HHsearch alignment for GI: 254780172 and conserved domain: PRK10160

>PRK10160 taurine transporter subunit; Provisional.
Probab=99.65  E-value=2.3e-13  Score=99.14  Aligned_cols=200  Identities=20%  Similarity=0.230  Sum_probs=138.7

Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCCCCCCH
Q ss_conf             11110024787799999999999875677544412786889997898888761472289999999976641558877387
Q gi|254780172|r  169 VETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDK  248 (386)
Q Consensus       169 V~t~~~gGl~~Tl~l~~~~~~~~~~lG~llal~r~s~~~~l~~~~~~~ie~~Rg~Pli~~lf~~~~~lp~~lp~g~~~~~  248 (386)
T Consensus        72 ~~g~l~~~~~~Tl~r~~~Gf~la~~~Gv~lGil~-g~~~~~~~~l~P~l~~l~~iP~ial~Pl~ilwf------G~g~~~  144 (275)
T PRK10160         72 MDATLWQHLAASLTRIVLALLAAVVIGIPVGIAM-GLSPTVRGILDPLIELYRPVPPLAYLPLMVIWF------GIGETS  144 (275)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHH------CCCCCC
T ss_conf             7754999999999999999999999999999999-987999999999999998588999999999853------578400


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999899989999999984586678999996216899999999699899862004799999996128999999
Q gi|254780172|r  249 LLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIIN  328 (386)
Q Consensus       249 ~~~a~i~l~l~~aAy~aEi~Rggl~svp~GQ~EAA~alGls~~q~~~~IilPQAlr~~iP~l~n~~i~l~KdTsL~~~Ig  328 (386)
T Consensus       145 ---~i~vv~l~~~fpi~~nt~~Gvr~vd~~l~e~ar~~gas~~q~~~~V~lP~alP~i~~GlRi~~~~a~~~~v~aE~l~  221 (275)
T PRK10160        145 ---KILLIYLAIFAPVAMSALAGVKSAQQVRIRAAQSLGASRAQVLWFVILPGALPEILTGLRIGLGVGWSTLVAAELIA  221 (275)
T ss_pred             ---HHEEEHHHHHHHHHHHHHHHHHHCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             ---61010287540899999999971899999999982999999999988887899999999999999999999999983


Q ss_pred             HHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             99999999997410100355136999999999999999999999999999843378
Q gi|254780172|r  329 MFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS  384 (386)
Q Consensus       329 ~~el~~~~~~~~~~~~~~~~~~~~e~y~~~a~iY~ii~~~ls~~~~~lE~rl~~~~  384 (386)
T Consensus       222 ~~~--GLG~~I~~a~~----~~~~~~~~a~ii~i~llg~~l~~~~~~lerrl~~W~  271 (275)
T PRK10160        222 ATR--GLGFMVQSAGE----FLATDVVLAGIAVIAIIAFLLELGLRALQRRLTPWH  271 (275)
T ss_pred             CCC--CHHHHHHHHHH----HCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             479--87899999998----637899999999999999999999999998918789