HHsearch alignment for GI: 254780172 and conserved domain: PRK09500

>PRK09500 potC spermidine/putrescine ABC transporter membrane protein; Reviewed.
Probab=99.59  E-value=6.2e-13  Score=96.51  Aligned_cols=202  Identities=15%  Similarity=0.189  Sum_probs=137.4

Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH-CCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCCCCCCH
Q ss_conf             111002478779999999999987567754441-2786889997898888761472289999999976641558877387
Q gi|254780172|r  170 ETSLWGGLLVTLVISFFGIIISMPLGILLALGR-NSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDK  248 (386)
Q Consensus       170 ~t~~~gGl~~Tl~l~~~~~~~~~~lG~llal~r-~s~~~~l~~~~~~~ie~~Rg~Pli~~lf~~~~~lp~~lp~g~~~~~  248 (386)
T Consensus        53 ~~~~~~~~~nSl~ia~~~~~~~~~lg~~~A~~l~r~~~~~-~~~~~~l~~~p~~~P~~v~~i~l~~~~~~---~g~~-~~  127 (257)
T PRK09500         53 NDSLLQAAQHSLTMAVFSATFATLIGSLTAVALYRYRFRG-KKFVSGMLFVVMMSPDIVMAISLLVLFML---LGIQ-LG  127 (257)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCC-HHHHHHHHHHHHHHHHHHHHHHHHHHHHH---CCHH-HH
T ss_conf             9379999999999999999999999999999997526774-56999999999997999999999999997---3513-20


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999899989999999984586678999996216899999999699899862004799999996128999999
Q gi|254780172|r  249 LLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIIN  328 (386)
Q Consensus       249 ~~~a~i~l~l~~aAy~aEi~Rggl~svp~GQ~EAA~alGls~~q~~~~IilPQAlr~~iP~l~n~~i~l~KdTsL~~~Ig  328 (386)
T Consensus       128 ~~~lil~~~~~~lP~~~~~i~~~l~~i~~~l~EAA~~lGAs~~~~f~~VilPl~~P~i~~~~il~F~~s~~ef~~~~~l~  207 (257)
T PRK09500        128 FWSLLFAHITFCLPFVVVTVYSRLKGFDVRMLEAAKDLGASEVTILRKIILPLAMPAVAAGWLLSFTLSMDDVVVSSFVT  207 (257)
T ss_pred             HHHHHHHHHHHCCCHHHHHHHHHHHHCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             99999888885150279999999971796999999872999879636312984799999999999999999999999752


Q ss_pred             HHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999999741010035513699999999999999999999999999984
Q gi|254780172|r  329 MFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTL  380 (386)
Q Consensus       329 ~~el~~~~~~~~~~~~~~~~~~~~e~y~~~a~iY~ii~~~ls~~~~~lE~rl  380 (386)
T Consensus       208 g~~~~tlp~~i~~~~~-~~~-~~--~~~Ala~il~~i~~~~~~l~~~l~r~~  255 (257)
T PRK09500        208 GPSYEILPLKIYSMVK-VGV-SP--EVNALATILLVLSLVLVILSQLLARDK  255 (257)
T ss_pred             CCCCEEHHHHHHHHHH-CCC-CH--HHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             8996028999999987-378-75--999999999999999999999986654