PSIBLAST alignment of GI: 254780170 and protein with PDB id: 3del

>gi|240104308|pdb|3DEL|B Chain B, The Structure Of Ct381, The Arginine Binding Protein From The Periplasm Chlamydia Trachomatis Length = 242
>gi|240104309|pdb|3DEL|C Chain C, The Structure Of Ct381, The Arginine Binding Protein From The Periplasm Chlamydia Trachomatis Length = 242
 Score = 87.8 bits (216), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 36/234 (15%), Positives = 67/234 (28%), Gaps = 15/234 (6%)

Query: 35  FLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERFLALQS 94
               G N     F  V   G+  GFD+D  R +S+ +       ++   +     L L+ 
Sbjct: 12  KFIVGTNATYPPFEFVDKRGEVVGFDIDLAREISNKLGKTLDVREF---SFDALILNLKQ 68

Query: 95  KQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASICVQAGT 154
            +ID +      T  R   + +             ++ K +    +      S+ VQ GT
Sbjct: 69  HRIDAVITGMSITPSRLKEILMI-PYYGEEIKHLVLVFKGENKHPLPLTQYRSVAVQTGT 127

Query: 155 TTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTNDR-PSE 213
             E  L         + H   F+   E+       +      + S    +        + 
Sbjct: 128 YQEAYLQSL-----SEVHIRSFDSTLEVLMEVMHGKSPVAVLEPSIAQVVLKDFPALSTA 182

Query: 214 HVILPDIISKSPLAPAIIQGDTEWYNIVSWTHYAM----VTAE-ELGITQKNIN 262
            + LP+          +          +      +    V AE E      N+ 
Sbjct: 183 TIDLPEDQWVLGYGIGVASDRPALALKIEAAVQEIRKEGVLAELEQKWGLNNLE 236