HHsearch alignment for GI: 254780172 and conserved domain: PRK10971

>PRK10971 sulfate/thiosulfate transporter subunit; Provisional.
Probab=99.69  E-value=2.4e-14  Score=105.01  Aligned_cols=226  Identities=14%  Similarity=0.194  Sum_probs=142.8

Q ss_pred             HHHHHHHHHCCCCCCCCC-----CCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH-CCCCHHHHHHHHHHHHHHCCCC
Q ss_conf             998898851333357411-----1111002478779999999999987567754441-2786889997898888761472
Q gi|254780172|r  151 LFPIFSFFVLYGGLGLSI-----VETSLWGGLLVTLVISFFGIIISMPLGILLALGR-NSNIPVLRYACITFIELFRGVP  224 (386)
Q Consensus       151 ~~pil~~~Ll~gg~gl~~-----V~t~~~gGl~~Tl~l~~~~~~~~~~lG~llal~r-~s~~~~l~~~~~~~ie~~Rg~P  224 (386)
T Consensus        29 l~Pl~~l~~~~~~~~l~ny~~~f~dp~~~~al~nTl~ia~~~t~i~~vlG~~~A~~l~r~~f~-gr~~l~~l~~lP~~iP  107 (277)
T PRK10971         29 LLPLSALVMQLSQMSWAQYWEVITNPQVVAAYKVTLLSAFVASIFNGVFGLLMAWILTRYRFP-GRTLLDALMDLPFALP  107 (277)
T ss_pred             HHHHHHHHHHHCCCCHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC-CHHHHHHHHHHHHHHH
T ss_conf             999999999981699999999987988999999999999999999999999999999915887-3899999999999989


Q ss_pred             HHHHHHHHHHHH------HHHC-CCCCCC-CHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHH
Q ss_conf             289999999976------6415-588773-87999999999998999899999999845866789999962168999999
Q gi|254780172|r  225 LVTVLFMASIML------PLFL-PDTWDV-DKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRL  296 (386)
Q Consensus       225 li~~lf~~~~~l------p~~l-p~g~~~-~~~~~a~i~l~l~~aAy~aEi~Rggl~svp~GQ~EAA~alGls~~q~~~~  296 (386)
T Consensus       108 ~~V~g~~~~~lf~~~G~~~~~l~~~gi~~~~~~~giii~~~~~~~Pf~~~~~~a~l~~id~~leEAA~~lGAs~~~~f~~  187 (277)
T PRK10971        108 TAVAGLTLASLFSVNGWYGEWLAKFDIKVTYTWLGIAVAMAFTSIPFVVRTVQPVLEELGPEYEEAAETLGATRWQSFRK  187 (277)
T ss_pred             HHHHHHHHHHHCCCCCHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHCCCCHHHHHHH
T ss_conf             99999999998466542667899759641012999999999999899999878999848999999998649986573041


Q ss_pred             HHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHH-----HHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             996998998620047999999961289999999-----999999999741010035513699999999999999999999
Q gi|254780172|r  297 IIMPQVIKRVIPGIVNTFIGLFKDSSLISIINM-----FDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISL  371 (386)
Q Consensus       297 IilPQAlr~~iP~l~n~~i~l~KdTsL~~~Ig~-----~el~~~~~~~~~~~~~~~~~~~~e~y~~~a~iY~ii~~~ls~  371 (386)
T Consensus       188 V~lPll~P~i~~g~ll~F~~s~~~f~~~~~l~G~~~~~t~tl~~--~iy~~~~-~~d~---~~a~Als~ill~~sli~~~  261 (277)
T PRK10971        188 VVLPELSPALLAGVALSFTRSLGEFGAVIFIAGNIAWKTEVTSL--MIFVRLQ-EFDY---PAASAIASVILAASLLLLF  261 (277)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHH--HHHHHHH-CCCH---HHHHHHHHHHHHHHHHHHH
T ss_conf             03985799999999999999998760675001799886514999--9999998-7688---9999999999999999999


Q ss_pred             HHHHHHHHHCCC
Q ss_conf             999999984337
Q gi|254780172|r  372 YSVFIEKTLHKG  383 (386)
Q Consensus       372 ~~~~lE~rl~~~  383 (386)
T Consensus       262 ~~~~l~~R~~Rr  273 (277)
T PRK10971        262 SINTLQSRFGRR  273 (277)
T ss_pred             HHHHHHHHHHHH
T ss_conf             999999999875