BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780172|ref|YP_003064585.1| general L-amino acid transport
system permease protein [Candidatus Liberibacter asiaticus str. psy62]
         (386 letters)

Database: nr 
           13,984,884 sequences; 4,792,584,752 total letters

Searching..................................................done


Results from round 1


>gi|254780172|ref|YP_003064585.1| general L-amino acid transport system permease protein [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254039849|gb|ACT56645.1| general L-amino acid transport system permease protein [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 386

 Score =  765 bits (1976), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/386 (100%), Positives = 386/386 (100%)

Query: 1   MIDSCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGI 60
           MIDSCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGI
Sbjct: 1   MIDSCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGI 60

Query: 61  IHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPI 120
           IHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPI
Sbjct: 61  IHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPI 120

Query: 121 LVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVT 180
           LVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVT
Sbjct: 121 LVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVT 180

Query: 181 LVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFL 240
           LVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFL
Sbjct: 181 LVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFL 240

Query: 241 PDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMP 300
           PDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMP
Sbjct: 241 PDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMP 300

Query: 301 QVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGF 360
           QVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGF
Sbjct: 301 QVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGF 360

Query: 361 VFWIFCFSISLYSVFIEKTLHKGSKK 386
           VFWIFCFSISLYSVFIEKTLHKGSKK
Sbjct: 361 VFWIFCFSISLYSVFIEKTLHKGSKK 386


>gi|315122675|ref|YP_004063164.1| general L-amino acid transport system permease protein [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313496077|gb|ADR52676.1| general L-amino acid transport system permease protein [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 386

 Score =  608 bits (1569), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 317/386 (82%), Positives = 346/386 (89%)

Query: 1   MIDSCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGI 60
           MI   KEFPYVRK+LL P LPPV+QRGIIAWIH +FF T KD +LT LII  LL  IP I
Sbjct: 1   MIHPLKEFPYVRKQLLPPCLPPVHQRGIIAWIHTSFFYTIKDSILTLLIIASLLSLIPDI 60

Query: 61  IHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPI 120
            HW F+DAVW G++R VCTT+SQGGIQPDGWNAACWAF+YDRY QFIFGNYP  +RWRPI
Sbjct: 61  AHWFFIDAVWTGTDRRVCTTISQGGIQPDGWNAACWAFVYDRYPQFIFGNYPAEERWRPI 120

Query: 121 LVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVT 180
           LVF+ GSILL PML+PS PRKFLN +LLF LFPIFSFFVLYGG GL+IVETSLWGGLLVT
Sbjct: 121 LVFVLGSILLIPMLMPSLPRKFLNGVLLFFLFPIFSFFVLYGGFGLTIVETSLWGGLLVT 180

Query: 181 LVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFL 240
           LVIS FGII+SMPLGILLALGR+SNI VLR  CITF+ELFRGVPLVTVLFM S+MLPLFL
Sbjct: 181 LVISLFGIIVSMPLGILLALGRSSNILVLRVVCITFVELFRGVPLVTVLFMTSVMLPLFL 240

Query: 241 PDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMP 300
           PD WDVDKLLRALLGV+AFASAYIAEV RGGLQSISKGQFEAANSLGL+Y Q MR II+P
Sbjct: 241 PDAWDVDKLLRALLGVAAFASAYIAEVFRGGLQSISKGQFEAANSLGLNYFQTMRFIIIP 300

Query: 301 QVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGF 360
           Q IKRVIPGIVNTFIGLFKDS+LISIINMFD+LG+VR NFS+S+W+SSVTPTTGLIF+GF
Sbjct: 301 QTIKRVIPGIVNTFIGLFKDSTLISIINMFDILGVVRANFSDSSWVSSVTPTTGLIFVGF 360

Query: 361 VFWIFCFSISLYSVFIEKTLHKGSKK 386
           VFWIFCFSISLYSVFIE+TLHKGSKK
Sbjct: 361 VFWIFCFSISLYSVFIERTLHKGSKK 386


>gi|241204486|ref|YP_002975582.1| polar amino acid ABC transcriptional regulator inner membrane
           protein [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240858376|gb|ACS56043.1| polar amino acid ABC transporter, inner membrane subunit [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 384

 Score =  507 bits (1305), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 239/383 (62%), Positives = 305/383 (79%)

Query: 4   SCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHW 63
           S  + P+VR  +L    PP  +RG +AWI +N   TPKD++LT L + L+ +++P +++W
Sbjct: 2   SVADKPFVRTSILAAEPPPPGERGAVAWIRRNLLATPKDVILTILALALIAWAVPHLVNW 61

Query: 64  VFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVF 123
           +F+ AVW G +RT C T  QGGIQPDGW+ ACWAFI  +Y+QFIFG YP+ +RWRP +V 
Sbjct: 62  LFIQAVWSGPDRTFCATTIQGGIQPDGWSGACWAFISAKYDQFIFGRYPLGERWRPAIVG 121

Query: 124 LTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVI 183
           +   +LL PMLIPS PRK LN+ILLF + P+ +F++L+GGLGL +VET LWGGL+VTLV+
Sbjct: 122 ILFILLLVPMLIPSAPRKGLNAILLFAVLPVIAFWLLHGGLGLEVVETPLWGGLMVTLVL 181

Query: 184 SFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDT 243
           SF GI +S+P+GILLALGR S +PV+R  C+TFIE+ RGVPL+TVLFMAS+MLPLFLP  
Sbjct: 182 SFVGIAVSLPVGILLALGRRSKMPVIRMLCVTFIEVIRGVPLITVLFMASVMLPLFLPTG 241

Query: 244 WDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVI 303
           W+VDKLLRAL+GVS F SAY+AEV+RGGLQ+I KGQFE A+SLGL Y QK RLIIMPQ I
Sbjct: 242 WNVDKLLRALIGVSIFTSAYMAEVIRGGLQAIPKGQFEGADSLGLGYWQKTRLIIMPQAI 301

Query: 304 KRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFW 363
           K VIP IVNTFIG FKD+SL++II MFDLLGIV++NFS++ W S+VTP TGLIF GF+FW
Sbjct: 302 KLVIPSIVNTFIGTFKDTSLVTIIGMFDLLGIVKLNFSDANWASAVTPITGLIFAGFIFW 361

Query: 364 IFCFSISLYSVFIEKTLHKGSKK 386
           +FCF +S YS F+E+ L  G K+
Sbjct: 362 LFCFGMSRYSGFMERHLDTGHKR 384


>gi|116251958|ref|YP_767796.1| general L-amino acid transport system permease protein [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|3182889|sp|Q52814|AAPM_RHIL3 RecName: Full=General L-amino acid transport system permease
           protein AapM
 gi|1154896|emb|CAA57935.1| general amino acid ABC type transporter [Rhizobium leguminosarum]
 gi|115256606|emb|CAK07694.1| General L-amino acid transport system permease protein [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 384

 Score =  505 bits (1301), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 238/383 (62%), Positives = 304/383 (79%)

Query: 4   SCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHW 63
           S  + P+VR  +L    PP  +RG +AWI +N   TPKD++LT L + L+ +++P +++W
Sbjct: 2   SVADKPFVRTSILAAEPPPPGERGAVAWIRRNLLATPKDVILTILALALIAWAVPHLVNW 61

Query: 64  VFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVF 123
           +F+ AVW G +RT C T  QGGIQPDGW+ ACWAFI  +Y+QFIFG YP+ +RWRP +V 
Sbjct: 62  LFIQAVWSGPDRTFCATTLQGGIQPDGWSGACWAFISAKYDQFIFGRYPLGERWRPAIVG 121

Query: 124 LTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVI 183
           +   +LL PMLIPS PRK LN+ILLF + P+ +F++L+GG GL +VET LWGGL+VTLV+
Sbjct: 122 ILFILLLVPMLIPSAPRKGLNAILLFAVLPVIAFWLLHGGFGLEVVETPLWGGLMVTLVL 181

Query: 184 SFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDT 243
           SF GI +S+P+GILLALGR S +PV+R  C+TFIE+ RGVPL+TVLFMAS+MLPLFLP  
Sbjct: 182 SFVGIAVSLPVGILLALGRRSRMPVIRMLCVTFIEVIRGVPLITVLFMASVMLPLFLPTG 241

Query: 244 WDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVI 303
           W+VDKLLRAL+GVS F SAY+AEV+RGGLQ+I KGQFE A+SLGL Y QK RLIIMPQ I
Sbjct: 242 WNVDKLLRALIGVSIFTSAYMAEVIRGGLQAIPKGQFEGADSLGLGYWQKTRLIIMPQAI 301

Query: 304 KRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFW 363
           K VIP IVNTFIG FKD+SL++II MFDLLGIV++NFS++ W S+VTP TGLIF GF+FW
Sbjct: 302 KLVIPSIVNTFIGTFKDTSLVTIIGMFDLLGIVKLNFSDANWASAVTPITGLIFAGFIFW 361

Query: 364 IFCFSISLYSVFIEKTLHKGSKK 386
           +FCF +S YS F+E+ L  G K+
Sbjct: 362 LFCFGMSRYSGFMERHLDTGHKR 384


>gi|86357517|ref|YP_469409.1| general L-amino acid ABC transporter, permease protein [Rhizobium
           etli CFN 42]
 gi|86281619|gb|ABC90682.1| general L-amino acid ABC transporter, permease protein [Rhizobium
           etli CFN 42]
          Length = 381

 Score =  502 bits (1293), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 240/377 (63%), Positives = 300/377 (79%)

Query: 10  YVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAV 69
           +VR  +L P  PP  ++G +AWI +N   TPKDI+LT L +  +++++   + W+F++AV
Sbjct: 5   FVRSAILAPEPPPSAEKGPVAWIRRNLLATPKDIVLTILALVFVVWALLHALDWLFVEAV 64

Query: 70  WIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSIL 129
           W G +RT C T  QGGIQPDGW+ ACWAF+  +++QFIFG YP+ +RWRP LV +   +L
Sbjct: 65  WSGPDRTFCATAVQGGIQPDGWSGACWAFVNAKFDQFIFGRYPLDERWRPTLVGILFVLL 124

Query: 130 LTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGII 189
           L PMLIPS PRK +N++LLFG+ PI SFF+LYGG GL IVET LWGGLLVTLV+SF GI 
Sbjct: 125 LVPMLIPSAPRKGVNALLLFGVLPIISFFLLYGGFGLEIVETPLWGGLLVTLVLSFVGIA 184

Query: 190 ISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKL 249
           +S PLGI+LALGR S +PV+R  C+ FIE+ RGVPL+TVLFMAS+MLPLFLP  W VDKL
Sbjct: 185 VSFPLGIILALGRRSQMPVIRTFCVVFIEVVRGVPLITVLFMASVMLPLFLPAGWTVDKL 244

Query: 250 LRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPG 309
           LRA++GVS FASAY+AEV+RGGLQ+I KGQFE A+SLGL Y QKMRL+IMPQ IK VIPG
Sbjct: 245 LRAVIGVSIFASAYMAEVIRGGLQAIPKGQFEGADSLGLGYWQKMRLVIMPQAIKLVIPG 304

Query: 310 IVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSI 369
           IVNTFIG+FKD+SL+SII+MFDLLGIVR+NF +  W ++VTP TGLIF GF FW+FCF +
Sbjct: 305 IVNTFIGMFKDTSLVSIISMFDLLGIVRLNFVDPNWATAVTPLTGLIFAGFAFWLFCFGM 364

Query: 370 SLYSVFIEKTLHKGSKK 386
           S YS FIE+ L  G K+
Sbjct: 365 SRYSAFIERHLDTGHKR 381


>gi|190891585|ref|YP_001978127.1| general L-amino acid ABC transporter, permease protein [Rhizobium
           etli CIAT 652]
 gi|190696864|gb|ACE90949.1| general L-amino acid ABC transporter, permease protein [Rhizobium
           etli CIAT 652]
          Length = 381

 Score =  501 bits (1291), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 239/377 (63%), Positives = 298/377 (79%)

Query: 10  YVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAV 69
           +VR  +L P  PP  ++G++AWI +N   TPKD++LT L +  + +++   + W+F+ AV
Sbjct: 5   FVRTAILAPEPPPAGEKGMVAWIRRNLLATPKDMVLTTLAVVFIAWALLHAVDWLFVQAV 64

Query: 70  WIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSIL 129
           W G +RT C T  QGGIQPDGW+ ACWAF+  +++QFI+G YP+ +RWRP LV +   +L
Sbjct: 65  WRGPDRTFCATAVQGGIQPDGWSGACWAFVNAKFDQFIYGRYPLDERWRPTLVGILFVLL 124

