacterium tuberculosis
           SUMu009]
 gi|308359733|gb|EFP48584.1| glutamine-binding lipoprotein glnH [Mycobacterium tuberculosis
           SUMu010]
 gi|308363675|gb|EFP52526.1| glutamine-binding lipoprotein glnH [Mycobacterium tuberculosis
           SUMu011]
 gi|308367326|gb|EFP56177.1| glutamine-binding lipoprotein glnH [Mycobacterium tuberculosis
           SUMu012]
 gi|326902236|gb|EGE49169.1| glutamine-binding lipoprotein glnH [Mycobacterium tuberculosis
           W-148]
 gi|328457121|gb|AEB02544.1| glutamine-binding lipoprotein glnH [Mycobacterium tuberculosis KZN
           4207]
          Length = 328

 Score = 78.2 bits (191), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 62/210 (29%), Positives = 96/210 (45%), Gaps = 18/210 (8%)

Query: 16  FFTSFSTNASILGDIKKRGFLKCGINTG--LVGFAEVKANGDWKGFDVDFCRALSSAIFD 73
           F T    +A++  DI+ RG L  G++ G  L  F +    G+  GFDVD    ++  IF 
Sbjct: 75  FATKAEADAAV-ADIRARGRLIVGLDIGSNLFSFRD-PITGEITGFDVDIAGEVARDIFG 132

Query: 74  DPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDG-QGFIMH 132
            PS ++Y  L+A ER  ALQ  Q+DI+ +    T  R   +  +     Y D  Q  +  
Sbjct: 133 VPSHVEYRILSAAERVTALQKSQVDIVVKTMSITCERRKLVNFS---TVYLDANQRILAP 189

Query: 133 KKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDA--AYRAHR 190
           +   I+ VS LSG  +CV  GTT+        +   +   P++   V   D   A +   
Sbjct: 190 RDSPITKVSDLSGKRVCVARGTTS------LRRIREIAPPPVIVSVVNWADCLVALQQRE 243

Query: 191 CDAYTGDISALYALKLTNDRPSEHVILPDI 220
            DA + D + L    L  + P  H++ PD+
Sbjct: 244 IDAVSTDDTILAG--LVEEDPYLHIVGPDM 271


>gi|293608419|ref|ZP_06690722.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292828992|gb|EFF87354.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 286

 Score = 78.2 bits (191), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 66/249 (26%), Positives = 117/249 (46%), Gaps = 11/249 (4%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           L  +KK G L+  +      F  V + G+ +GFDV   + ++  +  D  K++++   A 
Sbjct: 41  LEQVKKNGVLRVAVFADDPPFGFVDSAGNNQGFDVALAKRVTKDLLGDEKKVEFIVTEAS 100

Query: 87  ERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQ-GFIMHKKKGISSVSQLSG 145
            R   L+S + D++      T  R+  +  A  P  Y  G  G +  K K I+ ++QL G
Sbjct: 101 NRVEFLKSNRADVVFATFTVTPERKEVVDFA-EP--YLKGAFGIVSPKAKPITDIAQLEG 157

Query: 146 ASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALK 205
            ++ V  GT+++     YF  H  K + + FER  +   A    R DA + D  + YAL 
Sbjct: 158 KTLIVNKGTSSDT----YFTKHYPKVNLLKFERNSDAFKALTDGRGDAISQD--STYALA 211

Query: 206 LTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEEL-GITQKNINQV 264
                PS    +  I  +  +APA+ +G+T+  N ++     + T+ E+  I  + +  +
Sbjct: 212 WAAKNPSYVAGIQSIGDQEFIAPAVKKGNTQLLNWLNTEIKQLRTSGEIKKIYDETLKPI 271

Query: 265 SKDTTNPDV 273
             D+ NP+V
Sbjct: 272 YGDSVNPNV 280


>gi|184157761|ref|YP_001846100.1| amino acid ABC transporter periplasmic protein [Acinetobacter
           baumannii ACICU]
 gi|294842167|ref|ZP_06786850.1| amino acid ABC transporter periplasmic protein [Acinetobacter sp.
           6014059]
 gi|183209355|gb|ACC56753.1| ABC-type amino acid transport/signal transduction system,
           periplasmic component/domain [Acinetobacter baumannii
           ACICU]
 gi|322508071|gb|ADX03525.1| ArtI protein [Acinetobacter baumannii 1656-2]
 gi|323517653|gb|ADX92034.1| amino acid ABC transporter periplasmic protein [Acinetobacter
           baumannii TCDC-AB0715]
          Length = 286

 Score = 78.2 bits (191), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 66/249 (26%), Positives = 117/249 (46%), Gaps = 11/249 (4%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           L  +KK G L+  +      F  V + G+ +GFDV   + ++  +  D  K++++   A 
Sbjct: 41  LEQVKKNGVLRVAVFADDPPFGFVDSAGNNQGFDVALAKRVTKDLLGDEKKVEFIVTEAS 100

Query: 87  ERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQ-GFIMHKKKGISSVSQLSG 145
            R   L+S + D++      T  R+  +  A  P  Y  G  G +  K K I+ ++QL G
Sbjct: 101 NRVEFLKSNRADVVFATFTVTPERKEVVDFA-EP--YLKGAFGIVSPKAKPITDIAQLEG 157

Query: 146 ASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALK 205
            ++ V  GT+++     YF  H  K + + FER  +   A    R DA + D  + YAL 
Sbjct: 158 KTLIVNKGTSSDT----YFTKHYPKVNLLKFERNSDAFKALTDGRGDAISQD--STYALA 211

Query: 206 LTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEEL-GITQKNINQV 264
                PS    +  I  +  +APA+ +G+T+  N ++     + T+ E+  I  + +  +
Sbjct: 212 WAAKNPSYVAGIQSIGDQEFIAPAVKKGNTQLLNWLNTEIKQLRTSGEIKKIYDETLKPI 271

Query: 265 SKDTTNPDV 273
             D+ NP+V
Sbjct: 272 YGDSVNPNV 280


>gi|319791947|ref|YP_004153587.1| extracellular solute-binding protein family 3 [Variovorax paradoxus
           EPS]
 gi|315594410|gb|ADU35476.1| extracellular solute-binding protein family 3 [Variovorax paradoxus
           EPS]
          Length = 304

 Score = 78.2 bits (191), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 58/231 (25%), Positives = 106/231 (45%), Gaps = 5/231 (2%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSK---IQYLPL 83
           L   ++ G +  G     V F+ + A  +  G+ ++ CRAL +AI D  +K   I+++P+
Sbjct: 38  LAKARETGAITIGYRESSVPFSYLNARKEPIGYSIELCRALVTAIEDTVNKSLTIKWVPV 97

