RPSBLAST alignment of GI: 254780170 and protein with PDBid: 3kzg

>3kzg_A Arginine 3RD transport system periplasmic binding protein; arginine transport system, protein structure initiative II(PSI II); 2.06A {Legionella pneumophila subsp} Length = 237
 Score = 73.8 bits (180), Expect = 5e-14
 Identities = 33/213 (15%), Positives = 65/213 (30%), Gaps = 16/213 (7%)

Query: 36  LKCGINTGLVGFAEVKA-NGDWKGFDVDFCRALSSAIFDDPSKIQYLPLNAKERFLALQS 94
           L  G +     F      N    GFD+D  + +   +        +      + F AL++
Sbjct: 5   LTIGTSKFNPPFEVWSGNNSSLYGFDIDLMQEICRRLHA---TCTFEAYIFDDLFPALKN 61

Query: 95  KQIDILSRNTDWTLLREISLGLAFRPITYFDGQGFIMHKKKGISSVSQLSGASICVQAGT 154
           +++D++  +   T  R+      F          +I      IS+   L G  I V+ GT
Sbjct: 62  REVDLVIASMIITDERKKH--FIFSLPYMESNSQYITTVDSKISTFDDLHGKKIGVRKGT 119

Query: 155 TTELTLADYFKAHNMKYHPIVFERVEEIDAAYRAHRCDAYTGDISALYALKLTNDRPSEH 214
                      + N     I +E ++++      ++ DA   D  A      +     + 
Sbjct: 120 PYA----RQVLSENRNNQVIFYELIQDMLLGLSNNQVDASLMDYEAAKYWMASEPYAYKL 175

Query: 215 V------ILPDIISKSPLAPAIIQGDTEWYNIV 241
           +      I   I      +             +
Sbjct: 176 IGKKYKLIGKKISIGEGYSIMANPDQFVLIKKI 208