Query: 130 LTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGII 189
           L PMLIPS PRK +N++LLFG  PI SFF+LYGG GL IVET LWGGLLVTLV+SF GI 
Sbjct: 125 LVPMLIPSAPRKGVNALLLFGALPIVSFFLLYGGYGLEIVETPLWGGLLVTLVLSFVGIA 184

Query: 190 ISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKL 249
           +S PLGI+LALGR S +PV+R  CI FIE+ RGVPL+TVLFMAS+MLPLFLP  W VDKL
Sbjct: 185 VSFPLGIILALGRRSQMPVIRTVCIVFIEVVRGVPLITVLFMASVMLPLFLPAGWTVDKL 244

Query: 250 LRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPG 309
           LRA++GVS FASAY+AEV+RGGLQ+I KGQFE A+SLGL Y QKMRLIIMPQ IK VIPG
Sbjct: 245 LRAIIGVSIFASAYMAEVIRGGLQAIPKGQFEGADSLGLGYWQKMRLIIMPQAIKLVIPG 304

Query: 310 IVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSI 369
           IVNTFIG+FKD+SL+SII+MFDLLGIVR+NF +  W ++VTP TGLIF GF FW+FCF +
Sbjct: 305 IVNTFIGMFKDTSLVSIISMFDLLGIVRLNFVDPNWATAVTPLTGLIFAGFSFWLFCFGM 364

Query: 370 SLYSVFIEKTLHKGSKK 386
           S YS F+E+ L  G K+
Sbjct: 365 SRYSAFMERHLDTGHKR 381


>gi|209549160|ref|YP_002281077.1| polar amino acid ABC transporter inner membrane subunit [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|209534916|gb|ACI54851.1| polar amino acid ABC transporter, inner membrane subunit [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 384

 Score =  501 bits (1290), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 237/383 (61%), Positives = 301/383 (78%)

Query: 4   SCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHW 63
           S  + P+VR  +L    PP  +RG +AWI +N   TPKD++LT L + L+ +++P +++W
Sbjct: 2   SVADKPFVRTSILAAEPPPRGERGAVAWIRRNLLATPKDVILTILAVALIAWAVPHLVNW 61

Query: 64  VFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVF 123
           +F+ AVW G +RT C T  QGGIQP+GW+ ACWAF+  +Y+QFIFG YP+ +RWRP +V 
Sbjct: 62  LFIQAVWSGPDRTFCATTIQGGIQPEGWSGACWAFVSAKYDQFIFGRYPLDERWRPAIVG 121

Query: 124 LTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVI 183
           +   +LL PMLIPS PRK LN+ILLF   PI +F++L+GG GL +VET LWGGL+VTLV+
Sbjct: 122 ILFILLLVPMLIPSAPRKGLNAILLFAALPIIAFWLLHGGYGLEVVETPLWGGLMVTLVL 181

Query: 184 SFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDT 243
           SF GI +S+P GILLALGR S +PV+R  C+TFIE+ RGVPL+TVLFMAS+MLPLFLP  
Sbjct: 182 SFVGIAVSLPCGILLALGRRSKMPVIRMLCVTFIEVIRGVPLITVLFMASVMLPLFLPTG 241

Query: 244 WDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVI 303
           W+VDKLLRAL+GVS F SAY+AEV+RGGLQ+I KGQFE A+SLGL Y QK RLIIMPQ I
Sbjct: 242 WNVDKLLRALIGVSIFTSAYMAEVIRGGLQAIPKGQFEGADSLGLGYWQKTRLIIMPQAI 301

Query: 304 KRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFW 363
           K VIP IVNTFIG FKD+SL++II MFDLLGIV+ NFS++ W S+VTP TGLIF GF+FW
Sbjct: 302 KLVIPSIVNTFIGTFKDTSLVTIIGMFDLLGIVKQNFSDANWASAVTPITGLIFAGFIFW 361

Query: 364 IFCFSISLYSVFIEKTLHKGSKK 386
           +FCF +S YS F+E+ L  G K+
Sbjct: 362 LFCFGMSRYSGFMERHLDTGHKR 384


>gi|222085838|ref|YP_002544369.1| general L-amino acid ABC transporter [Agrobacterium radiobacter
           K84]
 gi|221723286|gb|ACM26442.1| general L-amino acid ABC transporter [Agrobacterium radiobacter
           K84]
          Length = 384

 Score =  486 bits (1251), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 231/383 (60%), Positives = 290/383 (75%)

Query: 4   SCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHW 63
           S     +V K LL P   P  ++G+  WI KN   TPKD++LT L I  L ++IP I++W
Sbjct: 2   SNTNHSFVSKTLLPPQQAPANEKGVGHWIKKNLLATPKDMVLTVLAIAFLAWAIPHIVNW 61

Query: 64  VFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVF 123
           +F+ A W G++RT C T  QGG QPDGW+ ACWAF+  +   F+FG YP  +RWRPILV 
Sbjct: 62  LFIQAAWTGADRTFCATTIQGGTQPDGWSGACWAFVSAKINVFLFGLYPPEERWRPILVI 121

Query: 124 LTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVI 183
           +   + + P+LIPS PRK LN +L F + PI SFF+LYGG GL +VET  WGGL+VTL++
Sbjct: 122 ILAVLTIAPLLIPSVPRKGLNVLLAFIVLPIMSFFLLYGGFGLDVVETQRWGGLMVTLIV 181

Query: 184 SFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDT 243
           SF  I +S+P GI+LALGR S +PV+R  C+ FIE+ RG+PL+TVLFMAS+MLPLFLP  
Sbjct: 182 SFVAIAVSVPFGIVLALGRRSQMPVIRMLCVLFIEVIRGIPLITVLFMASVMLPLFLPQG 241

Query: 244 WDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVI 303
           W +DKLLRA++GVS F SAY+AEV+RGGLQ++ KGQFE A+SLGL Y QKMRLI++PQ I
Sbjct: 242 WTIDKLLRAVIGVSIFTSAYMAEVIRGGLQAVPKGQFEGADSLGLGYWQKMRLIVLPQAI 301

Query: 304 KRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFW 363
           K VIPGIVNTFIG+FKD+SLISIINMFDLLGIVR NFS+  W S VTP TGLIF GFVFW
Sbjct: 302 KLVIPGIVNTFIGMFKDTSLISIINMFDLLGIVRQNFSDPNWASPVTPVTGLIFAGFVFW 361

Query: 364 IFCFSISLYSVFIEKTLHKGSKK 386
           +FCF++S YS F+E+ L  G K+
Sbjct: 362 LFCFAMSRYSGFMERHLDTGHKR 384


>gi|327190792|gb|EGE57860.1| general L-amino acid ABC transporter, permease protein [Rhizobium
           etli CNPAF512]
          Length = 359

 Score =  484 bits (1247), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 232/359 (64%), Positives = 287/359 (79%)

Query: 28  IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQ 87
           ++AWI +N   TPKD++LT L +  + +++   + W+F+ AVW G +RT C T  QGGIQ
Sbjct: 1   MVAWIRRNLLATPKDMVLTTLAVVFIAWALLHAVDWLFVQAVWRGPDRTFCATAVQGGIQ 60

Query: 88  PDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSIL 147
           PDGW+ ACWAF+  +++QFI+G YP+ +RWRP LV +   +LL PMLIPS PRK +N++L
Sbjct: 61  PDGWSGACWAFVNAKFDQFIYGRYPLDERWRPTLVGILFVLLLVPMLIPSAPRKGVNALL 120

Query: 148 LFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIP 207
           LFG  PI SFF+LYGG GL IVET LWGGLLVTLV+SF GI +S PLGI+LALGR S +P
Sbjct: 121 LFGALPIVSFFLLYGGYGLEIVETPLWGGLLVTLVLSFVGIAVSFPLGIILALGRRSQMP 180

Query: 208 VLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEV 267
           V+R  CI FIE+ RGVPL+TVLFMAS+MLPLFLP  W VDKLLRA++GVS FASAY+AEV
Sbjct: 181 VIRTVCIVFIEVVRGVPLITVLFMASVMLPLFLPAGWTVDKLLRAIIGVSIFASAYMAEV 240

Query: 268 LRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISII 327
           +RGGLQ+I KGQFE A+SLGL Y QKMRLIIMPQ IK VIPGIVNTFIG+FKD+SL+SII
Sbjct: 241 IRGGLQAIPKGQFEGADSLGLGYWQKMRLIIMPQAIKLVIPGIVNTFIGMFKDTSLVSII 300

Query: 328 NMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
           +MFDLLGIVR+NF +  W ++VTP TGLIF GF FW+FCF +S YS F+E+ L  G K+
Sbjct: 301 SMFDLLGIVRLNFVDPNWATAVTPLTGLIFAGFSFWLFCFGMSRYSAFMERHLDTGHKR 359


>gi|218671516|ref|ZP_03521186.1| general L-amino acid ABC transporter, permease protein [Rhizobium
           etli GR56]
          Length = 339

 Score =  465 bits (1197), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 223/326 (68%), Positives = 267/326 (81%)

Query: 61  IHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPI 120
           I W+F+ AVW G +RT C T  QGGIQPDGWN ACWAF+  +++QFIFG YP+ +RWRP 
Sbjct: 14  IDWLFVQAVWTGPDRTFCATAVQGGIQPDGWNGACWAFVNAKFDQFIFGRYPLDERWRPT 73

Query: 121 LVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVT 180
           LV +   +LL PMLIPS PRK +N++LLFG+ PI SFF+LYGG GL IVET LWGGLLVT
Sbjct: 74  LVGILFVLLLVPMLIPSAPRKGINALLLFGVLPIVSFFLLYGGFGLEIVETPLWGGLLVT 133

Query: 181 LVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFL 240
           LV+SF GI +S PLGI+LALGR S +PV+R  CI FIE+ RGVPL+TVLFMAS+MLPLFL
Sbjct: 134 LVLSFVGIAVSFPLGIILALGRRSQMPVIRTVCIVFIEVVRGVPLITVLFMASVMLPLFL 193

Query: 241 PDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMP 300
           P  W VDKLLRA++GVS FASAY+AEV+RGGLQ+I KGQFE A+SLGL Y QKMRL+IMP
Sbjct: 194 PAGWTVDKLLRAIIGVSIFASAYMAEVIRGGLQAIPKGQFEGADSLGLGYWQKMRLVIMP 253

Query: 301 QVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGF 360
           Q IK VIPGIVNTFIG+FKD+SL+SII+MFDLLGIVR+NF +  W ++VTP TGLIF GF
Sbjct: 254 QAIKLVIPGIVNTFIGMFKDTSLVSIISMFDLLGIVRLNFVDPNWATAVTPLTGLIFAGF 313

Query: 361 VFWIFCFSISLYSVFIEKTLHKGSKK 386
            FW+FCF +S YS F+E+ L  G K+
Sbjct: 314 AFWLFCFGMSRYSAFVERHLDTGHKR 339


>gi|227821878|ref|YP_002825848.1| putative amino acid ABC transporter, permease protein
           [Sinorhizobium fredii NGR234]
 gi|227340877|gb|ACP25095.1| putative amino acid ABC transporter, permease protein
           [Sinorhizobium fredii NGR234]
          Length = 384

 Score =  464 bits (1195), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 224/383 (58%), Positives = 288/383 (75%), Gaps = 1/383 (0%)

Query: 4   SCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHW 63
           S  +  +VR  ++  S  P  + G+++W+ KN F TPKD +LT + + +L + +P  I W
Sbjct: 2   STNQAAFVRSSMVDASPAPALESGVVSWLRKNLFATPKDTVLTIISLLILAWLVPPAIQW 61

Query: 64  VFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVF 123
           +F+DA W G  R VC T+SQGG QPDGW+ ACWAF+  ++ QF+FG YP+ +RWRP LV 
Sbjct: 62  LFIDAAWTGGGRGVCATLSQGGSQPDGWSGACWAFVNAKFGQFVFGRYPLEERWRPALVG 121

Query: 124 LTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLV 182
           +   + L PMLIP  P K LN+ILLF   PI +  +L GG LGL  VET+ WGGL+VTL 
Sbjct: 122 ILFVLFLVPMLIPKIPYKGLNAILLFAALPIVATILLPGGWLGLVYVETAFWGGLMVTLA 181

Query: 183 ISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPD 242
           +SF GI +S+PLGILLALGR S++PV++  C  FIE+ RG+PL+TVLFMAS+MLPLFLP 
Sbjct: 182 LSFVGIAVSLPLGILLALGRRSDMPVIKMLCTVFIEIVRGIPLITVLFMASVMLPLFLPQ 241