Query: 84  NAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQL 143
            +  R  A+ S Q+D+   +T   L R+  +  +F P  +  G   ++ K   I S   L
Sbjct: 98  TSDSRIDAVASGQVDLECGSTTNNLERQKRV--SFSPTMFVSGTKVLVKKGAPIKSFRDL 155

Query: 144 SGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYA 203
           +G  + V AGTT E TL D  +   +  +  V     E     ++ + DA+  D   LY 
Sbjct: 156 AGKKVAVTAGTTNEKTLRDLSEKFKLGINLQVARDHAESFGLVKSGQADAFATDDVLLYG 215

Query: 204 LKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEEL 254
           L   +   +++ ++ D +S  P      +GD +   +V+ T   +    E+
Sbjct: 216 LIAQDAAKADYEVVGDFLSYDPYGIMYRKGDAQLAKVVNDTFQVLAEDGEI 266


>gi|269120152|ref|YP_003308329.1| extracellular solute-binding protein family 3 [Sebaldella
           termitidis ATCC 33386]
 gi|268614030|gb|ACZ08398.1| extracellular solute-binding protein family 3 [Sebaldella
           termitidis ATCC 33386]
          Length = 283

 Score = 77.8 bits (190), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 68/249 (27%), Positives = 111/249 (44%), Gaps = 18/249 (7%)

Query: 1   MYKDFFVSILCLIILFF----TSFSTNASILGDI---KKRGFLKCGINTGLVGFAEVKAN 53
           M K  F+S++ L++        +   NA   G+I   +KRG L  G+ T    F  +   
Sbjct: 1   MKKLLFLSLMVLVLFVSCGNKNTDDNNAKTSGEIEKIQKRGKLIVGVFTDKPPFGFINEK 60

Query: 54  GDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREIS 113
            +  GFD+   +  +  +  D +KI+++P+ A  R   LQS ++DI+  N   T  RE  
Sbjct: 61  NENDGFDIALAKQFAKDLLGDENKIEFVPVEAASRVPFLQSDKVDIIMANMTVTPDREKV 120

Query: 114 LGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHP 173
           +  A  P      Q  + + K  I S++ L G  + V  GTT ++    +F  +      
Sbjct: 121 VDFA-NPYMKVAIQ-ILGNDKDNIKSLNDLKGKKLIVNKGTTADI----FFTKNYPDIEL 174

Query: 174 IVFERVEEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQG 233
           + F+   E   A +  R  A   D   LYA   TN  P   ++   +   SP+APA+ +G
Sbjct: 175 LRFDHNTEAFQALKDGRGVALAHDSLLLYAWAQTN--PGFTIVNEKLEEPSPIAPAVKKG 232

Query: 234 DT---EWYN 239
           +    EW N
Sbjct: 233 NNELREWIN 241


>gi|169796305|ref|YP_001714098.1| amino acid ABC transporter periplasmic substrate-binding protein
           [Acinetobacter baumannii AYE]
 gi|213156959|ref|YP_002319004.1| ABC transporter, periplasmic binding protein [Acinetobacter
           baumannii AB0057]
 gi|215483764|ref|YP_002325989.1| Glutamine-binding protein precursor (GlnBP) [Acinetobacter
           baumannii AB307-0294]
 gi|294837743|ref|ZP_06782426.1| Glutamine-binding protein precursor (GlnBP) [Acinetobacter sp.
           6013113]
 gi|294859370|ref|ZP_06797139.1| Glutamine-binding protein precursor (GlnBP) [Acinetobacter sp.
           6013150]
 gi|301344840|ref|ZP_07225581.1| Glutamine-binding protein precursor (GlnBP) [Acinetobacter
           baumannii AB056]
 gi|301510867|ref|ZP_07236104.1| Glutamine-binding protein precursor (GlnBP) [Acinetobacter
           baumannii AB058]
 gi|301596929|ref|ZP_07241937.1| Glutamine-binding protein precursor (GlnBP) [Acinetobacter
           baumannii AB059]
 gi|169149232|emb|CAM87114.1| putative amino acid transport protein (ABC superfamily, peri_bind)
           [Acinetobacter baumannii AYE]
 gi|213056119|gb|ACJ41021.1| ABC transporter, periplasmic binding protein [Acinetobacter
           baumannii AB0057]
 gi|213987452|gb|ACJ57751.1| Glutamine-binding protein precursor (GlnBP) [Acinetobacter
           baumannii AB307-0294]
          Length = 286

 Score = 77.8 bits (190), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 65/249 (26%), Positives = 117/249 (46%), Gaps = 11/249 (4%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           L  +KK G L+  +      F  V + G+ +GFDV   + ++  +  D  K++++   A 
Sbjct: 41  LEQVKKNGVLRVAVFADDPPFGYVDSAGNNQGFDVALAKRVTKDLLGDEKKVEFIVTEAS 100

Query: 87  ERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQ-GFIMHKKKGISSVSQLSG 145
            R   L+S + D++      T  R+  +  A  P  Y  G  G +  K + I+ ++QL G
Sbjct: 101 NRVEFLKSNRADVVFATFTVTPERKEVVDFA-EP--YLKGAFGIVSPKARPITDIAQLEG 157

Query: 146 ASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALK 205
            ++ V  GT+++     YF  H  K + + FER  +   A    R DA + D  + YAL 
Sbjct: 158 KTLIVNKGTSSDT----YFTKHYPKVNLLKFERNSDAFKALTDGRGDAISQD--STYALA 211

Query: 206 LTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEEL-GITQKNINQV 264
                PS    +  I  +  +APA+ +G+T+  N ++     + T+ E+  I  + +  +
Sbjct: 212 WAAKNPSYVAGIQSIGDQEFIAPAVKKGNTQLLNWLNTEIKQLRTSGEIKKIYDETLKPI 271

Query: 265 SKDTTNPDV 273
             D+ NP+V
Sbjct: 272 YGDSVNPNV 280


>gi|256377588|ref|YP_003101248.1| extracellular solute-binding protein family 3 [Actinosynnema mirum
           DSM 43827]
 gi|255921891|gb|ACU37402.1| extracellular solute-binding protein family 3 [Actinosynnema mirum
           DSM 43827]
          Length = 319

 Score = 77.8 bits (190), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 53/206 (25%), Positives = 104/206 (50%), Gaps = 15/206 (7%)

Query: 23  NASILGDIKKRGFLKCGI--NTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQY 80
           + S +  I +RG L  G+  NT L+GF +    G+ +GFDVD  R ++ ++  DP+K+++
Sbjct: 75  SGSTMRRIAERGQLVVGVDQNTYLMGFRD-PFTGELQGFDVDLAREVARSLLGDPTKVRF 133

