RPSBLAST alignment of GI: 254780170 and protein with PDBid: 2v25

>2v25_A Major cell-binding factor; antigen, adhesin, aspartate, glutamate, transport, ABC transport, virulence factor, receptor; 1.49A {Campylobacter jejuni} Length = 259
 Score = 75.6 bits (184), Expect = 2e-14
 Identities = 59/245 (24%), Positives = 103/245 (42%), Gaps = 11/245 (4%)

Query: 1   MYKDFFVSILCLII---LFFTSFSTNASILGDIKKRGFLKCGINTGLVGFAEV-KANGDW 56
           +++   + +    +   + F++ +     L  IK +G L  G+   +  +A + +A G+ 
Sbjct: 2   VFRKSLLKLAVFALGACVAFSNANAAEGKLESIKSKGQLIVGVKNDVPHYALLDQATGEI 61

Query: 57  KGFDVDFCRALSSAIFDDPSKIQYLPLNAKERFLALQSKQIDILSRNTDWTLLREISLGL 116
           KGF+VD  + L+ +I  D  KI+ + +NAK R   L +  +D +      T  R+     
Sbjct: 62  KGFEVDVAKLLAKSILGDDKKIKLVAVNAKTRGPLLDNGSVDAVIATFTITPERKRI--Y 119

Query: 117 AFRPITYFDGQGFIMHKKKGISSVSQLSGASICVQAGTTTELTLADYFKAHNMKYHPIVF 176
            F    Y D  G ++ K+K   S++ + GA+I V    TT+  + +  K   +      F
Sbjct: 120 NFSEPYYQDAIGLLVLKEKKYKSLADMKGANIGVAQAATTKKAIGEAAKKIGIDVKFSEF 179

Query: 177 ERVEEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEHVILPDIISKSPLAPAIIQGDTE 236
                I AA  A R DA++ D S L           +  ILPD            + D  
Sbjct: 180 PDYPSIKAALDAKRVDAFSVDKSILLGY-----VDDKSEILPDSFEPQSYGIVTKKDDPA 234

Query: 237 WYNIV 241
           +   V
Sbjct: 235 FAKYV 239