Query: 243 TWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQV 302
               DK LRAL+GVS FASAY+AEV+RGGLQ+I KGQ+E A+SLGLSY QKM LI++PQ 
Sbjct: 242 GVTFDKFLRALIGVSFFASAYMAEVVRGGLQAIPKGQYEGADSLGLSYWQKMNLIVLPQA 301

Query: 303 IKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVF 362
           +K VIPGIVNTFIGLFKD+SL+SII MFDLLGIVR NF+++ W ++VTP TGLIF GFVF
Sbjct: 302 LKLVIPGIVNTFIGLFKDTSLVSIIGMFDLLGIVRFNFTDANWATAVTPITGLIFAGFVF 361

Query: 363 WIFCFSISLYSVFIEKTLHKGSK 385
           W+FCF +S YS F+E+ L K  +
Sbjct: 362 WLFCFGMSRYSGFMERLLDKSQR 384


>gi|239831567|ref|ZP_04679896.1| amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine family [Ochrobactrum intermedium
           LMG 3301]
 gi|239823834|gb|EEQ95402.1| amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine family [Ochrobactrum intermedium
           LMG 3301]
          Length = 387

 Score =  460 bits (1183), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 228/387 (58%), Positives = 292/387 (75%), Gaps = 1/387 (0%)

Query: 1   MIDSCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGI 60
           M     +  YVR +++    PP   +G+  W+  N F TP D  LT L + ++ + +P I
Sbjct: 1   MTMENADLQYVRTQMVDGEAPPRSVQGLSHWLRVNLFATPVDAALTILGLLVVAWFLPPI 60

Query: 61  IHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPI 120
           I W+F+ AVW G++RT C TV+QGG QP+GW+ ACWAF+  +YEQF++G YP+++RWR  
Sbjct: 61  IEWLFVKAVWTGADRTACLTVAQGGAQPEGWSGACWAFVNAKYEQFLYGRYPISERWRVN 120

Query: 121 LVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLV 179
           L  L  ++LL P+LIP  P+K LN+IL F +FPI +FF+L GG  GL  VET LWGGLLV
Sbjct: 121 LTALIFAVLLVPLLIPKAPKKGLNAILFFFVFPIVAFFLLVGGWFGLPYVETPLWGGLLV 180

Query: 180 TLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLF 239
           TLV+SF GI +S+PLGI+LALGR S +PV+R   I FIE+ RGVPLVTVLFMAS+MLPLF
Sbjct: 181 TLVLSFVGIAVSLPLGIVLALGRRSKLPVIRAFSIIFIEMVRGVPLVTVLFMASVMLPLF 240

Query: 240 LPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIM 299
           LP     DKLLRAL+GV+ FASAY+AEV+RGGLQ+I +GQ+E A++LGLSY QK  LII+
Sbjct: 241 LPPGVTFDKLLRALIGVALFASAYMAEVVRGGLQAIPRGQYEGADALGLSYWQKTGLIIL 300

Query: 300 PQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIG 359
           PQ +K VIPGIVNTFIGLFKD+SL+ II MFDLLGIVR NF+++ W S  TP TGLIF G
Sbjct: 301 PQALKLVIPGIVNTFIGLFKDTSLVYIIGMFDLLGIVRQNFADANWASPQTPATGLIFAG 360

Query: 360 FVFWIFCFSISLYSVFIEKTLHKGSKK 386
           FVFWIFCF++S YS+F+E+ L  G K+
Sbjct: 361 FVFWIFCFAMSRYSIFMERRLDTGHKR 387


>gi|23501631|ref|NP_697758.1| amino acid ABC transporter permease [Brucella suis 1330]
 gi|161618714|ref|YP_001592601.1| His/Glu/Gln/Arg/opine amino acid ABC transporter permease [Brucella
           canis ATCC 23365]
 gi|254704070|ref|ZP_05165898.1| His/Glu/Gln/Arg/opine amino acid ABC transporter permease [Brucella
           suis bv. 3 str. 686]
 gi|260566682|ref|ZP_05837152.1| polar amino acid ABC transporter [Brucella suis bv. 4 str. 40]
 gi|261754728|ref|ZP_05998437.1| polar amino acid ABC transporter [Brucella suis bv. 3 str. 686]
 gi|23347548|gb|AAN29673.1| amino acid ABC transporter, permease protein [Brucella suis 1330]
 gi|161335525|gb|ABX61830.1| amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine family [Brucella canis ATCC 23365]
 gi|260156200|gb|EEW91280.1| polar amino acid ABC transporter [Brucella suis bv. 4 str. 40]
 gi|261744481|gb|EEY32407.1| polar amino acid ABC transporter [Brucella suis bv. 3 str. 686]
          Length = 385

 Score =  460 bits (1183), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 224/381 (58%), Positives = 290/381 (76%), Gaps = 1/381 (0%)

Query: 7   EFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFL 66
           +  YVR +++    PP   +GI  W+  N F TP D  LT   + L+++ +P II W+F+
Sbjct: 5   DLQYVRTQMVDGEAPPRSVQGISHWLRVNLFATPVDAALTIFGLVLVVWFVPPIIEWLFI 64

Query: 67  DAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTG 126
           +A W G++RT C T +QGG QPDGW+ ACWAF+  +YEQF++G YP+++RWR  L  L  
Sbjct: 65  NAAWTGTSRTACLTAAQGGAQPDGWSGACWAFVNAKYEQFLYGRYPISERWRVDLTALIF 124

Query: 127 SILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISF 185
           + LL P+LIP  P+K LN+IL F +FP+ +FF+L GG  GL  VET LWGGLLVTLV+SF
Sbjct: 125 AALLVPLLIPKIPKKGLNAILFFLVFPVVAFFLLVGGWFGLPYVETPLWGGLLVTLVLSF 184

Query: 186 FGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWD 245
            GI +S+PLGI+LALGR S +PV++   I+FIE+ RGVPLVTVLFMAS+MLPLFLP    
Sbjct: 185 VGIAVSLPLGIVLALGRRSKLPVIKTLSISFIEMVRGVPLVTVLFMASVMLPLFLPPGVT 244

Query: 246 VDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKR 305
            DKLLRAL+GV+ FASAY+AEV+RGGLQ+I +GQ+E A++LGLSY QK  L+++PQ +K 
Sbjct: 245 FDKLLRALIGVALFASAYMAEVVRGGLQAIPRGQYEGADALGLSYWQKTGLVVLPQALKL 304

Query: 306 VIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIF 365
           VIPGIVNTFIGLFKD+SL+ II MFDLLGIVR NFS++ W S  TP TGLIF GFVFWIF
Sbjct: 305 VIPGIVNTFIGLFKDTSLVYIIGMFDLLGIVRQNFSDANWASPQTPATGLIFAGFVFWIF 364

Query: 366 CFSISLYSVFIEKTLHKGSKK 386
           CF++S YS+F+E+ L  G K+
Sbjct: 365 CFAMSRYSIFMERRLDTGHKR 385


>gi|225627245|ref|ZP_03785282.1| amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine family protein [Brucella ceti str.
           Cudo]
 gi|225617250|gb|EEH14295.1| amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine family protein [Brucella ceti str.
           Cudo]
          Length = 387

 Score =  459 bits (1182), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 225/387 (58%), Positives = 290/387 (74%), Gaps = 1/387 (0%)

Query: 1   MIDSCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGI 60
           M     +  YVR +++    PP   +GI  W+  N F TP D  LT   + L+++ +P I
Sbjct: 1   MTMENADLQYVRTQMVDGEAPPRSVQGISHWLRVNLFATPVDAALTIFGLVLVVWFVPPI 60

Query: 61  IHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPI 120
           I W+F++A W G++RT C T +QGG QPDGW+ ACWAF+  +YEQF++G YP+++RWR  
Sbjct: 61  IEWLFINAAWTGTSRTACLTAAQGGAQPDGWSGACWAFVNAKYEQFLYGRYPISERWRVD 120

Query: 121 LVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLV 179
           L  L  + LL P+LIP  P+K LN+IL F +FP+ +FF+L GG  GL  VET LWGGLLV
Sbjct: 121 LTALIFAALLVPLLIPKIPKKGLNAILFFLVFPVVAFFLLVGGWFGLPYVETPLWGGLLV 180

Query: 180 TLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLF 239
           TLV+SF GI +S+PLGI+LALGR S +PV++   I FIE+ RGVPLVTVLFMAS+MLPLF
Sbjct: 181 TLVLSFVGIAVSLPLGIVLALGRRSKLPVIKTLSIIFIEMVRGVPLVTVLFMASVMLPLF 240

Query: 240 LPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIM 299
           LP     DKLLRAL+GV+ FASAY+AEV+RGGLQ+I +GQ+E A++LGLSY QK  L+++
Sbjct: 241 LPPGVTFDKLLRALIGVALFASAYMAEVVRGGLQAIPRGQYEGADALGLSYWQKTGLVVL 300

Query: 300 PQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIG 359
           PQ +K VIPGIVNTFIGLFKD+SL+ II MFDLLGIVR NFS++ W S  TP TGLIF G
Sbjct: 301 PQALKLVIPGIVNTFIGLFKDTSLVYIIGMFDLLGIVRQNFSDANWASPQTPATGLIFAG 360

Query: 360 FVFWIFCFSISLYSVFIEKTLHKGSKK 386
           FVFWIFCF++S YS+F+E+ L  G K+
Sbjct: 361 FVFWIFCFAMSRYSIFMERRLDTGHKR 387


>gi|306842007|ref|ZP_07474680.1| amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine family [Brucella sp. BO2]
 gi|306287848|gb|EFM59268.1| amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine family [Brucella sp. BO2]
          Length = 387

 Score =  459 bits (1181), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 225/387 (58%), Positives = 290/387 (74%), Gaps = 1/387 (0%)

Query: 1   MIDSCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGI 60
           M     +  YVR +++    PP   +GI  W+  N F TP D  LT   + L+++ +P I
Sbjct: 1   MTMENADLQYVRTQMVDGEAPPRSVQGISHWLRVNLFATPVDAALTIFGLVLVVWFVPPI 60

Query: 61  IHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPI 120
           I W+F++A W G++RT C T +QGG QPDGW+ ACWAF+  +YEQF++G YP+++RWR  
Sbjct: 61  IEWLFINAAWTGTSRTACLTAAQGGAQPDGWSGACWAFVNAKYEQFLYGRYPISERWRID 120

Query: 121 LVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLV 179
           L  L  + LL P+LIP  P+K LN+IL F +FP+ +FF+L GG  GL  VET LWGGLLV
Sbjct: 121 LTALIFAALLVPLLIPKVPKKGLNAILFFLVFPVVAFFLLVGGWFGLPYVETPLWGGLLV 180

Query: 180 TLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLF 239
           TLV+SF GI +S+PLGI+LALGR S +PV++   I FIE+ RGVPLVTVLFMAS+MLPLF
Sbjct: 181 TLVLSFVGIAVSLPLGIVLALGRRSKLPVIKTLSIIFIEMVRGVPLVTVLFMASVMLPLF 240

Query: 240 LPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIM 299
           LP     DKLLRAL+GV+ FASAY+AEV+RGGLQ+I +GQ+E A++LGLSY QK  L+++
Sbjct: 241 LPPGVTFDKLLRALIGVALFASAYMAEVVRGGLQAIPRGQYEGADALGLSYWQKTGLVVL 300

Query: 300 PQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIG 359
           PQ +K VIPGIVNTFIGLFKD+SL+ II MFDLLGIVR NFS++ W S  TP TGLIF G
Sbjct: 301 PQALKLVIPGIVNTFIGLFKDTSLVYIIGMFDLLGIVRQNFSDANWASPQTPATGLIFAG 360

Query: 360 FVFWIFCFSISLYSVFIEKTLHKGSKK 386
           FVFWIFCF++S YS+F+E+ L  G K+
Sbjct: 361 FVFWIFCFAMSRYSIFMERRLDTGHKR 387