Query: 81  LPLNAKERFLALQSKQIDILSRNTDWTL--LREISLGLAFRPITYFDGQGFIMHKKKGIS 138
             LN+ +R  AL++ ++D++ R    T    R ++   ++    Y  GQ  ++ K  G++
Sbjct: 134 RVLNSDQRLPALETGEVDVVVRTMTITCERWRRVNFSTSY----YEAGQRVLVPKDSGVT 189

Query: 139 SVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDI 198
            ++ LSG  +C   G++   +LA + +AH     P+      +     +  + DA + D 
Sbjct: 190 GLTALSGRKVCATTGSS---SLA-HVRAHPSGPVPVAVPNWTDCLVMLQQGQVDAISTDD 245

Query: 199 SALYALKLTNDRPSEHVILPDIISKS 224
           + L      +  P   V+ P + ++S
Sbjct: 246 TILAGFAAQD--PYTEVVGPRLTTES 269


>gi|299770571|ref|YP_003732597.1| Glutamine-binding protein precursor (GlnBP) [Acinetobacter sp. DR1]
 gi|298700659|gb|ADI91224.1| Glutamine-binding protein precursor (GlnBP) [Acinetobacter sp. DR1]
          Length = 286

 Score = 77.4 bits (189), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 65/249 (26%), Positives = 117/249 (46%), Gaps = 11/249 (4%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           L  +KK G L+  +      F  V + G+ +GFDV   + ++  +  D  K++++   A 
Sbjct: 41  LEQVKKNGVLRVAVFADDPPFGYVDSAGNNQGFDVALAKRVTKDLLGDEKKVEFIVTEAS 100

Query: 87  ERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQ-GFIMHKKKGISSVSQLSG 145
            R   L+S + D++      T  R+  +  +  P  Y  G  G +  K K I+ ++QL G
Sbjct: 101 NRVEFLKSNRADVVFATFTVTPERKEVVDFS-EP--YLKGAFGIVSPKAKPITDIAQLEG 157

Query: 146 ASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALK 205
            ++ V  GT+++     YF  H  K + + FER  +   A    R DA + D  + YAL 
Sbjct: 158 KTLIVNKGTSSDT----YFTKHYPKVNLLKFERNSDAFKALTDGRGDAISQD--STYALA 211

Query: 206 LTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEEL-GITQKNINQV 264
                PS    +  I  +  +APA+ +G+T+  N ++     + T+ E+  I  + +  +
Sbjct: 212 WAAKNPSYVAGIQSIGDQEFIAPAVKKGNTQLLNWLNTEIKQLRTSGEIKKIYDETLKPI 271

Query: 265 SKDTTNPDV 273
             D+ NP+V
Sbjct: 272 YGDSVNPNV 280


>gi|239909117|ref|YP_002955859.1| amino acid ABC transporter substrate binding protein precursor
           [Desulfovibrio magneticus RS-1]
 gi|239798984|dbj|BAH77973.1| amino acid ABC transporter substrate binding protein precursor
           [Desulfovibrio magneticus RS-1]
          Length = 272

 Score = 77.4 bits (189), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 65/245 (26%), Positives = 111/245 (45%), Gaps = 14/245 (5%)

Query: 1   MYKDFFVSILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGL--VGFAEVKANGDWKG 58
           M K   +++L  +     +    A  L DIK RG L  G+       GF + K N    G
Sbjct: 1   MRKAARLTVLACLFTLVAAMPALAGKLDDIKSRGTLVAGVKDSQRPFGFVDEKTN-QIVG 59

Query: 59  FDVDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAF 118
           F++D  +AL++ +    +K++  P+ +  R   L    +DI++        RE  +  + 
Sbjct: 60  FEIDLMQALATRL---NAKLELKPVTSSTRIPMLTQGAVDIVAATMTHKKEREDQVDFS- 115

Query: 119 RPITYF-DGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFE 177
             ITYF  GQ  ++ K  GI SV+ L+G  +    G+T+E  +    K        I FE
Sbjct: 116 --ITYFMTGQKLLVKKDGGIKSVADLAGKKVGSVKGSTSEQNV----KKAQPDCTVISFE 169

Query: 178 RVEEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEW 237
              E   A +  +  A T D S L  +K ++D+P    I+ + IS  P    + + D+++
Sbjct: 170 TYPEAFLALKQGKVQAVTTDESILVGIKNSDDKPEAWDIVGEYISPEPYGLGVAENDSDF 229

Query: 238 YNIVS 242
            + V+
Sbjct: 230 RDFVN 234


>gi|258406273|ref|YP_003199015.1| extracellular solute-binding protein family 3 [Desulfohalobium
           retbaense DSM 5692]
 gi|257798500|gb|ACV69437.1| extracellular solute-binding protein family 3 [Desulfohalobium
           retbaense DSM 5692]
          Length = 273

 Score = 77.4 bits (189), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 59/221 (26%), Positives = 102/221 (46%), Gaps = 12/221 (5%)

Query: 24  ASILGDIKKRGFLKCGINTGLVGFAEV-KANGDWKGFDVDFCRALSSAIFDDPSKIQYLP 82
           A  L +IK+RG++  G+   +V F  V K   +  GFDVD C+ L+  +  D   ++  P
Sbjct: 24  ADKLEEIKERGYMVAGVKDAVVPFGYVDKDTNNIVGFDVDICKELADKLGVD---LRLKP 80

Query: 83  LNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYF-DGQGFIMHKKKGISSVS 141
           + +  R   L    +DIL+        RE S+  +    TYF  GQ  ++ K   ISS +
Sbjct: 81  VTSSTRIPMLAQGSVDILAATMTHKFSREDSIDFS---TTYFMTGQKLLVKKDSDISSTA 137

Query: 142 QLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISAL 201
            L+G  +    G+T+E  +    K    +   + FE   +   A R  +  A T D + L
Sbjct: 138 DLAGKKVGTAKGSTSEKNI----KEAQPESRVLSFEGYPQAFLALRQGKVKAVTTDATIL 193

Query: 202 YALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVS 242
             LK +   P ++ I+ + IS  P    + + ++ + + V+
Sbjct: 194 LGLKNSAPDPDKYAIVGEYISDEPYGLGVPENESNFRDFVN 234


>gi|300718266|ref|YP_003743069.1| polar amino acid ABC transporter, periplasmic ligand binding
           protein [Erwinia billingiae Eb661]
 gi|299064102|emb|CAX61222.1| polar amino acid ABC transporter, periplasmic ligand binding
           protein [Erwinia billingiae Eb661]
          Length = 271

