PSIBLAST alignment of GI: 254780170 and protein with PDB id: 3h7m

>gi|242556607|pdb|3H7M|A Chain A, Crystal Structure Of A Histidine Kinase Sensor Domain With Similarity To Periplasmic Binding Proteins Length = 234
 Score = 94.8 bits (234), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 32/205 (15%), Positives = 68/205 (33%), Gaps = 12/205 (5%)

Query: 35  FLKCGINTGLVGFAEVKANGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERFLALQS 94
            +  G +     +  +  NG   G++V+  RA++  +      +++      E F AL+S
Sbjct: 12  TIVVGGDRDYPPYEFIDQNGKPAGYNVELTRAIAEVMG---MTVEFRLGAWSEMFSALKS 68

Query: 95  KQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKK-GISSVSQLSGASICVQAG 153
            ++D+L      +   + +  + F P            +     + +  L G  + +   
Sbjct: 69  GRVDVLQG---ISWSEKRARQIDFTPPHTIVYHAIFARRDSPPAAGLEDLRGRKVALHRD 125

Query: 154 TTTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTNDRPSE 213
                 LA+           ++     +      A  CD Y           +  +R + 
Sbjct: 126 GIMHEYLAE----RGYGKDLVLTPTPADALRLLAAGGCD-YAVVAMVPGMYIIRENRLTN 180

Query: 214 HVILPDIISKSPLAPAIIQGDTEWY 238
            V +   I+      A+ QGD E  
Sbjct: 181 LVPVARSIAAQRYGYAVRQGDAELL 205