>gi|254701521|ref|ZP_05163349.1| His/Glu/Gln/Arg/opine amino acid ABC transporter permease [Brucella
           suis bv. 5 str. 513]
 gi|254709862|ref|ZP_05171673.1| His/Glu/Gln/Arg/opine amino acid ABC transporter permease [Brucella
           pinnipedialis B2/94]
 gi|256031354|ref|ZP_05444968.1| His/Glu/Gln/Arg/opine amino acid ABC transporter permease [Brucella
           pinnipedialis M292/94/1]
 gi|256060864|ref|ZP_05451024.1| His/Glu/Gln/Arg/opine amino acid ABC transporter permease [Brucella
           neotomae 5K33]
 gi|256159476|ref|ZP_05457244.1| His/Glu/Gln/Arg/opine amino acid ABC transporter permease [Brucella
           ceti M490/95/1]
 gi|256254762|ref|ZP_05460298.1| His/Glu/Gln/Arg/opine amino acid ABC transporter permease [Brucella
           ceti B1/94]
 gi|260168488|ref|ZP_05755299.1| amino acid ABC transporter, permease protein [Brucella sp. F5/99]
 gi|261221941|ref|ZP_05936222.1| polar amino acid ABC transporter [Brucella ceti B1/94]
 gi|261317403|ref|ZP_05956600.1| polar amino acid ABC transporter [Brucella pinnipedialis B2/94]
 gi|261324861|ref|ZP_05964058.1| polar amino acid ABC transporter [Brucella neotomae 5K33]
 gi|261752069|ref|ZP_05995778.1| polar amino acid ABC transporter [Brucella suis bv. 5 str. 513]
 gi|261757956|ref|ZP_06001665.1| polar amino acid ABC transporter [Brucella sp. F5/99]
 gi|265988440|ref|ZP_06100997.1| polar amino acid ABC transporter [Brucella pinnipedialis M292/94/1]
 gi|265997904|ref|ZP_06110461.1| polar amino acid ABC transporter [Brucella ceti M490/95/1]
 gi|294852108|ref|ZP_06792781.1| general L-amino acid transport system permease [Brucella sp. NVSL
           07-0026]
 gi|260920525|gb|EEX87178.1| polar amino acid ABC transporter [Brucella ceti B1/94]
 gi|261296626|gb|EEY00123.1| polar amino acid ABC transporter [Brucella pinnipedialis B2/94]
 gi|261300841|gb|EEY04338.1| polar amino acid ABC transporter [Brucella neotomae 5K33]
 gi|261737940|gb|EEY25936.1| polar amino acid ABC transporter [Brucella sp. F5/99]
 gi|261741822|gb|EEY29748.1| polar amino acid ABC transporter [Brucella suis bv. 5 str. 513]
 gi|262552372|gb|EEZ08362.1| polar amino acid ABC transporter [Brucella ceti M490/95/1]
 gi|264660637|gb|EEZ30898.1| polar amino acid ABC transporter [Brucella pinnipedialis M292/94/1]
 gi|294820697|gb|EFG37696.1| general L-amino acid transport system permease [Brucella sp. NVSL
           07-0026]
          Length = 385

 Score =  459 bits (1180), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 224/381 (58%), Positives = 289/381 (75%), Gaps = 1/381 (0%)

Query: 7   EFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFL 66
           +  YVR +++    PP   +GI  W+  N F TP D  LT   + L+++ +P II W+F+
Sbjct: 5   DLQYVRTQMVDGEAPPRSVQGISHWLRVNLFATPVDAALTIFGLVLVVWFVPPIIEWLFI 64

Query: 67  DAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTG 126
           +A W G++RT C T +QGG QPDGW+ ACWAF+  +YEQF++G YP+++RWR  L  L  
Sbjct: 65  NAAWTGTSRTACLTAAQGGAQPDGWSGACWAFVNAKYEQFLYGRYPISERWRVDLTALIF 124

Query: 127 SILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISF 185
           + LL P+LIP  P+K LN+IL F +FP+ +FF+L GG  GL  VET LWGGLLVTLV+SF
Sbjct: 125 AALLVPLLIPKIPKKGLNAILFFLVFPVVAFFLLVGGWFGLPYVETPLWGGLLVTLVLSF 184

Query: 186 FGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWD 245
            GI +S+PLGI+LALGR S +PV++   I FIE+ RGVPLVTVLFMAS+MLPLFLP    
Sbjct: 185 VGIAVSLPLGIVLALGRRSKLPVIKTLSIIFIEMVRGVPLVTVLFMASVMLPLFLPPGVT 244

Query: 246 VDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKR 305
            DKLLRAL+GV+ FASAY+AEV+RGGLQ+I +GQ+E A++LGLSY QK  L+++PQ +K 
Sbjct: 245 FDKLLRALIGVALFASAYMAEVVRGGLQAIPRGQYEGADALGLSYWQKTGLVVLPQALKL 304

Query: 306 VIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIF 365
           VIPGIVNTFIGLFKD+SL+ II MFDLLGIVR NFS++ W S  TP TGLIF GFVFWIF
Sbjct: 305 VIPGIVNTFIGLFKDTSLVYIIGMFDLLGIVRQNFSDANWASPQTPATGLIFAGFVFWIF 364

Query: 366 CFSISLYSVFIEKTLHKGSKK 386
           CF++S YS+F+E+ L  G K+
Sbjct: 365 CFAMSRYSIFMERRLDTGHKR 385


>gi|153009882|ref|YP_001371097.1| polar amino acid ABC transporter inner membrane subunit
           [Ochrobactrum anthropi ATCC 49188]
 gi|151561770|gb|ABS15268.1| polar amino acid ABC transporter, inner membrane subunit
           [Ochrobactrum anthropi ATCC 49188]
          Length = 385

 Score =  459 bits (1180), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 228/381 (59%), Positives = 288/381 (75%), Gaps = 1/381 (0%)

Query: 7   EFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFL 66
           +  YVR +++    PP   +GI  W+  N F TP D  LT L +  + + +P II W+F 
Sbjct: 5   DLQYVRSQMVDGEAPPRSVQGISHWLRVNLFATPVDAALTILGLLAVAWFLPPIIEWLFF 64

Query: 67  DAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTG 126
            AVW G++RT C TV+QGG QP+GW+ ACWAF+  +YEQFI+G YP+++RWR  L  L  
Sbjct: 65  KAVWTGADRTACLTVAQGGTQPEGWSGACWAFVNAKYEQFIYGRYPISERWRVNLTALIF 124

Query: 127 SILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISF 185
            +LL P+LIP  P+K LN+IL F +FPI +FF+L GG  GL  VET LWGGLLVTLV+SF
Sbjct: 125 VVLLVPLLIPKAPKKALNAILFFFVFPIVAFFLLVGGWFGLPYVETPLWGGLLVTLVLSF 184

Query: 186 FGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWD 245
            GI +S+PLGI+LALGR S +PV++   I FIE+ RGVPLVTVLFMAS+MLPLFLP    
Sbjct: 185 VGIAVSLPLGIVLALGRRSKLPVIKTFSIIFIEMVRGVPLVTVLFMASVMLPLFLPPGVT 244

Query: 246 VDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKR 305
            DKLLRAL+GV+ FASAY+AEV+RGGLQ+I +GQ+E A++LGLSY QK  LI++PQ +K 
Sbjct: 245 FDKLLRALIGVALFASAYMAEVVRGGLQAIPRGQYEGADALGLSYWQKTGLIVLPQALKL 304

Query: 306 VIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIF 365
           VIPGIVNTFIGLFKD+SL+ II MFDLLGIVR NFS++ W S  TP TGLIF GFVFWIF
Sbjct: 305 VIPGIVNTFIGLFKDTSLVYIIGMFDLLGIVRQNFSDANWASPQTPATGLIFAGFVFWIF 364

Query: 366 CFSISLYSVFIEKTLHKGSKK 386
           CF++S YS+F+E+ L  G K+
Sbjct: 365 CFAMSRYSIFMERRLDTGHKR 385


>gi|254718863|ref|ZP_05180674.1| His/Glu/Gln/Arg/opine amino acid ABC transporter permease [Brucella
           sp. 83/13]
 gi|265983848|ref|ZP_06096583.1| polar amino acid ABC transporter [Brucella sp. 83/13]
 gi|306837634|ref|ZP_07470504.1| amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine family [Brucella sp. NF 2653]
 gi|264662440|gb|EEZ32701.1| polar amino acid ABC transporter [Brucella sp. 83/13]
 gi|306407283|gb|EFM63492.1| amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine family [Brucella sp. NF 2653]
          Length = 385

 Score =  458 bits (1179), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 224/381 (58%), Positives = 289/381 (75%), Gaps = 1/381 (0%)

Query: 7   EFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFL 66
           +  YVR +++    PP   +GI  W+  N F TP D  LT   + L+++ +P II W+F+
Sbjct: 5   DLQYVRTQMVDGEAPPRSVQGISHWLRVNLFATPVDAALTIFGLVLVVWFVPPIIEWLFI 64

Query: 67  DAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTG 126
           +A W G++RT C T +QGG QPDGW+ ACWAF+  +YEQF++G YP+++RWR  L  L  
Sbjct: 65  NAAWTGTSRTACLTAAQGGAQPDGWSGACWAFVNAKYEQFLYGRYPISERWRVDLTALIF 124

Query: 127 SILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISF 185
           + LL P+LIP  P+K LN+IL F +FP+ +FF+L GG  GL  VET LWGGLLVTLV+SF
Sbjct: 125 AALLVPLLIPKVPKKGLNAILFFLVFPVVAFFLLVGGWFGLPYVETPLWGGLLVTLVLSF 184

Query: 186 FGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWD 245
            GI +S+PLGI+LALGR S +PV++   I FIE+ RGVPLVTVLFMAS+MLPLFLP    
Sbjct: 185 VGIAVSLPLGIVLALGRRSKLPVIKTLSIIFIEMVRGVPLVTVLFMASVMLPLFLPPGVT 244

Query: 246 VDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKR 305
            DKLLRAL+GV+ FASAY+AEV+RGGLQ+I +GQ+E A++LGLSY QK  L+++PQ +K 
Sbjct: 245 FDKLLRALIGVALFASAYMAEVVRGGLQAIPRGQYEGADALGLSYWQKTGLVVLPQALKL 304

Query: 306 VIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIF 365
           VIPGIVNTFIGLFKD+SL+ II MFDLLGIVR NFS++ W S  TP TGLIF GFVFWIF
Sbjct: 305 VIPGIVNTFIGLFKDTSLVYIIGMFDLLGIVRQNFSDANWASPQTPATGLIFAGFVFWIF 364

Query: 366 CFSISLYSVFIEKTLHKGSKK 386
           CF++S YS+F+E+ L  G K+
Sbjct: 365 CFAMSRYSIFMERRLDTGHKR 385


>gi|148559315|ref|YP_001258725.1| amino acid ABC transporter permease [Brucella ovis ATCC 25840]
 gi|148370572|gb|ABQ60551.1| amino acid ABC transporter, permease protein [Brucella ovis ATCC
           25840]
          Length = 385

 Score =  457 bits (1177), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 223/381 (58%), Positives = 288/381 (75%), Gaps = 1/381 (0%)

Query: 7   EFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFL 66
           +  YVR +++    PP   +GI  W+  N F TP D  LT   + L+++ +P II W+F+
Sbjct: 5   DLQYVRTQMVDGEAPPRSVQGISHWLRVNLFATPVDAALTIFGLVLVVWFVPPIIEWLFI 64

Query: 67  DAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTG 126
           +A W G++RT C T +QGG QPDGW+ ACWAF+  +YEQF++G YP+++RWR  L  L  
Sbjct: 65  NAAWTGTSRTACLTAAQGGAQPDGWSGACWAFVNAKYEQFLYGRYPISERWRVDLTALIF 124

Query: 127 SILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISF 185
           + LL P+LIP  P+K LN+IL F +FP+ +FF+L GG  GL  VET LWGGLLVTLV+SF
Sbjct: 125 AALLVPLLIPKIPKKGLNAILFFLVFPVVAFFLLVGGWFGLPYVETPLWGGLLVTLVLSF 184

Query: 186 FGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWD 245
            GI +S+PLGI+LALGR S +PV++   I FIE+ RGVPLVTVLFMAS+MLPLFLP    
Sbjct: 185 VGIAVSLPLGIVLALGRRSKLPVIKTLSIIFIEMVRGVPLVTVLFMASVMLPLFLPPGVT 244

Query: 246 VDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKR 305
            DKLLRAL+GV+ FASAY+AEV+RGGLQ+I +GQ+E A++LGLSY QK  L+++PQ +K 
Sbjct: 245 FDKLLRALIGVALFASAYMAEVVRGGLQAIPRGQYEGADALGLSYWQKTSLVVLPQALKL 304

Query: 306 VIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIF 365
           VIPGIVNTFIGLFKD+SL+ II MFDLLGIVR NFS++ W S   P TGLIF GFVFWIF
Sbjct: 305 VIPGIVNTFIGLFKDTSLVYIIGMFDLLGIVRQNFSDANWASPQAPATGLIFAGFVFWIF 364

