PSIBLAST alignment of GI: 254780170 and protein with PDB id: 2ia4

>gi|159794821|pdb|2IA4|A Chain A, Crystal Structure Of Novel Amino Acid Binding Protein From Shigella Flexneri Length = 279
 Score =  154 bits (389), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 43/240 (17%), Positives = 85/240 (35%), Gaps = 6/240 (2%)

Query: 20  FSTNASILGDIKKRGFLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDD----P 75
                S L  I K G +  G     V F+         G+  D+  A+  A+        
Sbjct: 1   APAAGSTLDKIAKNGVIVVGHRESSVPFSYYDNQQKVVGYSQDYSNAIVEAVKKKLNKPD 60

Query: 76  SKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKK 135
            +++ +P+ ++ R   LQ+   D    +T   + R+      F    +  G   +  K  
Sbjct: 61  LQVKLIPITSQNRIPLLQNGTFDFECGSTTNNVERQKQAA--FSDTIFVVGTRLLTKKGG 118

Query: 136 GISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYT 195
            I   + L G ++ V +GTT+E+ L    +        I  +   +      + R  A+ 
Sbjct: 119 DIKDFADLKGKAVVVTSGTTSEVLLNKLNEEQKXNXRIISAKDHGDSFRTLESGRAVAFX 178

Query: 196 GDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAMVTAEELG 255
            D + L   +    +P    I+    S+      + + D ++  +   T   + T+ E  
Sbjct: 179 XDDALLAGERAKAKKPDNWDIVGKPQSQEAYGCXLRKDDPQFKKLXDDTIAQVQTSGEAE 238