HHsearch alignment for GI: 254780172 and conserved domain: PRK10973

>PRK10973 glycerol-3-phosphate transporter membrane protein; Provisional.
Probab=98.71  E-value=6.9e-06  Score=54.21  Aligned_cols=144  Identities=18%  Similarity=0.161  Sum_probs=91.1

Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH-CCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCCCCCCHH
Q ss_conf             11002478779999999999987567754441-27868899978988887614722899999999766415588773879
Q gi|254780172|r  171 TSLWGGLLVTLVISFFGIIISMPLGILLALGR-NSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKL  249 (386)
Q Consensus       171 t~~~gGl~~Tl~l~~~~~~~~~~lG~llal~r-~s~~~~l~~~~~~~ie~~Rg~Pli~~lf~~~~~lp~~lp~g~~~~~~  249 (386)
T Consensus        71 ~~f~~~~~NSliva~~~~~~~~~~~~~aaYalsr~~f~~-~~~~~~~~l~~~~iP~~~~~iP~~~~~~~l---gl-~~t~  145 (281)
T PRK10973         71 APFGRMLLNSFVMAFSITVGKITVSMLSAFAIVWFRFPL-RNLFFWMIFITLMLPVEVRIFPTVEVIANL---KM-LDSY  145 (281)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---CC-CCCH
T ss_conf             159999999999999999999999999999999840541-999999999999989999999999999993---97-1108


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHH
Q ss_conf             999999999989998999999998458667899999621689999999969989986200479999999612
Q gi|254780172|r  250 LRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDS  321 (386)
Q Consensus       250 ~~a~i~l~l~~aAy~aEi~Rggl~svp~GQ~EAA~alGls~~q~~~~IilPQAlr~~iP~l~n~~i~l~KdT  321 (386)
T Consensus       146 ~gli--l~~~~~~~~i~l~~~f~~~IP~el~EAA~iDGas~~~~f~~IilPl~kP~i~tv~i~~fi~~WNef  215 (281)
T PRK10973        146 AGLT--LPLMASATATFLFRQFFMTLPDELVEAARIDGAGPMRFFWDIVLPLSKTNLAALFVITFIYGWNQY  215 (281)
T ss_pred             HHHH--HHHHHHHHHHHHHHHHHHHCCHHHHHHHHHCCCCHHHHHHHHEECCCHHHHHHHHHHHHHHHHHHH
T ss_conf             9999--999999999999999997688889999998198677781541002659999999999999999979