 Score = 77.0 bits (188), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 67/238 (28%), Positives = 101/238 (42%), Gaps = 13/238 (5%)

Query: 8   SILCLIILFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRAL 67
           +++ L +L      T+A  L DIK RG L  GI      +  + A G   GF+VD  R++
Sbjct: 6   ALMALSLLIMAPVITHADTLSDIKSRGVLTVGIKNDYPPYGFMNAEGKTVGFEVDLARSI 65

Query: 68  SSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQ 127
           ++ +   P KI+ +P+NA  R   LQS QID++      T  R   +      ++   G 
Sbjct: 66  AANLLGSPDKIKLVPVNASNRIQFLQSGQIDLIMATLGVTPERAKEIDFTVEYVSA-AGP 124

Query: 128 GFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYR 187
             +  K+   +   QL G  IC   G+        Y K    KY  I       +  AYR
Sbjct: 125 SVMARKEAKFNQWEQLKGQKICGIQGSY-------YNKTLTQKYG-IQLVNFTALPEAYR 176

Query: 188 A---HRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVS 242
           A   +RC A   D   L   KL     S++ I        P+A  + +GD  + N V+
Sbjct: 177 ALQDNRCVAMVFDDMTLQN-KLGEPGWSDYKIAIKPYEFLPMAGGLRKGDEAFKNAVN 233


>gi|315452691|ref|YP_004072961.1| amino-acid(glutamine) ABC transporter, periplasmic
           glutamine-binding protein [Helicobacter felis ATCC
           49179]
 gi|315131743|emb|CBY82371.1| amino-acid(Glutamine) ABC transporter, periplasmic
           glutamine-binding protein [Helicobacter felis ATCC
           49179]
          Length = 276

 Score = 77.0 bits (188), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 59/222 (26%), Positives = 103/222 (46%), Gaps = 12/222 (5%)

Query: 21  STNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQY 80
            +  S L  IK+RG LK G+ +    F  + + G+++GFDV   + ++  +  D  KI++
Sbjct: 28  QSKESGLASIKQRGVLKVGVFSDKPPFGYMDSKGEYQGFDVYIAKRMAKDLLGDEKKIEF 87

Query: 81  LPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSV 140
           +P+ A  R   L+S ++DI+  N   T  RE  +  A +P  Y      +  K   + S+
Sbjct: 88  IPVEAAARVEFLKSNKVDIIMANFTKTKEREAVVDFA-KP--YMKVALGVASKNGEVKSI 144

Query: 141 SQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISA 200
             L    + V  GTT +     YF  +      + +++  E   A + +R  A   D + 
Sbjct: 145 EDLKDKPLIVNKGTTADF----YFSKNYPNISLLKYDQNTETFLALKDNRGPALAHDNTL 200

Query: 201 LYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDT---EWYN 239
           L+A    N  P   V +P +  +  +APA+ +G+    EW N
Sbjct: 201 LFAWVKKN--PEFKVGIPSLGDQDVIAPAVKKGNKALLEWLN 240


>gi|262278742|ref|ZP_06056527.1| ArtI protein [Acinetobacter calcoaceticus RUH2202]
 gi|262259093|gb|EEY77826.1| ArtI protein [Acinetobacter calcoaceticus RUH2202]
          Length = 286

 Score = 77.0 bits (188), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 65/249 (26%), Positives = 117/249 (46%), Gaps = 11/249 (4%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAK 86
           L  +KK G L+  +      F  V + G+ +GFDV   + ++  +  D  K++++   A 
Sbjct: 41  LEQVKKNGVLRVAVFADDPPFGYVDSAGNNQGFDVALAKRVTKDLLGDEKKVEFIVTEAS 100

Query: 87  ERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQ-GFIMHKKKGISSVSQLSG 145
            R   L+S + D++      T  R+  +  A  P  Y  G  G +  K K I+ ++QL G
Sbjct: 101 NRVEFLKSNRADVVFATFTVTPERKEVVDFA-EP--YLKGAFGIVSPKAKPITDIAQLEG 157

Query: 146 ASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALK 205
            ++ V  GT+++     YF  H  K + + FER  +   A    R DA + D  + YAL 
Sbjct: 158 KTLIVNKGTSSDT----YFTKHYPKVNLLKFERNSDAFKALTDGRGDAISQD--STYALA 211

Query: 206 LTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEEL-GITQKNINQV 264
                PS    +  I  +  +APA+ +G+T+  N ++     + T+ E+  I  + +  +
Sbjct: 212 WAAKNPSYVAGIQSIGDQEFIAPAVKKGNTQLLNWLNTEIKQLRTSGEIKKIYDETLKPI 271

Query: 265 SKDTTNPDV 273
             ++ NP+V
Sbjct: 272 YGESVNPNV 280


>gi|13324646|gb|AAK18828.1|AF327739_5 Peb1 [Streptococcus thermophilus]
          Length = 277

 Score = 77.0 bits (188), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 54/205 (26%), Positives = 95/205 (46%), Gaps = 15/205 (7%)

Query: 7   VSILCLIILFFTSFSTNAS---------ILGDIKKRGFLKCGINTGLVGFAEVKANGD-W 56
           VS++   +   T+  T A           +  I  RG L  G+   +  F    A  + +
Sbjct: 13  VSLVIATVFLITNHKTEAEDTSKLLDSKTVQKIVNRGTLNVGVKQDVPNFGYYSAKTNRY 72

Query: 57  KGFDVDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGL 116
           +G +VD  + ++  +     K+ Y+P+  + R   + +  ID+L     +T+  E     
Sbjct: 73  EGMEVDLAKKIADEL---RVKVNYIPVTTQTREPLMDNGTIDLLIGT--YTINDERKASY 127

Query: 117 AFRPITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVF 176
           A     Y D  GF++ K  GI+ +S L+G +I V  G +T+  L +Y  AHN+K++ +  
Sbjct: 128 AISNPYYRDQIGFLVLKDSGINKISDLNGKTIGVAQGASTKAALQEYSSAHNLKFNYVQL 187

Query: 177 ERVEEIDAAYRAHRCDAYTGDISAL 201
               E+  +  AHR DA++ D S L
Sbjct: 188 GSYPELAVSLYAHRVDAFSVDKSIL 212


>gi|256847116|ref|ZP_05552562.1| ABC transporter solute-binding component [Lactobacillus
           coleohominis 101-4-CHN]
 gi|256715780|gb|EEU30755.1| ABC transporter solute-binding component [Lactobacillus
           coleohominis 101-4-CHN]
          Length = 284

 Score = 77.0 bits (188), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 66/225 (29%), Positives = 103/225 (45%), Gaps = 14/225 (6%)

