BLAST/PSIBLAST alignment of GI: 254780172 and GI: 327190792 at iteration 1
>gi|327190792|gb|EGE57860.1| general L-amino acid ABC transporter, permease protein [Rhizobium etli CNPAF512] Length = 359
 Score =  484 bits (1247), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 232/359 (64%), Positives = 287/359 (79%)

Query: 28  IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQ 87
           ++AWI +N   TPKD++LT L +  + +++   + W+F+ AVW G +RT C T  QGGIQ
Sbjct: 1   MVAWIRRNLLATPKDMVLTTLAVVFIAWALLHAVDWLFVQAVWRGPDRTFCATAVQGGIQ 60

Query: 88  PDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSIL 147
           PDGW+ ACWAF+  +++QFI+G YP+ +RWRP LV +   +LL PMLIPS PRK +N++L
Sbjct: 61  PDGWSGACWAFVNAKFDQFIYGRYPLDERWRPTLVGILFVLLLVPMLIPSAPRKGVNALL 120

Query: 148 LFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIP 207
           LFG  PI SFF+LYGG GL IVET LWGGLLVTLV+SF GI +S PLGI+LALGR S +P
Sbjct: 121 LFGALPIVSFFLLYGGYGLEIVETPLWGGLLVTLVLSFVGIAVSFPLGIILALGRRSQMP 180

Query: 208 VLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEV 267
           V+R  CI FIE+ RGVPL+TVLFMAS+MLPLFLP  W VDKLLRA++GVS FASAY+AEV
Sbjct: 181 VIRTVCIVFIEVVRGVPLITVLFMASVMLPLFLPAGWTVDKLLRAIIGVSIFASAYMAEV 240

Query: 268 LRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISII 327
           +RGGLQ+I KGQFE A+SLGL Y QKMRLIIMPQ IK VIPGIVNTFIG+FKD+SL+SII
Sbjct: 241 IRGGLQAIPKGQFEGADSLGLGYWQKMRLIIMPQAIKLVIPGIVNTFIGMFKDTSLVSII 300

Query: 328 NMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
           +MFDLLGIVR+NF +  W ++VTP TGLIF GF FW+FCF +S YS F+E+ L  G K+
Sbjct: 301 SMFDLLGIVRLNFVDPNWATAVTPLTGLIFAGFSFWLFCFGMSRYSAFMERHLDTGHKR 359