HHsearch alignment for GI: 254780172 and conserved domain: CHL00187

>CHL00187 cysT sulfate transport protein; Provisional.
Probab=99.35  E-value=8.6e-11  Score=83.66  Aligned_cols=171  Identities=20%  Similarity=0.213  Sum_probs=110.6

Q ss_pred             HHHHHHHHHCCCCCCCCC-----CCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH-HHCCCCHHHHHHHHHHHHHHCCCC
Q ss_conf             998898851333357411-----11110024787799999999999875677544-412786889997898888761472
Q gi|254780172|r  151 LFPIFSFFVLYGGLGLSI-----VETSLWGGLLVTLVISFFGIIISMPLGILLAL-GRNSNIPVLRYACITFIELFRGVP  224 (386)
Q Consensus       151 ~~pil~~~Ll~gg~gl~~-----V~t~~~gGl~~Tl~l~~~~~~~~~~lG~llal-~r~s~~~~l~~~~~~~ie~~Rg~P  224 (386)
T Consensus        24 i~Pl~~l~~~s~~~~~~~~~~~~~~~~~~~~~~~Sl~~s~~~t~i~~~ig~~~A~~l~r~~~~g-k~~~~~l~~lP~~iP  102 (235)
T CHL00187         24 ILPILALLIKASQQPWSDFLQIATEPIALSAYSLTVSMALIAALINGIFGLLIAWVLVRYNFPG-KRFLDAAVDLPFALP  102 (235)
T ss_pred             HHHHHHHHHHHHCCCHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCC-HHHHHHHHHHHHHHH
T ss_conf             9999999999961789999999859999999999999999999999999999999999843761-899999999999978


Q ss_pred             HHHHHHHHHHHH------HHHCC-CCCC-CCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHH
Q ss_conf             289999999976------64155-8877-387999999999998999899999999845866789999962168999999
Q gi|254780172|r  225 LVTVLFMASIML------PLFLP-DTWD-VDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRL  296 (386)
Q Consensus       225 li~~lf~~~~~l------p~~lp-~g~~-~~~~~~a~i~l~l~~aAy~aEi~Rggl~svp~GQ~EAA~alGls~~q~~~~  296 (386)
T Consensus       103 ~~v~a~~~~~~f~~~G~~~~~l~~~~~~~~~~~~giii~~~~~~~P~~~~~~~~~l~~i~~~leEAA~~lGAs~~~~f~~  182 (235)
T CHL00187        103 TSVAGLTLATVYGDNGWIGHILSSLGIKIVFTKLGVLLAMIFVSLPFVVRTIQPVLQEIEKELEEAAWSLGASPWETFWK  182 (235)
T ss_pred             HHHHHHHHHHHHCCCCHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHH
T ss_conf             99999999999644661768999707651230999999999988799999899999860299999998739995041131


Q ss_pred             HHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9969989986200479999999612899999999999
Q gi|254780172|r  297 IIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLL  333 (386)
Q Consensus       297 IilPQAlr~~iP~l~n~~i~l~KdTsL~~~Ig~~el~  333 (386)
T Consensus       183 I~lPll~p~i~a~~-----------~l~f~~~~~eFg  208 (235)
T CHL00187        183 VIFPPLIPALLTGL-----------ALTFSRAIGEYG  208 (235)
T ss_pred             EEHHHHHHHHHHHH-----------HHHHHHHHHHHH
T ss_conf             21784689999999-----------999999999987