Query: 21  STNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQY 80
           ++N S +  IKKRG LK  +   L  +  V  +G   G+DV   R ++    D   K+++
Sbjct: 35  ASNPSSVSAIKKRGVLKVAVFGDLPPYGWVNKDGKRVGYDVALARQMAK---DLGVKVKF 91

Query: 81  LPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSV 140
           + +NA  R   L S + DI+  N   T  R+  +  A +P       G +  KKK I+ V
Sbjct: 92  VQVNANNRVDTLNSNKADIVLANFTVTSERKQVVDFA-KPYMKV-SVGVVSPKKKAITKV 149

Query: 141 SQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISA 200
           SQL G  + V  GTT E    +YF +       + F+   +   A + +R  A   D S 
Sbjct: 150 SQLKGKKVIVTKGTTAE----NYFTSKQKGVSLLKFDSKTQQFNALKNNRGAALADDNSY 205

Query: 201 LYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTH 245
           LYA     + P   V +  I  K  +APA+ +G+    N   W++
Sbjct: 206 LYA--WVKNNPKYTVGIKSIGPKQYIAPAVKKGNKSLLN---WSN 245


>gi|78356474|ref|YP_387923.1| extracellular solute-binding protein [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
 gi|78218879|gb|ABB38228.1| amino acid ABC transporter substrate-binding protein, PAAT family
           [Desulfovibrio desulfuricans subsp. desulfuricans str.
           G20]
          Length = 271

 Score = 76.6 bits (187), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 59/230 (25%), Positives = 106/230 (46%), Gaps = 12/230 (5%)

Query: 15  LFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANG-DWKGFDVDFCRALSSAIFD 73
           + F++ + +A  + +IK RG L  G+   +V F  V  N     GFDVD CR ++  +  
Sbjct: 13  MIFSAATASAGKIEEIKDRGVLVAGVKDSVVPFGFVDENSKQLVGFDVDICRYIAGQL-- 70

Query: 74  DPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYF-DGQGFIMH 132
              +++   + +  R   +    +DI +        R+  +  +   ITYF DGQ  ++ 
Sbjct: 71  -GVELELKTVTSATRIPMVTQGSVDIAAATMTHKHERDNVIDFS---ITYFMDGQKILVA 126

Query: 133 KKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCD 192
           K  GI+SV+ L G  +    G+T+E  +    KA       + F+   +   A +  +  
Sbjct: 127 KDSGINSVADLKGKKVATVKGSTSEKNI----KAAQPDCRVLSFDEYPQAMLALKQGKAS 182

Query: 193 AYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVS 242
           A T D + L  LK ++  P + VI  D IS  P    + + D+++ + V+
Sbjct: 183 AVTTDSTILLGLKNSDPEPEKWVIAGDYISAEPYGLGLPENDSDFRDFVN 232


>gi|323697540|ref|ZP_08109452.1| extracellular solute-binding protein family 3 [Desulfovibrio sp.
           ND132]
 gi|323457472|gb|EGB13337.1| extracellular solute-binding protein family 3 [Desulfovibrio
           desulfuricans ND132]
          Length = 268

 Score = 76.6 bits (187), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 58/218 (26%), Positives = 98/218 (44%), Gaps = 12/218 (5%)

Query: 27  LGDIKKRGFLKCGINTGLVGFAEVKAN-GDWKGFDVDFCRALSSAIFDDPSKIQYLPLNA 85
           L D+K +G L CG+   +  F  V  N  +  GFDVD C+ ++  I     K ++  + +
Sbjct: 26  LEDVKAKGVLVCGVKDSVNLFGFVDPNTKELVGFDVDICKYIADKI---GVKTEFKVVTS 82

Query: 86  KERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYF-DGQGFIMHKKKGISSVSQLS 144
           K R   L    +D+L+        R+  +  +   ITYF DGQ  ++ K  GI+S + L+
Sbjct: 83  KNRIPMLAQGSVDMLAATMTHKFSRDEQIDFS---ITYFMDGQKLLVEKGSGITSTADLA 139

Query: 145 GASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYAL 204
              +    G+T+E  +    KA       I ++   +   A +  +  A T D   L  L
Sbjct: 140 NKKVGTVKGSTSEKNI----KAAQPAAQVISYDEYPQAFMALKQGKVKAVTTDSGILAGL 195

Query: 205 KLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVS 242
           K  +D P +  I+    S  P    + Q D+E+ + V+
Sbjct: 196 KAGDDNPEKWEIVGAFFSSEPYGLGVPQNDSEFRDFVN 233


>gi|118465451|ref|YP_883877.1| extracellular solute-binding protein, family protein 3
           [Mycobacterium avium 104]
 gi|118166738|gb|ABK67635.1| Bacterial extracellular solute-binding protein, family protein 3
           [Mycobacterium avium 104]
          Length = 334

 Score = 76.6 bits (187), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 62/221 (28%), Positives = 99/221 (44%), Gaps = 20/221 (9%)

Query: 11  CLIILFFTSFSTNA---SILGDIKKRGFLKCGINTG--LVGFAEVKANGDWKGFDVDFCR 65
           C +      F T A   + + DI+ RG L  G++ G  L  F +    G+  GFDVD   
Sbjct: 72  CDLTASLRPFPTKAEADAAVADIRARGRLIVGLDIGSNLFSFRD-PITGEITGFDVDIAG 130

Query: 66  ALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFD 125
            ++  IF  PS ++Y  L++ ER  ALQ  ++D++ +    T  R   +  +     Y D
Sbjct: 131 EIARDIFGAPSHVEYRILSSDERVTALQRGEVDVVVKTMTITCDRRKQVNFS---TVYLD 187

Query: 126 G-QGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDA 184
             Q  +  +   I+ VS LSG  +CV  GTT+        +   +   PIV   V   D 
Sbjct: 188 ANQRILAPRDSPITKVSDLSGKRVCVAKGTTS------LHRIRQIDPPPIVVSVVNWADC 241

Query: 185 --AYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISK 223
             A +    DA + D S L    L  + P  H++ P++ ++
Sbjct: 242 LVAMQQREIDAVSTDDSILAG--LVEEDPYLHIVGPNMATQ 280


>gi|312278469|gb|ADQ63126.1| ABC-type amino acid transport/signal transduction system,
           periplasmic component/domain [Streptococcus thermophilus
           ND03]
          Length = 277

 Score = 76.6 bits (187), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 51/185 (27%), Positives = 90/185 (48%), Gaps = 6/185 (3%)

Query: 18  TSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGD-WKGFDVDFCRALSSAIFDDPS 76
           TS   ++  +  I  RG L  G+   +  F    A  + ++G +VD  + ++  +     
Sbjct: 33  TSKLLDSKAVQKIVNRGTLNVGVKQDVPNFGYYSAKTNRYEGMEVDLAKKIADEL---KV 89