Query: 366 CFSISLYSVFIEKTLHKGSKK 386
           CF++S YS+F+E+ L  G K+
Sbjct: 365 CFAMSRYSIFMERRLDTGHKR 385


>gi|218507774|ref|ZP_03505652.1| general L-amino acid ABC transporter, permease protein [Rhizobium
           etli Brasil 5]
          Length = 338

 Score =  457 bits (1177), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 221/326 (67%), Positives = 265/326 (81%)

Query: 61  IHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPI 120
           + W+F+ AVW G +RT C T  QGGIQPDGW+ ACWAF+  + +QFI+G YP+ +RWRP 
Sbjct: 13  VDWLFVQAVWRGPDRTFCATAVQGGIQPDGWSGACWAFVKAKIDQFIYGRYPLDERWRPT 72

Query: 121 LVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVT 180
           LV +   +LL PMLIPS PRK +N++LLFG  PI SFF+LYGG GL IVET LWGGLLVT
Sbjct: 73  LVGILFVLLLVPMLIPSAPRKGVNALLLFGALPIVSFFLLYGGYGLEIVETPLWGGLLVT 132

Query: 181 LVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFL 240
           LV+SF GI +S PLGI+LALGR S +PV+R  CI FIE+ RGVPL+TVLFMAS+MLPLFL
Sbjct: 133 LVLSFVGIAVSFPLGIILALGRRSQMPVIRTVCIVFIEVVRGVPLITVLFMASVMLPLFL 192

Query: 241 PDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMP 300
           P  W VDKLLRA++GVS FASAY+AEV+RGGLQ+I KGQFE A+SLGL Y QKMRLIIMP
Sbjct: 193 PAGWTVDKLLRAIIGVSIFASAYMAEVIRGGLQAIPKGQFEGADSLGLGYWQKMRLIIMP 252

Query: 301 QVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGF 360
           Q IK VIPGIVNTFIG+FKD+SL+SII+MFDLLGIVR+NF +  W ++VTP TGLIF GF
Sbjct: 253 QAIKLVIPGIVNTFIGMFKDTSLVSIISMFDLLGIVRLNFVDPNWATAVTPLTGLIFAGF 312

Query: 361 VFWIFCFSISLYSVFIEKTLHKGSKK 386
            FW+FCF +S YS F+E+ L  G K+
Sbjct: 313 SFWLFCFGMSRYSAFMERHLDTGHKR 338


>gi|256369177|ref|YP_003106685.1| amino acid ABC transporter, permease protein [Brucella microti CCM
           4915]
 gi|255999337|gb|ACU47736.1| amino acid ABC transporter, permease protein [Brucella microti CCM
           4915]
          Length = 385

 Score =  457 bits (1176), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 223/381 (58%), Positives = 288/381 (75%), Gaps = 1/381 (0%)

Query: 7   EFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFL 66
           +  YVR +++    PP   +GI  W+  N F TP D  LT   + L+++ +P II W+F+
Sbjct: 5   DLQYVRTQMVDGEAPPRSVQGISHWLRVNLFATPVDAALTIFGLVLVVWFVPPIIEWLFI 64

Query: 67  DAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTG 126
           +A W G++RT C T +QGG QPDGW+ ACWAF+  +YEQF++G YP+++RWR  L  L  
Sbjct: 65  NAAWTGTSRTACLTAAQGGAQPDGWSGACWAFVNAKYEQFLYGRYPISERWRVDLTALIF 124

Query: 127 SILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISF 185
           + LL P+LIP  P+K LN+IL F +FP+ +FF+L GG  GL  VET LWGGLLVTLV+SF
Sbjct: 125 AALLVPLLIPKIPKKGLNAILFFLVFPVVAFFLLVGGWFGLPYVETPLWGGLLVTLVLSF 184

Query: 186 FGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWD 245
            GI +S+PLGI+LA GR S +PV++   I FIE+ RGVPLVTVLFMAS+MLPLFLP    
Sbjct: 185 VGIAVSLPLGIVLAFGRRSKLPVIKTLSIIFIEMVRGVPLVTVLFMASVMLPLFLPPGVT 244

Query: 246 VDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKR 305
            DKLLRAL+GV+ FASAY+AEV+RGGLQ+I +GQ+E A++LGLSY QK  L+++PQ +K 
Sbjct: 245 FDKLLRALIGVALFASAYMAEVVRGGLQAIPRGQYEGADALGLSYWQKTGLVVLPQALKL 304

Query: 306 VIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIF 365
           VIPGIVNTFIGLFKD+SL+ II MFDLLGIVR NFS++ W S  TP TGLIF GFVFWIF
Sbjct: 305 VIPGIVNTFIGLFKDTSLVYIIGMFDLLGIVRQNFSDANWASPQTPATGLIFAGFVFWIF 364

Query: 366 CFSISLYSVFIEKTLHKGSKK 386
           CF++S YS+F+E+ L  G K+
Sbjct: 365 CFAMSRYSIFMERRLDTGHKR 385


>gi|254713863|ref|ZP_05175674.1| His/Glu/Gln/Arg/opine amino acid ABC transporter permease [Brucella
           ceti M644/93/1]
 gi|254717080|ref|ZP_05178891.1| His/Glu/Gln/Arg/opine amino acid ABC transporter permease [Brucella
           ceti M13/05/1]
 gi|261218891|ref|ZP_05933172.1| polar amino acid ABC transporter [Brucella ceti M13/05/1]
 gi|261321610|ref|ZP_05960807.1| polar amino acid ABC transporter [Brucella ceti M644/93/1]
 gi|260923980|gb|EEX90548.1| polar amino acid ABC transporter [Brucella ceti M13/05/1]
 gi|261294300|gb|EEX97796.1| polar amino acid ABC transporter [Brucella ceti M644/93/1]
          Length = 385

 Score =  457 bits (1175), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 223/381 (58%), Positives = 288/381 (75%), Gaps = 1/381 (0%)

Query: 7   EFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFL 66
           +  YVR +++    PP   +GI  W+  N F TP D  LT   + L+++ +P II W+F+
Sbjct: 5   DLQYVRTQMVDGEAPPRSVQGISHWLRVNLFATPVDAALTIFGLVLVVWFVPPIIEWLFI 64

Query: 67  DAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTG 126
           +A W G++RT C T +QGG QPDGW+ ACWAF+  +YEQF++G YP+++RWR  L  L  
Sbjct: 65  NAAWTGTSRTACLTAAQGGAQPDGWSGACWAFVNAKYEQFLYGRYPISERWRVDLTALIF 124

Query: 127 SILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISF 185
           + LL P+LIP  P+K LN+IL F +FP+ +FF+L GG  GL  VET LWGGLLVTLV+SF
Sbjct: 125 AALLVPLLIPKIPKKGLNAILFFLVFPVVAFFLLVGGWFGLPYVETPLWGGLLVTLVLSF 184

Query: 186 FGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWD 245
            GI +S+PLGI+L LGR S +PV++   I FIE+ RGVPLVTVLFMAS+MLPLFLP    
Sbjct: 185 VGIAVSLPLGIVLVLGRRSKLPVIKTLSIIFIEMVRGVPLVTVLFMASVMLPLFLPPGVT 244

Query: 246 VDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKR 305
            DKLLRAL+GV+ FASAY+AEV+RGGLQ+I +GQ+E A++LGLSY QK  L+++PQ +K 
Sbjct: 245 FDKLLRALIGVALFASAYMAEVVRGGLQAIPRGQYEGADALGLSYWQKTGLVVLPQALKL 304

Query: 306 VIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIF 365
           VIPGIVNTFIGLFKD+SL+ II MFDLLGIVR NFS++ W S  TP TGLIF GFVFWIF
Sbjct: 305 VIPGIVNTFIGLFKDTSLVYIIGMFDLLGIVRQNFSDANWASPQTPATGLIFAGFVFWIF 364

Query: 366 CFSISLYSVFIEKTLHKGSKK 386
           CF++S YS+F+E+ L  G K+
Sbjct: 365 CFAMSRYSIFMERRLDTGHKR 385


>gi|15888896|ref|NP_354577.1| ABC transporter, membrane spanning protein (amino acid)
           [Agrobacterium tumefaciens str. C58]
 gi|15156666|gb|AAK87362.1| ABC transporter, membrane spanning protein (amino acid)
           [Agrobacterium tumefaciens str. C58]
          Length = 385

 Score =  456 bits (1172), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 224/384 (58%), Positives = 286/384 (74%), Gaps = 1/384 (0%)

Query: 4   SCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHW 63
           +     +VR+ +      P    G   W+    F TPKD +LT + + LL + +P II W
Sbjct: 2   TISNHAFVRQTIEDARPAPSSAVGFGHWLRTKLFATPKDTVLTVIALALLAYLVPPIIKW 61

Query: 64  VFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVF 123
           +F+DAVW GS+R  C TVSQGG  PDG + ACWAF+  +  QF+FG YP+ +RWRPILV 
Sbjct: 62  LFIDAVWTGSDRFACLTVSQGGALPDGQSGACWAFVSAKLGQFVFGRYPIDERWRPILVM 121

Query: 124 LTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLV 182
           +T +ILL PMLIP  P K LN++ LF + P  +FF+L GG+ GL  VET LWGGL+VTL+
Sbjct: 122 VTFAILLVPMLIPKAPFKRLNALALFIILPFIAFFLLIGGVFGLPKVETQLWGGLMVTLI 181

Query: 183 ISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPD 242
           +SFFGI +S+P GILLALGR SN+PV++  C+ FIE+ RG+PL+TVLF ASIMLPLFLPD
Sbjct: 182 LSFFGITVSLPFGILLALGRRSNLPVIKMLCVLFIEVIRGIPLITVLFFASIMLPLFLPD 241

Query: 243 TWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQV 302
            W  DK LRAL+GVS F+SAY+AEV+RGGLQ+I KGQ+E A+SLGL+Y QK RLI++PQ 
Sbjct: 242 GWTFDKFLRALVGVSLFSSAYMAEVIRGGLQAIPKGQYEGADSLGLNYWQKTRLIVLPQA 301

Query: 303 IKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVF 362
           +K VIPGIVNTFIGLFKD+SL+SII MFDLLGIV +N +++ W + VT  TG IF GFVF
Sbjct: 302 LKLVIPGIVNTFIGLFKDTSLVSIIGMFDLLGIVTLNQADANWATPVTAMTGYIFAGFVF 361

Query: 363 WIFCFSISLYSVFIEKTLHKGSKK 386
           WIFCF +S YS+F+E+ L  G K+
Sbjct: 362 WIFCFGMSRYSLFMERHLDTGHKR 385


>gi|163843016|ref|YP_001627420.1| His/Glu/Gln/Arg/opine amino acid ABC transporter permease [Brucella
           suis ATCC 23445]
 gi|163673739|gb|ABY37850.1| amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine family [Brucella suis ATCC 23445]
          Length = 385

 Score =  456 bits (1172), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 223/381 (58%), Positives = 289/381 (75%), Gaps = 1/381 (0%)

Query: 7   EFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFL 66
           +  YVR +++    PP   +GI  W+  N F TP D  LT   + L+++ +P II W+F+
Sbjct: 5   DLQYVRTQMVDGETPPRSVQGISHWLRVNLFATPVDAALTIFGLVLVVWFVPPIIEWLFI 64

Query: 67  DAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTG 126
           +A W G++RT C T +QGG QPDGW+ A WAF+  +YEQF++G YP+++RWR  L  L  
Sbjct: 65  NAAWTGTSRTACLTAAQGGAQPDGWSGAYWAFVNAKYEQFLYGRYPISERWRVDLTALIF 124

Query: 127 SILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISF 185
           + LL P+LIP  P+K LN+IL F +FP+ +FF+L GG  GL  VET LWGGLLVTLV+SF
Sbjct: 125 AALLVPLLIPKIPKKGLNAILFFLVFPVVAFFLLVGGWFGLPYVETPLWGGLLVTLVLSF 184

Query: 186 FGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWD 245
            GI +S+PLGI+LALGR S +PV++   I+FIE+ RGVPLVTVLFMAS+MLPLFLP    
Sbjct: 185 VGIAVSLPLGIVLALGRRSKLPVIKTLSISFIEMVRGVPLVTVLFMASVMLPLFLPPGVT 244

