HHsearch alignment for GI: 254780172 and conserved domain: PRK11122

>PRK11122 artM arginine transporter permease subunit ArtM; Provisional.
Probab=100.00  E-value=0  Score=408.50  Aligned_cols=208  Identities=22%  Similarity=0.415  Sum_probs=195.0

Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHH-----CCC--CC
Q ss_conf             10024787799999999999875677544412786889997898888761472289999999976641-----558--87
Q gi|254780172|r  172 SLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLF-----LPD--TW  244 (386)
Q Consensus       172 ~~~gGl~~Tl~l~~~~~~~~~~lG~llal~r~s~~~~l~~~~~~~ie~~Rg~Pli~~lf~~~~~lp~~-----lp~--g~  244 (386)
T Consensus         7 ~ll~G~~~Tl~l~~~s~~~~~~lG~~la~~r~~~~~~l~~~~~~yv~~~Rg~PlLv~lf~~yfg~~~~~~l~~~~~~~~~   86 (222)
T PRK11122          7 ELLKGLHTSLTLTVASLLVALVLALIFTIILTLKTPVLVWLVRGYITLFTGTPLLVQIFLIYYGPGQFPWLQEYPWLWHL   86 (222)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHCCCHHHHH
T ss_conf             99999999999999999999999999999998797789999999999995646999999999814888777503035320


Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHH
Q ss_conf             73879999999999989998999999998458667899999621689999999969989986200479999999612899
Q gi|254780172|r  245 DVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLI  324 (386)
Q Consensus       245 ~~~~~~~a~i~l~l~~aAy~aEi~Rggl~svp~GQ~EAA~alGls~~q~~~~IilPQAlr~~iP~l~n~~i~l~KdTsL~  324 (386)
T Consensus        87 ~~~~~~~~viaL~l~~~Ay~aEi~R~gi~sV~~GQ~EAA~slGls~~q~~r-IilPQa~r~~lP~l~n~~i~liK~TsL~  165 (222)
T PRK11122         87 LSQPWLCAMLALALNSAAYSTQLFYGAIRAIPEGQWQSCSALGMSKKQTLA-ILLPYAFKRALSSYSNEVVLVFKGTSLA  165 (222)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCCHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             225999999999999999999999999960998799999986989999999-8999999998668899999999984999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             99999999999999741010035513699999999999999999999999999984337899
Q gi|254780172|r  325 SIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK  386 (386)
Q Consensus       325 ~~Ig~~el~~~~~~~~~~~~~~~~~~~~e~y~~~a~iY~ii~~~ls~~~~~lE~rl~~~~rR  386 (386)
T Consensus       166 s~Igv~El~~~a~~i~~~t-----~~-~~~y~~~a~~Y~~i~~~~~~~~~~lErR~~~~~rr  221 (222)
T PRK11122        166 YTITLMDVMGYSQLLYGRT-----YD-VMVFGAAGIIYLVVNGLLTLLMRLIERKALAFERR  221 (222)
T ss_pred             HHHHHHHHHHHHHHHHHCC-----CH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             9998999999999999741-----60-99999999999999999999999999987655335