HHsearch alignment for GI: 254780172 and conserved domain: PRK10592

>PRK10592 putrescine transporter subunit: membrane component of ABC superfamily; Provisional.
Probab=99.58  E-value=5.3e-13  Score=96.91  Aligned_cols=208  Identities=18%  Similarity=0.219  Sum_probs=132.2

Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH--HCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHH-HHHCCCCCCC
Q ss_conf             11100247877999999999998756775444--12786889997898888761472289999999976-6415588773
Q gi|254780172|r  170 ETSLWGGLLVTLVISFFGIIISMPLGILLALG--RNSNIPVLRYACITFIELFRGVPLVTVLFMASIML-PLFLPDTWDV  246 (386)
Q Consensus       170 ~t~~~gGl~~Tl~l~~~~~~~~~~lG~llal~--r~s~~~~l~~~~~~~ie~~Rg~Pli~~lf~~~~~l-p~~lp~g~~~  246 (386)
T Consensus        58 ~~~~~~a~~~Sl~ia~~~t~i~~~lG~~~A~~l~r~~~~~g~~~~~~-l~~~Pl~vP~iv~gl~l~~~f~~~g~~~g~~~  136 (281)
T PRK10592         58 DDAMMSAVGLSLTIAACAATMAAILGTIAAVVMVRFGRFRGSNGFAF-MITAPLVMPDVITGLSLLLLFVALGHAIGWPA  136 (281)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCH
T ss_conf             97899999999999999999999999999999998055330699999-99989986789999999999998463225320


Q ss_pred             -CHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHH
Q ss_conf             -8799999999999899989999999984586678999996216899999999699899862004799999996128999
Q gi|254780172|r  247 -DKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLIS  325 (386)
Q Consensus       247 -~~~~~a~i~l~l~~aAy~aEi~Rggl~svp~GQ~EAA~alGls~~q~~~~IilPQAlr~~iP~l~n~~i~l~KdTsL~~  325 (386)
T Consensus       137 ~~~~~~i~i~~~~~~~P~~~~~i~a~l~~id~~leEAA~~LGAs~~~~f~~V~LPli~Pgiiag~il~F~~s~~ef~~~~  216 (281)
T PRK10592        137 DRGMLTIWLAHVTFCTAYVAVVISSRLRELDRSIEEAAMDLGATPLKVFFVITLPMIMPAIISGWLLAFTLSLDDLVIAS  216 (281)
T ss_pred             HCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHCCCCHHHHHHEEEEHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             02378999999999999999999999985892799999881999888834354171159899999999999998777886


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             999999999999974101003551369999999999999999999999999998433
Q gi|254780172|r  326 IINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHK  382 (386)
Q Consensus       326 ~Ig~~el~~~~~~~~~~~~~~~~~~~~e~y~~~a~iY~ii~~~ls~~~~~lE~rl~~  382 (386)
T Consensus       217 ~l~g~~~~TLpv~iy~~~~--~~~~p-~-~~A~~~l~~~v~~~~~~ia~~l~~R~~k  269 (281)
T PRK10592        217 FVSGPGATTLPMLVFSSVR--MGVNP-E-INALATLILGVVGIVGFIAWYLMARAEK  269 (281)
T ss_pred             HEECCCCCCHHHHHHHHHH--CCCCH-H-HHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             2108998456999999987--17987-9-9999999999999999999999988898