Query: 246 VDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKR 305
            DKLLRAL+GV+ FASAY+AEV+RGGLQ+I +GQ+E A++LGLSY QK  L+++PQ +K 
Sbjct: 245 FDKLLRALIGVALFASAYMAEVVRGGLQAIPRGQYEGADALGLSYWQKTGLVVLPQALKL 304

Query: 306 VIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIF 365
           VIPGIVNTFIGLFKD+SL+ II MFDLLGIVR NFS++ W S  TP TGLIF GFVFWIF
Sbjct: 305 VIPGIVNTFIGLFKDTSLVYIIGMFDLLGIVRQNFSDANWASPQTPATGLIFAGFVFWIF 364

Query: 366 CFSISLYSVFIEKTLHKGSKK 386
           CF++S YS+F+E+ L  G K+
Sbjct: 365 CFAMSRYSIFMERRLDTGHKR 385


>gi|306843690|ref|ZP_07476290.1| amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine family [Brucella sp. BO1]
 gi|306276000|gb|EFM57709.1| amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine family [Brucella sp. BO1]
          Length = 385

 Score =  454 bits (1168), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 223/381 (58%), Positives = 288/381 (75%), Gaps = 1/381 (0%)

Query: 7   EFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFL 66
           +  YVR +++    PP   +GI  W+  N F TP D  LT   + L+++ +  II W+F+
Sbjct: 5   DLQYVRTQMVDGEAPPRSVQGISHWLRVNLFATPVDAALTIFGLVLVVWFVLPIIEWLFI 64

Query: 67  DAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTG 126
           +A W G++RT C T +QGG QPDGW+ ACWAF+  +YEQF++G YP+++RWR  L  L  
Sbjct: 65  NAAWTGTSRTACLTAAQGGAQPDGWSGACWAFVNAKYEQFLYGRYPISERWRVDLTALIF 124

Query: 127 SILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISF 185
           + LL P+LIP  P+K LN+IL F +FP+ +FF+L GG  GL  VET LWGGLLVTLV+SF
Sbjct: 125 AALLVPLLIPKVPKKGLNAILFFLVFPVVAFFLLVGGWFGLPYVETPLWGGLLVTLVLSF 184

Query: 186 FGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWD 245
            GI +S+PLGI+LALGR S +PV++   I FIE+ RGVPLVTVLFMAS+MLPLFLP    
Sbjct: 185 VGIAVSLPLGIVLALGRRSKLPVIKTLSIIFIEMVRGVPLVTVLFMASVMLPLFLPPGVT 244

Query: 246 VDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKR 305
            DKLLRAL+GV+ FASAY+AEV+RGGLQ+I +GQ+E A++LGLSY QK  L+++PQ +K 
Sbjct: 245 FDKLLRALIGVALFASAYMAEVVRGGLQAIPRGQYEGADALGLSYWQKTGLVVLPQALKL 304

Query: 306 VIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIF 365
           VIPGIVNTFIGLFKD+SL+ II MFDLLGIVR NFS++ W S  TP TGLIF GFVFWIF
Sbjct: 305 VIPGIVNTFIGLFKDTSLVYIIGMFDLLGIVRQNFSDANWASPQTPATGLIFAGFVFWIF 364

Query: 366 CFSISLYSVFIEKTLHKGSKK 386
           CF++S YS+F+E+ L  G K+
Sbjct: 365 CFAMSRYSIFMERRLDTGHKR 385


>gi|325292972|ref|YP_004278836.1| general L-amino acid transport system permease protein AapM
           [Agrobacterium sp. H13-3]
 gi|325060825|gb|ADY64516.1| general L-amino acid transport system permease protein AapM
           [Agrobacterium sp. H13-3]
          Length = 385

 Score =  452 bits (1164), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 220/384 (57%), Positives = 284/384 (73%), Gaps = 1/384 (0%)

Query: 4   SCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHW 63
           +     +VR  + +    P    GI  W+    F TPKD +LT L I  L + +P I  W
Sbjct: 2   TISNHAFVRHTIEEAKPAPSSAVGISHWLRTKLFATPKDTVLTVLAIAFLAYLLPPIFKW 61

Query: 64  VFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVF 123
           +F+DAVW G++R  C T SQGG   DG + ACWAF+  ++ Q +FG YP+ +RWRPILV 
Sbjct: 62  LFVDAVWTGTDRIACLTASQGGALADGQSGACWAFVSAKFGQIMFGRYPIDERWRPILVM 121

Query: 124 LTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLV 182
           +  +ILL PMLIP  P K LN++ LF + P+ +FF+L GG+ GL +VET LWGGL+VTL+
Sbjct: 122 VMFTILLVPMLIPKAPFKRLNALALFIILPVIAFFLLIGGVFGLPVVETQLWGGLMVTLI 181

Query: 183 ISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPD 242
           +SFFGI +S+P GILLALGR SN+PV++  C+ FIE+ RG+PL+TVLF ASIMLPLFLPD
Sbjct: 182 LSFFGIAVSLPFGILLALGRRSNLPVIKMLCVLFIEVIRGIPLITVLFFASIMLPLFLPD 241

Query: 243 TWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQV 302
            W  DK LRAL+GVS F+SAY+AEV+RGGLQ+I KGQ+E A+SLGL+Y QK RLI++PQ 
Sbjct: 242 GWTFDKFLRALVGVSLFSSAYMAEVIRGGLQAIPKGQYEGADSLGLNYWQKTRLIVLPQA 301

Query: 303 IKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVF 362
           +K VIPGIVNTFIGLFKD+SL+SII MFDLLGIV +N S++ W + VT  TG IF GF+F
Sbjct: 302 LKLVIPGIVNTFIGLFKDTSLVSIIGMFDLLGIVTLNQSDANWATPVTAMTGYIFAGFIF 361

Query: 363 WIFCFSISLYSVFIEKTLHKGSKK 386
           WIFCF +S YS+F+E+ L  G K+
Sbjct: 362 WIFCFGMSRYSLFMERHLDTGHKR 385


>gi|319784338|ref|YP_004143814.1| polar amino acid ABC transporter inner membrane subunit
           [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317170226|gb|ADV13764.1| polar amino acid ABC transporter, inner membrane subunit
           [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 385

 Score =  446 bits (1148), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 215/382 (56%), Positives = 283/382 (74%), Gaps = 1/382 (0%)

Query: 6   KEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVF 65
            +  +VR  ++     P    G+ AW+ KN   +  D +LT + I L+   +P II+W F
Sbjct: 4   HDMSWVRTEMVLAQPAPASVTGLGAWVRKNLIASTGDTILTIVGIALVAMILPQIINWAF 63

Query: 66  LDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLT 125
           ++AVW G +RTVC TV+QGGIQPDGW  ACWAF+  ++ QF+ G YP+ +RWRPILV + 
Sbjct: 64  INAVWTGPDRTVCATVAQGGIQPDGWTGACWAFVNAKFGQFMLGRYPIEERWRPILVAIL 123

Query: 126 GSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVIS 184
              LL PML+P  PRK LN++LLF + PI +F +L GG+ GL  VETSLWGGLLVTL +S
Sbjct: 124 FVALLVPMLMPKVPRKGLNAVLLFFVLPIVAFVLLVGGMFGLPHVETSLWGGLLVTLSLS 183

Query: 185 FFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTW 244
           F GI +S+PLGI+LALGR S +P+++  C+ FIE  RG+PL+TVLF AS+MLPLFLP+  
Sbjct: 184 FVGIAVSLPLGIVLALGRRSKMPIIKTLCVVFIETVRGIPLITVLFFASVMLPLFLPEGV 243

Query: 245 DVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIK 304
             DK LRAL+GVS FA+AY+AEV+RGGLQ+I KGQ+E A+SLGL Y QKM  I+MPQ +K
Sbjct: 244 SFDKFLRALIGVSLFAAAYMAEVVRGGLQAIPKGQYEGADSLGLGYWQKMYFIVMPQALK 303

Query: 305 RVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWI 364
            VIPGIVNTFIG+FKD+SL+ II+MFDLLGIV+ NFS++ W ++ T  +GLIF  FVFW+
Sbjct: 304 LVIPGIVNTFIGMFKDTSLVIIISMFDLLGIVKQNFSDANWATAQTARSGLIFAAFVFWL 363

Query: 365 FCFSISLYSVFIEKTLHKGSKK 386
           FCF +S YS++ E+ L  G K+
Sbjct: 364 FCFGMSRYSMYTERRLDTGHKR 385


>gi|150396325|ref|YP_001326792.1| polar amino acid ABC transporter inner membrane subunit
           [Sinorhizobium medicae WSM419]
 gi|150027840|gb|ABR59957.1| polar amino acid ABC transporter, inner membrane subunit
           [Sinorhizobium medicae WSM419]
          Length = 384

 Score =  445 bits (1145), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 225/383 (58%), Positives = 291/383 (75%), Gaps = 1/383 (0%)

Query: 4   SCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHW 63
           S ++  +VR  +++ S  P  +RG  +W+ +N F TPKD +LT + + +L + +P  I W
Sbjct: 2   STQQATFVRASMIEASPAPSLERGAASWLRRNLFATPKDSVLTIISLLILAWLVPPAIQW 61

Query: 64  VFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVF 123
           +F+DA W G  R VC T+SQGG QP+GW+ ACWAF+  ++ QF+FG YP+ +RWRP LV 
Sbjct: 62  LFIDAAWSGGGRGVCATLSQGGSQPEGWSGACWAFVNAKFAQFLFGRYPLDERWRPALVG 121

Query: 124 LTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLV 182
           +   +LL PMLIP  P K LN++LL G  P+ +  +L GG  GL+ VET LWGGL+VTLV
Sbjct: 122 ILFVLLLVPMLIPRIPYKGLNALLLLGALPVLAAILLPGGWFGLTYVETPLWGGLMVTLV 181

Query: 183 ISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPD 242
           +SF GI +S+PLGILLALGR SN+PV++  C  FIE+ RGVPL+TVLFMAS+MLPLFLP 
Sbjct: 182 LSFVGIAVSLPLGILLALGRRSNMPVIKMLCTAFIEVIRGVPLITVLFMASVMLPLFLPQ 241

Query: 243 TWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQV 302
               DK LRAL+GVS FASAY+AEV+RGGLQ+I KGQ+E A+SLGLSY QKM  I++PQ 
Sbjct: 242 GVTFDKFLRALIGVSLFASAYMAEVVRGGLQAIPKGQYEGADSLGLSYWQKMGFIVLPQA 301

Query: 303 IKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVF 362
           +K VIPGIVNTFIGLFKD+SL+SII MFDLLGIVR+NFS++ W S+VTP TGLIF GFVF
Sbjct: 302 LKLVIPGIVNTFIGLFKDTSLVSIIGMFDLLGIVRLNFSDTNWASAVTPLTGLIFAGFVF 361

Query: 363 WIFCFSISLYSVFIEKTLHKGSK 385
           W+FCF +S YS F+E+ L +  +
Sbjct: 362 WLFCFGMSRYSGFMERLLDRSQR 384


>gi|150378347|ref|YP_001314941.1| polar amino acid ABC transporter, inner membrane subunit
           [Sinorhizobium medicae WSM419]
 gi|150032894|gb|ABR65008.1| polar amino acid ABC transporter, inner membrane subunit
           [Sinorhizobium medicae WSM419]
          Length = 384

 Score =  445 bits (1145), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 225/383 (58%), Positives = 291/383 (75%), Gaps = 1/383 (0%)

Query: 4   SCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHW 63
           S ++  +VR  +++ S  P  +RG  +W+ +N F TPKD +LT + + +L + +P  I W
Sbjct: 2   STQQATFVRASMIEASPAPSLERGAASWLRRNLFATPKDSVLTIISLLILTWLVPPAIQW 61

Query: 64  VFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVF 123
           +F+DA W G  R VC T+SQGG QP+GW+ ACWAF+  ++ QF+FG YP+ +RWRP LV 
Sbjct: 62  LFIDAAWSGGGRGVCATLSQGGSQPEGWSGACWAFVNAKFAQFLFGRYPLDERWRPALVG 121

Query: 124 LTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLV 182
           +   +LL PMLIP  P K LN++LL G  P+ +  +L GG  GL+ VET LWGGL+VTLV
Sbjct: 122 ILFVLLLVPMLIPRIPYKGLNALLLLGALPVLAAILLPGGWFGLTYVETPLWGGLMVTLV 181

Query: 183 ISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPD 242
           +SF GI +S+PLGILLALGR SN+PV++  C  FIE+ RGVPL+TVLFMAS+MLPLFLP 
Sbjct: 182 LSFVGIAVSLPLGILLALGRRSNMPVIKMLCTAFIEVIRGVPLITVLFMASVMLPLFLPQ 241

