HHsearch alignment of GI: 254780172 and MMDB domain: 2r6g_G_73-244

>2r6g_G (G:73-244) Maltose transport system permease protein MALG; ABC transporter, catalytic intermediate, E. coli maltose transporter, MBP; HET: MAL ATP; 2.80A {Escherichia coli K12}
Probab=99.63  E-value=4.5e-15  Score=108.97  Aligned_cols=159  Identities=14%  Similarity=0.048  Sum_probs=126.3

Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHH-CCCCCCCCH
Q ss_conf             1110024787799999999999875677544412786889997898888761472289999999976641-558877387
Q gi|254780172|r  170 ETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLF-LPDTWDVDK  248 (386)
Q Consensus       170 ~t~~~gGl~~Tl~l~~~~~~~~~~lG~llal~r~s~~~~l~~~~~~~ie~~Rg~Pli~~lf~~~~~lp~~-lp~g~~~~~  248 (386)
                      +.+.|..+..|+.+++.+.++++++|+.+|..-.-.....|........+-..+|-++........+... .........
T Consensus         6 ~~~~~~~l~~Sl~~a~~~~~i~~~ig~~~a~~~~~~~~~~~~~~~~~~~~~~~ip~~v~~~~~~~~~~~~~~~~~~~~~~   85 (172)
T 2r6g_G            6 PFPVLLWLWNSVKVAGISAIGIVALSTTCAYAFARMRFPGKATLLKGMLIFQMFPAVLSLVALYALFDRLGEYIPFIGLN   85 (172)
T ss_dssp             SSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCTTSHHHHHHHHHTTSSCSSSHHHHHHHHHHHHHHHSTTSSTT
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCCCCHHHEEEHHEECCCCCCCCCCCCCC
T ss_conf             52799998648999999999998631033333320441478899987623321331120110310024456512222467


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999899989999999984586678999996216899999999699899862004799999996128999999
Q gi|254780172|r  249 LLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIIN  328 (386)
Q Consensus       249 ~~~a~i~l~l~~aAy~aEi~Rggl~svp~GQ~EAA~alGls~~q~~~~IilPQAlr~~iP~l~n~~i~l~KdTsL~~~Ig  328 (386)
                      ...++++..+....|..-..+++++++|+.+.|||+++|.|+||++++|++|++.+....+..-.++..++|....+.++
T Consensus        86 ~~~~ii~~~~~~~p~~~~~~~~~l~~i~~~~~eaA~~lGas~~~~f~~V~lP~~~p~i~~~~~l~f~~~~~~~~~~~~l~  165 (172)
T 2r6g_G           86 THGGVIFAYLGGIALHVWTIKGYFETIDSSLEEAAALDGATPWQAFRLVLLPLSVPILAVVFILSFIAAITEVPVASLLL  165 (172)
T ss_dssp             SHHHHHHHHTTTTHHHHHHHHHHHTTSCTHHHHHHHHTTCCHHHHHHHTTHHHHHHHHHHHHHHHHHHHHTCCHHHHHHC
T ss_pred             CEEEEEECCCCCEEEEEEEEEHHHHCCCHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCEEECCEECC
T ss_conf             50000000355115421100036413305655567754940777788888987654677788776443232300340114