Query: 77  KIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKG 136
           K+ Y+P+  + R   + +  ID+L     +T+  E     A     Y D  GF++ K  G
Sbjct: 90  KVNYIPVTTQTREPLMDNGTIDLLIGT--YTINDERKASYAISNPYYHDQIGFLVLKDSG 147

Query: 137 ISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTG 196
           I+ +S L+G +I V  G +T+  L +Y  AHN+K++ +      E+  +  AHR DA++ 
Sbjct: 148 INKISDLNGKTIGVAQGASTKAALQEYASAHNLKFNYVQLGSYPELAVSLYAHRVDAFSV 207

Query: 197 DISAL 201
           D S L
Sbjct: 208 DKSIL 212


>gi|55821171|ref|YP_139613.1| polar amino acid ABC uptake transporter substrate binding protein
           [Streptococcus thermophilus LMG 18311]
 gi|55737156|gb|AAV60798.1| polar amino acid ABC uptake transporter substrate binding protein
           [Streptococcus thermophilus LMG 18311]
          Length = 277

 Score = 76.6 bits (187), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 57/205 (27%), Positives = 97/205 (47%), Gaps = 15/205 (7%)

Query: 7   VSILCLIILFFTSFSTNA---SILGDIK------KRGFLKCGINTGLVGFAEVKANGD-W 56
           VS++   +   T+  T A   S L D K       RG L  G+   +  F    A  + +
Sbjct: 13  VSLVIATVFLITNHKTEAEDTSKLLDSKAVQKIVNRGTLNVGVKQDVPNFGYYSAKTNRY 72

Query: 57  KGFDVDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGL 116
           +G +VD  + ++  +     K+ Y+P+  + R   + +  ID+L     +T+  E     
Sbjct: 73  EGMEVDLAKKIADEL---RVKVNYIPVTTQTREPLMDNGTIDLLIGT--YTINDERKASY 127

Query: 117 AFRPITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVF 176
           A     Y D  GF++ K  GI+ +S L+G +I V  G +T+  L +Y  AHN+K++ +  
Sbjct: 128 AISNPYYRDQIGFLVLKDSGINKISDLNGKTIGVAQGASTKAALQEYSSAHNLKFNYVQL 187

Query: 177 ERVEEIDAAYRAHRCDAYTGDISAL 201
               E+  +  AHR DA++ D S L
Sbjct: 188 GSYPELAVSLYAHRVDAFSVDKSIL 212


>gi|55823084|ref|YP_141525.1| amino acid (glutamine) ABC transporter substrate-binding protein
           [Streptococcus thermophilus CNRZ1066]
 gi|55739069|gb|AAV62710.1| amino acid (glutamine) ABC transporter substrate-binding protein
           [Streptococcus thermophilus CNRZ1066]
          Length = 277

 Score = 76.6 bits (187), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 57/205 (27%), Positives = 97/205 (47%), Gaps = 15/205 (7%)

Query: 7   VSILCLIILFFTSFSTNA---SILGDIK------KRGFLKCGINTGLVGFAEVKANGD-W 56
           VS++   +   T+  T A   S L D K       RG L  G+   +  F    A  + +
Sbjct: 13  VSLVIATVFLITNHKTEAEDTSKLLDSKAVQKIVNRGTLNVGVKQDVPNFGYYSAKTNRY 72

Query: 57  KGFDVDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGL 116
           +G +VD  + ++  +     K+ Y+P+  + R   + +  ID+L     +T+  E     
Sbjct: 73  EGMEVDLAKKIADEL---RVKVNYIPVTTQTREPLMDNGTIDLLIGT--YTINDERKASY 127

Query: 117 AFRPITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVF 176
           A     Y D  GF++ K  GI+ +S L+G +I V  G +T+  L +Y  AHN+K++ +  
Sbjct: 128 AISNPYYRDQIGFLVLKDSGINKISDLNGKTIGVAQGASTKAALQEYASAHNLKFNYVQL 187

Query: 177 ERVEEIDAAYRAHRCDAYTGDISAL 201
               E+  +  AHR DA++ D S L
Sbjct: 188 GSYPELAVSLYAHRVDAFSVDKSIL 212


>gi|41409992|ref|NP_962828.1| GlnH [Mycobacterium avium subsp. paratuberculosis K-10]
 gi|41398825|gb|AAS06444.1| GlnH [Mycobacterium avium subsp. paratuberculosis K-10]
          Length = 309

 Score = 76.6 bits (187), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 62/221 (28%), Positives = 99/221 (44%), Gaps = 20/221 (9%)

Query: 11  CLIILFFTSFSTNA---SILGDIKKRGFLKCGINTG--LVGFAEVKANGDWKGFDVDFCR 65
           C +      F T A   + + DI+ RG L  G++ G  L  F +    G+  GFDVD   
Sbjct: 47  CDLTASLRPFPTKAEADAAVADIRARGRLIVGLDIGSNLFSFRD-PITGEITGFDVDIAG 105

Query: 66  ALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFD 125
            ++  IF  PS ++Y  L++ ER  ALQ  ++D++ +    T  R   +  +     Y D
Sbjct: 106 EIARDIFGAPSHVEYRILSSDERVTALQRGEVDVVVKTMTITCDRRKQVNFS---TVYLD 162

Query: 126 G-QGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDA 184
             Q  +  +   I+ VS LSG  +CV  GTT+        +   +   PIV   V   D 
Sbjct: 163 ANQRILAPRDSPITKVSDLSGKRVCVAKGTTS------LHRIRQIDPPPIVVSVVNWADC 216

Query: 185 --AYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISK 223
             A +    DA + D S L    L  + P  H++ P++ ++
Sbjct: 217 LVAMQQREIDAVSTDDSILAG--LVEEDPYLHIVGPNMATQ 255


>gi|254777189|ref|ZP_05218705.1| extracellular solute-binding protein, family protein 3
           [Mycobacterium avium subsp. avium ATCC 25291]
          Length = 326

 Score = 76.6 bits (187), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 62/221 (28%), Positives = 99/221 (44%), Gaps = 20/221 (9%)

Query: 11  CLIILFFTSFSTNA---SILGDIKKRGFLKCGINTG--LVGFAEVKANGDWKGFDVDFCR 65
           C +      F T A   + + DI+ RG L  G++ G  L  F +    G+  GFDVD   
Sbjct: 64  CDLTASLRPFPTKAEADAAVADIRARGRLIVGLDIGSNLFSFRD-PITGEITGFDVDIAG 122