Query: 243 TWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQV 302
               DK LRAL+GVS FASAY+AEV+RGGLQ+I KGQ+E A+SLGLSY QKM  I++PQ 
Sbjct: 242 GVTFDKFLRALIGVSLFASAYMAEVVRGGLQAIPKGQYEGADSLGLSYWQKMGFIVLPQA 301

Query: 303 IKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVF 362
           +K VIPGIVNTFIGLFKD+SL+SII MFDLLGIVR+NFS++ W S+VTP TGLIF GFVF
Sbjct: 302 LKLVIPGIVNTFIGLFKDTSLVSIIGMFDLLGIVRLNFSDTNWASAVTPLTGLIFAGFVF 361

Query: 363 WIFCFSISLYSVFIEKTLHKGSK 385
           W+FCF +S YS F+E+ L +  +
Sbjct: 362 WLFCFGMSRYSGFMERLLDRSQR 384


>gi|222148882|ref|YP_002549839.1| ABC transporter membrane spanning protein (amino acid)
           [Agrobacterium vitis S4]
 gi|221735868|gb|ACM36831.1| ABC transporter membrane spanning protein (amino acid)
           [Agrobacterium vitis S4]
          Length = 395

 Score =  445 bits (1145), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 224/377 (59%), Positives = 288/377 (76%)

Query: 10  YVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAV 69
           +VR  ++  S  P  Q G  AW+ KN   TPKD++LT L +  L + +PG+I+W+F+ AV
Sbjct: 19  FVRTEMVSASPAPAGQIGTTAWVRKNLIATPKDVVLTLLALAFLAYVLPGLINWLFVHAV 78

Query: 70  WIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSIL 129
           W G+ R  C TVSQGG  PDG   ACWAF+  +++QFIFG YP  + WRP+ V +  ++L
Sbjct: 79  WSGAGRIACLTVSQGGALPDGSAGACWAFVGAKFQQFIFGRYPSEEIWRPLTVMVLFAVL 138

Query: 130 LTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGII 189
           L PMLIP  P K  N++LLF + P+ SFF+L GG GL  VET+ WGGL+VTL++SFFGI 
Sbjct: 139 LAPMLIPKAPFKGTNALLLFLVLPVVSFFLLTGGFGLEHVETARWGGLMVTLILSFFGIA 198

Query: 190 ISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKL 249
           +S+P+GI+LALGR S +PV++  C+ FIE+ RGVPL+TVLFMAS+MLPLFLPD W  DKL
Sbjct: 199 VSLPVGIMLALGRRSTMPVIKMLCVIFIEVVRGVPLITVLFMASVMLPLFLPDGWSFDKL 258

Query: 250 LRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPG 309
           LRAL+GVS F+SAY+AEV+RGGLQ+I KGQFE A+SLGLSY QK+RLI++PQ IK VIPG
Sbjct: 259 LRALVGVSIFSSAYMAEVIRGGLQAIPKGQFEGADSLGLSYWQKIRLIVLPQAIKLVIPG 318

Query: 310 IVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSI 369
           IVNTFIGLFKD+SL+SII MFDLLGIV +N S+S W +  T  TGL+F GF++W+FCFS+
Sbjct: 319 IVNTFIGLFKDTSLVSIIGMFDLLGIVILNLSDSNWATPETAVTGLVFAGFIYWLFCFSM 378

Query: 370 SLYSVFIEKTLHKGSKK 386
           S YS F+E+ L  G K 
Sbjct: 379 SRYSYFMERHLDTGHKH 395


>gi|307316994|ref|ZP_07596435.1| polar amino acid ABC transporter, inner membrane subunit
           [Sinorhizobium meliloti AK83]
 gi|306897082|gb|EFN27827.1| polar amino acid ABC transporter, inner membrane subunit
           [Sinorhizobium meliloti AK83]
          Length = 384

 Score =  445 bits (1144), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 224/383 (58%), Positives = 289/383 (75%), Gaps = 1/383 (0%)

Query: 4   SCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHW 63
           S  +  +VR  +++ S  P  + G+++W+ KN F TPKD  LT + + +L + +P  I W
Sbjct: 2   STNQASFVRASMIEASPAPSLESGVVSWLRKNLFATPKDTALTIISLLILAWLVPPAIQW 61

Query: 64  VFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVF 123
           +F+DA W G  R VC T+SQGG QP+GW+ ACWAF+  ++ QF+FG YP+ +RWRP LV 
Sbjct: 62  LFIDAAWSGGGRGVCATLSQGGSQPEGWSGACWAFVNAKFAQFLFGRYPLDERWRPALVG 121

Query: 124 LTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLV 182
           +   +LL PMLIP  P K LN++LL    PI S  +L GG  GL+ VET LWGGL+VTLV
Sbjct: 122 ILFVLLLVPMLIPRIPYKGLNALLLLVALPILSAILLPGGWFGLTYVETPLWGGLMVTLV 181

Query: 183 ISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPD 242
           +SF GI +S+PLGILLALGR SN+PV++  C  FIE+ RGVPL+TVLFMAS+MLPLFLP 
Sbjct: 182 LSFVGIAVSLPLGILLALGRRSNMPVIKMLCTVFIEVIRGVPLITVLFMASVMLPLFLPQ 241

Query: 243 TWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQV 302
               DK LRAL+GVS FASAY+AEV+RGGLQ+I KGQ+E A+SLGLS+ QKM  I++PQ 
Sbjct: 242 GVTFDKFLRALIGVSLFASAYMAEVVRGGLQAIPKGQYEGADSLGLSFWQKMGFIVLPQA 301

Query: 303 IKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVF 362
           +K VIPGIVNTFIGLFKD+SL+SII MFDLLGIVR+NFS++ W ++VTP TGLIF GFVF
Sbjct: 302 LKLVIPGIVNTFIGLFKDTSLVSIIGMFDLLGIVRLNFSDTNWATAVTPLTGLIFAGFVF 361

Query: 363 WIFCFSISLYSVFIEKTLHKGSK 385
           W+FCF +S YS F+E+ L +  +
Sbjct: 362 WLFCFGMSRYSGFMERLLDRSQR 384


>gi|13476743|ref|NP_108312.1| amino acid ABC transporter, permease protein [Mesorhizobium loti
           MAFF303099]
 gi|14027504|dbj|BAB53773.1| amino acid ABC transporter, permease protein [Mesorhizobium loti
           MAFF303099]
          Length = 385

 Score =  444 bits (1143), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 216/382 (56%), Positives = 282/382 (73%), Gaps = 1/382 (0%)

Query: 6   KEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVF 65
            +  +VR  +      P   RG +AW+ KN  GT  D +LT L I ++ + +P +I W F
Sbjct: 4   HDMSWVRTEMALAQSAPTSVRGPMAWVRKNLVGTVGDTILTILGIVIVAWILPQVIGWAF 63

Query: 66  LDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLT 125
           ++AVW G +RTVC TV+QGGIQPDGW  ACWAF+  ++ QF+FG YP+ +RWRPILV + 
Sbjct: 64  INAVWTGPDRTVCATVAQGGIQPDGWTGACWAFVNAKFGQFMFGTYPIEERWRPILVAIL 123

Query: 126 GSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVIS 184
              LL PMLIP  PRK LN+ILLF + PI SFF+L GG+ GL  VETS WGGLLVTL +S
Sbjct: 124 FVALLVPMLIPRVPRKGLNAILLFLVLPIVSFFLLIGGVFGLPHVETSRWGGLLVTLSLS 183

Query: 185 FFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTW 244
           F GI +S+PLG +LALGR S +P+++  C+ FIE  RG+PL+TVLF  S+MLPLFLP   
Sbjct: 184 FVGIAVSLPLGTVLALGRRSKMPIVKTLCVVFIETVRGIPLITVLFFVSVMLPLFLPAGV 243

Query: 245 DVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIK 304
             DK LRAL+GVS FA+AY+AEV+RGGLQ+I KGQ+E A+SLGL Y QKM LI++PQ ++
Sbjct: 244 TFDKFLRALIGVSLFAAAYMAEVVRGGLQAIPKGQYEGADSLGLGYWQKMGLIVLPQALR 303

Query: 305 RVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWI 364
            VIPGIVNTFIG+FKD+SL+ II+MFDLLG+V+ NFS++ W +  T  +GL+F  FVFW+
Sbjct: 304 LVIPGIVNTFIGMFKDTSLVLIISMFDLLGVVKQNFSDANWATPQTARSGLVFAAFVFWL 363

Query: 365 FCFSISLYSVFIEKTLHKGSKK 386
           FCF +S YS++ E+ L  G K+
Sbjct: 364 FCFGMSRYSMYTERRLDTGHKR 385


>gi|15965229|ref|NP_385582.1| general L-amino acid transport permease ABC transporter protein
           [Sinorhizobium meliloti 1021]
 gi|307309252|ref|ZP_07588920.1| polar amino acid ABC transporter, inner membrane subunit
           [Sinorhizobium meliloti BL225C]
 gi|15074409|emb|CAC46055.1| Probable general L-amino acid transport permease ABC transporter
           [Sinorhizobium meliloti 1021]
 gi|306900253|gb|EFN30870.1| polar amino acid ABC transporter, inner membrane subunit
           [Sinorhizobium meliloti BL225C]
          Length = 384

 Score =  443 bits (1139), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 224/383 (58%), Positives = 288/383 (75%), Gaps = 1/383 (0%)

Query: 4   SCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHW 63
           S  +  +VR  +++ S  P  + G ++W+ KN F TPKD  LT + + +L + +P  I W
Sbjct: 2   STNQASFVRASMIEASPAPSLESGAVSWLRKNLFATPKDTALTIISLLILAWLVPPAIQW 61

Query: 64  VFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVF 123
           +F+DA W G  R VC T+SQGG QP+GW+ ACWAF+  ++ QF+FG YP+ +RWRP LV 
Sbjct: 62  LFIDAAWSGGGRGVCATLSQGGSQPEGWSGACWAFVNAKFAQFLFGRYPLDERWRPALVG 121

Query: 124 LTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLV 182
           +   +LL PMLIP  P K LN++LL    PI S  +L GG  GL+ VET LWGGL+VTLV
Sbjct: 122 ILFVLLLVPMLIPRIPYKGLNALLLLVALPILSAILLPGGWFGLTYVETPLWGGLMVTLV 181

Query: 183 ISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPD 242
           +SF GI +S+PLGILLALGR SN+PV++  C  FIE+ RGVPL+TVLFMAS+MLPLFLP 
Sbjct: 182 LSFVGIAVSLPLGILLALGRRSNMPVIKMLCTVFIEVIRGVPLITVLFMASVMLPLFLPQ 241

Query: 243 TWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQV 302
               DK LRAL+GVS FASAY+AEV+RGGLQ+I KGQ+E A+SLGLS+ QKM  I++PQ 
Sbjct: 242 GVTFDKFLRALIGVSLFASAYMAEVVRGGLQAIPKGQYEGADSLGLSFWQKMGFIVLPQA 301

Query: 303 IKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVF 362
           +K VIPGIVNTFIGLFKD+SL+SII MFDLLGIVR+NFS++ W ++VTP TGLIF GFVF
Sbjct: 302 LKLVIPGIVNTFIGLFKDTSLVSIIGMFDLLGIVRLNFSDTNWATAVTPLTGLIFAGFVF 361

Query: 363 WIFCFSISLYSVFIEKTLHKGSK 385
           W+FCF +S YS F+E+ L +  +
Sbjct: 362 WLFCFGMSRYSGFMERLLDRSQR 384


>gi|260463339|ref|ZP_05811540.1| polar amino acid ABC transporter, inner membrane subunit
           [Mesorhizobium opportunistum WSM2075]
 gi|259030929|gb|EEW32204.1| polar amino acid ABC transporter, inner membrane subunit
           [Mesorhizobium opportunistum WSM2075]
          Length = 385

 Score =  437 bits (1125), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 215/382 (56%), Positives = 284/382 (74%), Gaps = 1/382 (0%)

Query: 6   KEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVF 65
            +  +VR  +      P    G +AW+ KN  GT  D +LT L I ++ + +P +I W F
Sbjct: 4   HDMSWVRTEMALAQPAPASVSGPMAWVRKNLVGTVGDTILTILGIIIVAWVLPQVIGWAF 63

Query: 66  LDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLT 125
           ++AVW G +RTVC TV+QGGIQPDGW+ ACWAF+  ++ QF+FG YP+ +RWRPI+V + 
Sbjct: 64  INAVWTGPDRTVCATVAQGGIQPDGWSGACWAFVNAKFGQFMFGTYPVEERWRPIVVAIL 123

