HHSEARCH alignment of GI: 254780172 and SCOP domain: d3dhwa1

Alignment
>d3dhwa1 f.58.1.1 (A:6-208) D-methionine transport system permease protein MetI {Escherichia coli [TaxId: 562]}
Probab=99.92  E-value=4.6e-24  Score=160.57  Aligned_cols=165  Identities=20%  Similarity=0.280  Sum_probs=131.9

Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHH----HHHHHH---CCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCCCCC
Q ss_conf             02478779999999999987567----754441---27868899978988887614722899999999766415588773
Q gi|254780172|r  174 WGGLLVTLVISFFGIIISMPLGI----LLALGR---NSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDV  246 (386)
Q Consensus       174 ~gGl~~Tl~l~~~~~~~~~~lG~----llal~r---~s~~~~l~~~~~~~ie~~Rg~Pli~~lf~~~~~lp~~lp~g~~~  246 (386)
                      +.|+..|+.+++.+..+++++|+    +++..+   ..+.+.+......+++++|++|.++++++.+.......  +.. 
T Consensus         5 l~~~~~tl~is~~~~~i~~ilg~~lg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ip~~v~~~~~~~~~~~~~--~~~-   81 (203)
T d3dhwa1           5 VRGVWETLAMTFVSGFFGFVIGLPVGVLLYVTRPGQIIANAKLYRTVSAIVNIFRSIPFIILLVWMIPFTRVIV--GTS-   81 (203)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHTTGGGGGGGGGGTTCSSSCCSSHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHTT--CCS-
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--CCC-
T ss_conf             99999999999999999999999999999998744432008999999999999999999999999998635540--454-


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHH
Q ss_conf             87999999999998999899999999845866789999962168999999996998998620047999999961289999
Q gi|254780172|r  247 DKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISI  326 (386)
Q Consensus       247 ~~~~~a~i~l~l~~aAy~aEi~Rggl~svp~GQ~EAA~alGls~~q~~~~IilPQAlr~~iP~l~n~~i~l~KdTsL~~~  326 (386)
                      .....+++++++++.+|+.+++|+|++++|++|.|||+++|.|+||++++|++||+.+..+++..++++..+||++++..
T Consensus        82 ~~~~~~i~~~~~~~~p~~~~~~~~~l~~i~~~~~Eaa~~lGas~~q~~~~vilP~~~p~i~~~~~~~~~~~i~~~~~~~~  161 (203)
T d3dhwa1          82 IGLQAAIVPLTVGAAPFIARMVENALLEIPTGLIEASRAMGATPMQIVRKVLLPEALPGLVNAATITLITLVGYSAMGGA  161 (203)
T ss_dssp             SSHHHHHHHHHHHHHHHHHHHHHHHHHHSCTTTTTHHHHHTCCTHHHHHHTTHHHHHHHHHHHHHHHHHHHHHHHHHCCS
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             11999999999986489999999888843620689998869944424188409976999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHH
Q ss_conf             999999999999741
Q gi|254780172|r  327 INMFDLLGIVRVNFS  341 (386)
Q Consensus       327 Ig~~el~~~~~~~~~  341 (386)
                      +|..|+.....+...
T Consensus       162 ig~~~~~~~~~~~~~  176 (203)
T d3dhwa1         162 VGAGGLGQIGYQYGY  176 (203)
T ss_dssp             TTCCHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHH
T ss_conf             977599999999998


SCOP domain information

class: Membrane and cell surface proteins and peptides
fold: MetI-like
superfamily: MetI-like
family: MetI-like
domain: D-methionine transport system permease protein MetI
species: Escherichia coli [TaxId: 562]