HHsearch alignment for GI: 254780172 and conserved domain: COG0601

>COG0601 DppB ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism].
Probab=99.10  E-value=3.8e-08  Score=67.77  Aligned_cols=220  Identities=16%  Similarity=0.204  Sum_probs=135.3

Q ss_pred             CCCCCCC-----CCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH-CCCCHHHHHHHHHHHHHHCCCCHHH----HH
Q ss_conf             3333574-----111111002478779999999999987567754441-2786889997898888761472289----99
Q gi|254780172|r  160 LYGGLGL-----SIVETSLWGGLLVTLVISFFGIIISMPLGILLALGR-NSNIPVLRYACITFIELFRGVPLVT----VL  229 (386)
Q Consensus       160 l~gg~gl-----~~V~t~~~gGl~~Tl~l~~~~~~~~~~lG~llal~r-~s~~~~l~~~~~~~ie~~Rg~Pli~----~l  229 (386)
T Consensus        73 ~~gdfG~S~~~~~pV~~~I~~~lp~Tl~L~~~a~iis~~lgi~LG~~aa~~~~~~~D~~~~~~~~~~~siP~F~~~~lli  152 (317)
T COG0601          73 LHGDFGTSFVYKRPVADLILERLPATLELALVALILAVLLGIPLGILAALKRGSWIDRLLRVLSLLGISIPSFWLGLLLI  152 (317)
T ss_pred             HCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             48688733567996899999884999999999999999999999999994489759999999999999602999999999


Q ss_pred             HHHHHHHHHHCC-CCCC-----------CCHHHHHHHHHHHHHHHHHHHHHHHHHH-HCCHHHHHHHHHHCCHHHHHHHH
Q ss_conf             999997664155-8877-----------3879999999999989998999999998-45866789999962168999999
Q gi|254780172|r  230 FMASIMLPLFLP-DTWD-----------VDKLLRALLGVSAFASAYIAEVLRGGLQ-SISKGQFEAANSLGLSYLQKMRL  296 (386)
Q Consensus       230 f~~~~~lp~~lp-~g~~-----------~~~~~~a~i~l~l~~aAy~aEi~Rggl~-svp~GQ~EAA~alGls~~q~~~~  296 (386)
T Consensus       153 ~~f~~~l~~~-P~~g~~~~~~~~~~~~~~~h~iLP~~~L~~~~~a~~~r~~R~~~~e~l~~dyV~~AraKGl~~~~i~~k  231 (317)
T COG0601         153 LLFSVKLGWL-PVGGRGSAGSWDSFLDALKHLILPALTLGLVSLAGIARLTRSSMLEVLNQDYVRTARAKGLSERRILFK  231 (317)
T ss_pred             HHHHHHHCCC-CCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEHHH
T ss_conf             9999996768-988878865156799999999999999999999999999999999998668999999879992510398


Q ss_pred             HHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHH-HHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99699899862004799999996128999999999999999974101003551369-99999999999999999999999
Q gi|254780172|r  297 IIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPT-TGLIFIGFVFWIFCFSISLYSVF  375 (386)
Q Consensus       297 IilPQAlr~~iP~l~n~~i~l~KdTsL~~~Ig~~el~~~~~~~~~~~~~~~~~~~~-e~y~~~a~iY~ii~~~ls~~~~~  375 (386)
T Consensus       232 H~lrNa~iP~vt~~~~~~~~ll~GavivE--~iF~~pGiG~l~~~Ai~-~~D~p~i~g~~~~~~~~~i~~nli~Dily~~  308 (317)
T COG0601         232 HALRNALLPVITVLGLQLGGLLGGAVVVE--TVFSWPGLGRLLVDAIL-NRDYPVVQGIVLVIALLVILGNLLVDILYAL  308 (317)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCHHHHH--HHCCCCCHHHHHHHHHH-CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             63376488899999999999984687873--54087784999999998-2484999999999999999999999999996


Q ss_pred             HHHHHCCC
Q ss_conf             99984337
Q gi|254780172|r  376 IEKTLHKG  383 (386)
Q Consensus       376 lE~rl~~~  383 (386)
T Consensus       309 lDPRir~~  316 (317)
T COG0601         309 LDPRIRLG  316 (317)
T ss_pred             CCCCCCCC
T ss_conf             49756688