Query: 66  ALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFD 125
            ++  IF  PS ++Y  L++ ER  ALQ  ++D++ +    T  R   +  +     Y D
Sbjct: 123 EIARDIFGAPSHVEYRILSSDERVTALQRGEVDVVVKTMTITCDRRKQVNFS---TVYLD 179

Query: 126 G-QGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDA 184
             Q  +  +   I+ VS LSG  +CV  GTT+        +   +   PIV   V   D 
Sbjct: 180 ANQRILAPRDSPITKVSDLSGKRVCVAKGTTS------LHRIRQIDPPPIVVSVVNWADC 233

Query: 185 --AYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISK 223
             A +    DA + D S L    L  + P  H++ P++ ++
Sbjct: 234 LVAMQQREIDAVSTDDSILAG--LVEEDPYLHIVGPNMATQ 272


>gi|116627888|ref|YP_820507.1| amino acid ABC transporter periplasmic protein [Streptococcus
           thermophilus LMD-9]
 gi|116101165|gb|ABJ66311.1| ABC-type amino acid transport/signal transduction system,
           periplasmic component/domain [Streptococcus thermophilus
           LMD-9]
          Length = 277

 Score = 76.6 bits (187), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 51/185 (27%), Positives = 90/185 (48%), Gaps = 6/185 (3%)

Query: 18  TSFSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGD-WKGFDVDFCRALSSAIFDDPS 76
           TS   ++  +  I  RG L  G+   +  F    A  + ++G +VD  + ++  +     
Sbjct: 33  TSKLLDSKAVQKIVNRGTLNVGVKQDVPNFGYYSAKTNRYEGMEVDLAKKIADEL---KV 89

Query: 77  KIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKG 136
           K+ Y+P+  + R   + +  ID+L     +T+  E     A     Y D  GF++ K  G
Sbjct: 90  KVNYIPVTTQTREPLMDNGTIDLLIGT--YTINDERKASYAISNPYYHDQIGFLVLKDSG 147

Query: 137 ISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTG 196
           I+ +S L+G +I V  G +T+  L +Y  AHN+K++ +      E+  +  AHR DA++ 
Sbjct: 148 INKISDLNGKTIGVAQGASTKAALQEYASAHNLKFNYVQLGSYPELAVSLYAHRVDAFSV 207

Query: 197 DISAL 201
           D S L
Sbjct: 208 DKSIL 212


>gi|57242093|ref|ZP_00370033.1| amino acid ABC transporter, amino acid-binding protein
           [Campylobacter upsaliensis RM3195]
 gi|57017285|gb|EAL54066.1| amino acid ABC transporter, amino acid-binding protein
           [Campylobacter upsaliensis RM3195]
          Length = 257

 Score = 76.6 bits (187), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 62/200 (31%), Positives = 94/200 (47%), Gaps = 8/200 (4%)

Query: 21  STNASILGDIKKRGFLKCGINTGLVGFAEV-KANGDWKGFDVDFCRALSSAIFDDPSKIQ 79
           S NA  L DIK +G L  G+   +  +A + +  G+ KGF+VD  + L+  I  D +KI+
Sbjct: 23  SANAGKLEDIKAKGTLVVGVKNDVPHYALLDQKTGEIKGFEVDVAKKLAKEILGDENKIK 82

Query: 80  YLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISS 139
            + +NAK R   L +  +D++     +T+  E      F    Y D  G ++ K+KG  S
Sbjct: 83  LVAVNAKTRGPLLDNGTLDVVIAT--FTITPERKKIYNFSQPYYQDAIGLLVLKEKGYKS 140

Query: 140 VSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDIS 199
           ++ + GA I V    TT+  + +  K   +      F     I AA  A R D ++ D S
Sbjct: 141 LADMKGAKIGVAQAATTKRVIGEAAKKAGVSVSFSEFPDYPSIKAALDAKRVDVFSVDKS 200

Query: 200 ALYALKLTNDRPSEHVILPD 219
            L       D  SE  ILPD
Sbjct: 201 ILLGY---VDEKSE--ILPD 215


>gi|315638192|ref|ZP_07893374.1| amino acid ABC superfamily ATP binding cassette transporter,
           binding protein [Campylobacter upsaliensis JV21]
 gi|315481728|gb|EFU72350.1| amino acid ABC superfamily ATP binding cassette transporter,
           binding protein [Campylobacter upsaliensis JV21]
          Length = 262

 Score = 76.6 bits (187), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 62/200 (31%), Positives = 94/200 (47%), Gaps = 8/200 (4%)

Query: 21  STNASILGDIKKRGFLKCGINTGLVGFAEV-KANGDWKGFDVDFCRALSSAIFDDPSKIQ 79
           S NA  L DIK +G L  G+   +  +A + +  G+ KGF+VD  + L+  I  D +KI+
Sbjct: 28  SANAGKLEDIKAKGTLVVGVKNDVPHYALLDQKTGEIKGFEVDVAKKLAKEILGDENKIK 87

Query: 80  YLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISS 139
            + +NAK R   L +  +D++     +T+  E      F    Y D  G ++ K+KG  S
Sbjct: 88  LVAVNAKTRGPLLDNGTLDVVIAT--FTITPERKKIYNFSQPYYQDAIGLLVLKEKGYKS 145

Query: 140 VSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDIS 199
           ++ + GA I V    TT+  + +  K   +      F     I AA  A R D ++ D S
Sbjct: 146 LADMKGAKIGVAQAATTKRVIGEAAKKAGVSVSFSEFPDYPSIKAALDAKRVDVFSVDKS 205

Query: 200 ALYALKLTNDRPSEHVILPD 219
            L       D  SE  ILPD
Sbjct: 206 ILLGY---VDEKSE--ILPD 220


>gi|288905749|ref|YP_003430971.1| ABC transporter, amino acid binding protein [Streptococcus
           gallolyticus UCN34]
 gi|306831847|ref|ZP_07465003.1| amino acid ABC superfamily ATP binding cassette transporter,
           binding protein [Streptococcus gallolyticus subsp.
           gallolyticus TX20005]
 gi|288732475|emb|CBI14047.1| Putative ABC transporter, amino acid binding protein [Streptococcus
           gallolyticus UCN34]
 gi|304426045|gb|EFM29161.1| amino acid ABC superfamily ATP binding cassette transporter,
           binding protein [Streptococcus gallolyticus subsp.
           gallolyticus TX20005]
          Length = 272

 Score = 76.3 bits (186), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 87/173 (50%), Gaps = 6/173 (3%)

Query: 30  IKKRGFLKCGINTGLVGFAEVKAN-GDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKER 88
           I+  G LK G+   +  F    A  G ++G +VD  + ++  +     K+ +  + A+ R
Sbjct: 40  IQDAGVLKVGVKQDVPNFGYYSAETGKYEGMEVDLAKKIAKKL---GVKVSFTAVTAQTR 96

Query: 89  FLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASI 148
              L + QIDIL     +T+  E     A     Y+D  GF+++K KG  S++ L G +I
Sbjct: 97  EALLDNGQIDILIAT--YTITEERQASYAISDPYYYDEIGFLVNKSKGYDSIADLDGLTI 154

Query: 149 CVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISAL 201
            V  G+TT+  + +Y +AHN+ ++ +      E+  +  A+R  A++ D S L
Sbjct: 155 GVAQGSTTKSAIEEYGEAHNLSFNFVQLGSYPELAISLYANRISAFSVDKSIL 207


>gi|118618243|ref|YP_906575.1| glutamine-binding lipoprotein GlnH [Mycobacterium ulcerans Agy99]
 gi|183980737|ref|YP_001849028.1| glutamine-binding lipoprotein GlnH [Mycobacterium marinum M]
 gi|118570353|gb|ABL05104.1| glutamine-binding lipoprotein GlnH [Mycobacterium ulcerans Agy99]
 gi|183174063|gb|ACC39173.1| glutamine-binding lipoprotein GlnH [Mycobacterium marinum M]
          Length = 328

 Score = 76.3 bits (186), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 60/213 (28%), Positives = 98/213 (46%), Gaps = 18/213 (8%)

Query: 16  FFTSFSTNASILGDIKKRGFLKCGINTG--LVGFAEVKANGDWKGFDVDFCRALSSAIFD 73
           F T    +A++  DI+ RG L  G++ G  L  F +    G+  GFDVD    ++  IF 
Sbjct: 75  FPTKAEADAAV-ADIRARGRLIVGLDIGSNLFSFRD-PITGEITGFDVDIASEVARDIFG 132

Query: 74  DPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDG-QGFIMH 132
            P+ ++Y  L+A ER  ALQS Q+D++ +    T  R   +  +     Y D  Q  +  
Sbjct: 133 GPTHVEYRILSAAERITALQSSQVDVVVKTMTITCERRKLVNFS---TVYLDANQRILTS 189

Query: 133 KKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDA--AYRAHR 190
           +   I  VS LSG  +CV  GTT+        +   +   P++   V   D   A +   
Sbjct: 190 RDSPIFKVSDLSGKRVCVARGTTS------LRRIREIAPPPVIVSVVNWADCLVALQQRE 243

Query: 191 CDAYTGDISALYALKLTNDRPSEHVILPDIISK 223
            DA + D + L    L  + P  H++ P++ ++
Sbjct: 244 IDAVSTDDTILAG--LVEEDPYLHIVGPNMANQ 274


>gi|325978782|ref|YP_004288498.1| putative glutamine transport system substrate-binding protein
           [Streptococcus gallolyticus subsp. gallolyticus ATCC
           BAA-2069]
 gi|325178710|emb|CBZ48754.1| putative glutamine transport system substrate-binding protein
           [Streptococcus gallolyticus subsp. gallolyticus ATCC
           BAA-2069]
          Length = 270

 Score = 76.3 bits (186), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 87/173 (50%), Gaps = 6/173 (3%)

Query: 30  IKKRGFLKCGINTGLVGFAEVKAN-GDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKER 88
           I+  G LK G+   +  F    A  G ++G +VD  + ++  +     K+ +  + A+ R
Sbjct: 38  IQDAGVLKVGVKQDVPNFGYYSAETGKYEGMEVDLAKKIAKKL---GVKVSFTAVTAQTR 94

Query: 89  FLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASI 148
              L + QIDIL     +T+  E     A     Y+D  GF+++K KG  S++ L G +I
Sbjct: 95  EALLDNGQIDILIAT--YTITEERQASYAISDPYYYDEIGFLVNKSKGYDSIADLDGLTI 152

Query: 149 CVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISAL 201
            V  G+TT+  + +Y +AHN+ ++ +      E+  +  A+R  A++ D S L
Sbjct: 153 GVAQGSTTKSAIEEYGEAHNLSFNFVQLGSYPELAISLYANRISAFSVDKSIL 205


>gi|51891628|ref|YP_074319.1| amino acid ABC transporter substrate-binding protein
           [Symbiobacterium thermophilum IAM 14863]
 gi|51855317|dbj|BAD39475.1| amino acid ABC transporter substrate-binding protein
           [Symbiobacterium thermophilum IAM 14863]
          Length = 275

 Score = 76.3 bits (186), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 62/226 (27%), Positives = 99/226 (43%), Gaps = 8/226 (3%)

Query: 30  IKKRGFLKCGINTGLVGFAEVK-ANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKER 88
           I+  G L+ G+   +  F     A    +G ++D  R ++  IF D SK+Q+  +NAK R
Sbjct: 47  IRDAGVLRVGVKEDVPKFGYFDPAKNAHEGLEIDLARRIAKEIFGDESKVQFTGVNAKTR 106

Query: 89  FLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASI 148
             AL + +ID++     +T+  E      F    + D  GF++    GI S   L G  I
Sbjct: 107 GPALDNGEIDLVIAT--FTITEERKKSWNFSDPYFTDYVGFLVLADSGIQSWKDLDGKVI 164

Query: 149 CVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTN 208
            V    +T   L +  +   +K   + F    EI AA  + R DA++ D S L+  K   
Sbjct: 165 GVAQSASTRAALTEQAEKDGIKVEFMEFATYPEIKAALDSRRIDAFSVDQSILWGYK--- 221

Query: 209 DRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEEL 254
               ++V+LPD  +      A    +TE    V+     M  + EL
Sbjct: 222 --DDKNVMLPDKFAPQEYGIATKLSNTELAEFVNNILKGMKESGEL 265


>gi|57504979|ref|ZP_00370931.1| amino acid ABC transporter, amino acid-binding protein
           [Campylobacter coli RM2228]
 gi|57019251|gb|EAL55957.1| amino acid ABC transporter, amino acid-binding protein
           [Campylobacter coli RM2228]
          Length = 241

 Score = 76.3 bits (186), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 61/206 (29%), Positives = 98/206 (47%), Gaps = 8/206 (3%)

Query: 15  LFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEV-KANGDWKGFDVDFCRALSSAIFD 73
           + FTS +     L  IK +G L  G+   +  +A + +A G+ KGF+VD  + L+ +I  
Sbjct: 1   MAFTSANAAEGKLEAIKAKGELVIGVKNDVPHYALLDQATGEIKGFEVDVAKMLAKSILG 60

Query: 74  DPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHK 133
           D +K++ + +NAK R   L +  +D +     +T+  E      F