Query: 126 GSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVIS 184
            + LL PMLIP  PRK LN+ILLF + PI SFF+L GG+ GL  VETS WGGLL+TL +S
Sbjct: 124 FAALLIPMLIPRVPRKGLNAILLFLVLPIVSFFLLVGGMFGLPHVETSRWGGLLITLSLS 183

Query: 185 FFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTW 244
           F GI +S+PLG +LALGR S +P+++  C+ FIE  RG+PL+TVLF  S+MLPLFLP   
Sbjct: 184 FVGIAVSLPLGTVLALGRRSKMPIVKMLCVIFIEAVRGIPLITVLFFVSVMLPLFLPAGV 243

Query: 245 DVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIK 304
             DK LRAL+GVS FA+AY+AEV+RGGLQ+I KGQ+E A+SLGL Y QKM LI++PQ +K
Sbjct: 244 TFDKYLRALIGVSLFAAAYMAEVVRGGLQAIPKGQYEGADSLGLGYWQKMSLIVLPQALK 303

Query: 305 RVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWI 364
            VIPGIVNTFIG+FKD+SL+ II+MFDLLGIV+ NFS++ W ++ T  +GL+F  FVFW+
Sbjct: 304 LVIPGIVNTFIGMFKDTSLVLIISMFDLLGIVKQNFSDANWATAQTAKSGLVFAAFVFWL 363

Query: 365 FCFSISLYSVFIEKTLHKGSKK 386
           FCF +S YS++ E+ L  G K+
Sbjct: 364 FCFGMSRYSMYTERRLDTGHKR 385


>gi|82699627|ref|YP_414201.1| binding-protein dependent transport system inner membrane protein
           [Brucella melitensis biovar Abortus 2308]
 gi|254689009|ref|ZP_05152263.1| binding-protein dependent transport system inner membrane protein
           [Brucella abortus bv. 6 str. 870]
 gi|254697144|ref|ZP_05158972.1| binding-protein dependent transport system inner membrane protein
           [Brucella abortus bv. 2 str. 86/8/59]
 gi|254707028|ref|ZP_05168856.1| binding-protein dependent transport system inner membrane protein
           [Brucella pinnipedialis M163/99/10]
 gi|254730040|ref|ZP_05188618.1| binding-protein dependent transport system inner membrane protein
           [Brucella abortus bv. 4 str. 292]
 gi|256113278|ref|ZP_05454146.1| binding-protein dependent transport system inner membrane protein
           [Brucella melitensis bv. 3 str. Ether]
 gi|256257259|ref|ZP_05462795.1| binding-protein dependent transport system inner membrane protein
           [Brucella abortus bv. 9 str. C68]
 gi|256264231|ref|ZP_05466763.1| amino acid ABC transporter permease [Brucella melitensis bv. 2 str.
           63/9]
 gi|260545547|ref|ZP_05821288.1| polar amino acid ABC transporter [Brucella abortus NCTC 8038]
 gi|260754502|ref|ZP_05866850.1| ABC-type arginine transport system, permease component [Brucella
           abortus bv. 6 str. 870]
 gi|260757723|ref|ZP_05870071.1| ABC transporter permease [Brucella abortus bv. 4 str. 292]
 gi|260761548|ref|ZP_05873891.1| ABC transporter permease [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883531|ref|ZP_05895145.1| polar amino acid ABC transporter [Brucella abortus bv. 9 str. C68]
 gi|265994690|ref|ZP_06107247.1| polar amino acid ABC transporter [Brucella melitensis bv. 3 str.
           Ether]
 gi|82615728|emb|CAJ10724.1| Binding-protein-dependent transport systems inner membrane
           component:Tetracycline resistance protein [Brucella
           melitensis biovar Abortus 2308]
 gi|260096954|gb|EEW80829.1| polar amino acid ABC transporter [Brucella abortus NCTC 8038]
 gi|260668041|gb|EEX54981.1| ABC transporter permease [Brucella abortus bv. 4 str. 292]
 gi|260671980|gb|EEX58801.1| ABC transporter permease [Brucella abortus bv. 2 str. 86/8/59]
 gi|260674610|gb|EEX61431.1| ABC-type arginine transport system, permease component [Brucella
           abortus bv. 6 str. 870]
 gi|260873059|gb|EEX80128.1| polar amino acid ABC transporter [Brucella abortus bv. 9 str. C68]
 gi|262765803|gb|EEZ11592.1| polar amino acid ABC transporter [Brucella melitensis bv. 3 str.
           Ether]
 gi|263094477|gb|EEZ18299.1| amino acid ABC transporter permease [Brucella melitensis bv. 2 str.
           63/9]
 gi|326408767|gb|ADZ65832.1| His/Glu/Gln/Arg/opine amino acid ABC transporter permease [Brucella
           melitensis M28]
 gi|326538485|gb|ADZ86700.1| binding-protein-dependent transport systems inner membrane
           component:Tetracycline resistance protein [Brucella
           melitensis M5-90]
          Length = 343

 Score =  430 bits (1106), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 210/343 (61%), Positives = 270/343 (78%), Gaps = 1/343 (0%)

Query: 45  LTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYE 104
           +T   + L+++ +P II W+F++A W G++RT C T +QGG QPDGW+ ACWAF+  +YE
Sbjct: 1   MTIFGLVLVVWFVPPIIEWLFINAAWTGTSRTACLTAAQGGAQPDGWSGACWAFVNAKYE 60

Query: 105 QFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGG- 163
           QF++G YP+++RWR  L  L  + LL P+LIP  P+K LN+IL F +FP+ +FF+L GG 
Sbjct: 61  QFLYGRYPISERWRVDLTALIFAALLVPLLIPKIPKKGLNAILFFLVFPVVAFFLLVGGW 120

Query: 164 LGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGV 223
            GL  VET LWGGLLVTLV+SF GI +S+PLGI+LALGR S +PV++   I FIE+ RGV
Sbjct: 121 FGLPYVETPLWGGLLVTLVLSFVGIAVSLPLGIVLALGRRSKLPVIKTLSIIFIEMVRGV 180

Query: 224 PLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAA 283
           PLVTVLFMAS+MLPLFLP     DKLLRAL+GV+ FASAY+AEV+RGGLQ+I +GQ+E A
Sbjct: 181 PLVTVLFMASVMLPLFLPPGVTFDKLLRALIGVALFASAYMAEVVRGGLQAIPRGQYEGA 240

Query: 284 NSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSES 343
           ++LGLSY QK  L+++PQ +K VIPGIVNTFIGLFKD+SL+ II MFDLLGIVR NFS++
Sbjct: 241 DALGLSYWQKTGLVVLPQALKLVIPGIVNTFIGLFKDTSLVYIIGMFDLLGIVRQNFSDA 300

Query: 344 TWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
            W S  TP TGLIF GFVFWIFCF++S YS+F+E+ L  G K+
Sbjct: 301 NWASPQTPATGLIFAGFVFWIFCFAMSRYSIFMERRLDTGHKR 343


>gi|261314497|ref|ZP_05953694.1| polar amino acid ABC transporter [Brucella pinnipedialis
           M163/99/10]
 gi|261303523|gb|EEY07020.1| polar amino acid ABC transporter [Brucella pinnipedialis
           M163/99/10]
          Length = 357

 Score =  429 bits (1102), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 209/338 (61%), Positives = 268/338 (79%), Gaps = 1/338 (0%)

Query: 50  ICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFG 109
           + L+++ +P II W+F++A W G++RT C T +QGG QPDGW+ ACWAF+  +YEQF++G
Sbjct: 20  LVLVVWFVPPIIEWLFINAAWTGTSRTACLTAAQGGAQPDGWSGACWAFVNAKYEQFLYG 79

Query: 110 NYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGG-LGLSI 168
            YP+++RWR  L  L  + LL P+LIP  P+K LN+IL F +FP+ +FF+L GG  GL  
Sbjct: 80  RYPISERWRVDLTALIFAALLVPLLIPKIPKKGLNAILFFLVFPVVAFFLLVGGWFGLPY 139

Query: 169 VETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTV 228
           VET LWGGLLVTLV+SF GI +S+PLGI+LALGR S +PV++   I FIE+ RGVPLVTV
Sbjct: 140 VETPLWGGLLVTLVLSFVGIAVSLPLGIVLALGRRSKLPVIKTLSIIFIEMVRGVPLVTV 199

Query: 229 LFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGL 288
           LFMAS+MLPLFLP     DKLLRAL+GV+ FASAY+AEV+RGGLQ+I +GQ+E A++LGL
Sbjct: 200 LFMASVMLPLFLPPGVTFDKLLRALIGVALFASAYMAEVVRGGLQAIPRGQYEGADALGL 259

Query: 289 SYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISS 348
           SY QK  L+++PQ +K VIPGIVNTFIGLFKD+SL+ II MFDLLGIVR NFS++ W S 
Sbjct: 260 SYWQKTGLVVLPQALKLVIPGIVNTFIGLFKDTSLVYIIGMFDLLGIVRQNFSDANWASP 319

Query: 349 VTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
            TP TGLIF GFVFWIFCF++S YS+F+E+ L  G K+
Sbjct: 320 QTPATGLIFAGFVFWIFCFAMSRYSIFMERRLDTGHKR 357


>gi|254693492|ref|ZP_05155320.1| binding-protein dependent transport system inner membrane protein
           [Brucella abortus bv. 3 str. Tulya]
 gi|261213750|ref|ZP_05928031.1| ABC-type amino acid transporter permease [Brucella abortus bv. 3
           str. Tulya]
 gi|260915357|gb|EEX82218.1| ABC-type amino acid transporter permease [Brucella abortus bv. 3
           str. Tulya]
          Length = 343

 Score =  427 bits (1099), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 209/343 (60%), Positives = 269/343 (78%), Gaps = 1/343 (0%)

Query: 45  LTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYE 104
           +T   + L+++ +P II W+F++A W G++RT C T +QGG QPDGW+ ACWAF+  +YE
Sbjct: 1   MTIFGLVLVVWFVPPIIEWLFINAAWTGTSRTACLTAAQGGAQPDGWSGACWAFVNAKYE 60

Query: 105 QFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGG- 163
           QF++G YP+++RWR  L  L  + LL P+LIP  P+K LN+IL F +FP+ +FF+L GG 
Sbjct: 61  QFLYGRYPISERWRVDLTALIFAALLVPLLIPKIPKKGLNAILFFLVFPVVAFFLLVGGW 120

Query: 164 LGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGV 223
            GL  VET LWGGLLVT V+SF GI +S+PLGI+LALGR S +PV++   I FIE+ RGV
Sbjct: 121 FGLPYVETPLWGGLLVTQVLSFVGIAVSLPLGIVLALGRRSKLPVIKTLSIIFIEMVRGV 180

Query: 224 PLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAA 283
           PLVTVLFMAS+MLPLFLP     DKLLRAL+GV+ FASAY+AEV+RGGLQ+I +GQ+E A
Sbjct: 181 PLVTVLFMASVMLPLFLPPGVTFDKLLRALIGVALFASAYMAEVVRGGLQAIPRGQYEGA 240

Query: 284 NSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSES 343
           ++LGLSY QK  L+++PQ +K VIPGIVNTFIGLFKD+SL+ II MFDLLGIVR NFS++
Sbjct: 241 DALGLSYWQKTGLVVLPQALKLVIPGIVNTFIGLFKDTSLVYIIGMFDLLGIVRQNFSDA 300

Query: 344 TWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
            W S  TP TGLIF GFVFWIFCF++S YS+F+E+ L  G K+
Sbjct: 301 NWASPQTPATGLIFAGFVFWIFCFAMSRYSIFMERRLDTGHKR 343


>gi|17987492|ref|NP_540126.1| general L-amino acid transport system permease protein AAPM
           [Brucella melitensis bv. 1 str. 16M]
 gi|256044434|ref|ZP_05447338.1| general L-amino acid transport system permease protein AAPM
           [Brucella melitensis bv. 1 str. Rev.1]
 gi|260563785|ref|ZP_05834271.1| polar amino acid ABC transporter [Brucella melitensis bv. 1 str.
           16M]
 gi|265990854|ref|ZP_06103411.1| amino acid ABC transporter permease [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|17983190|gb|AAL52390.1| general l-amino acid transport system permease protein aapm
           [Brucella melitensis bv. 1 str. 16M]
 gi|260153801|gb|EEW88893.1| polar amino acid ABC transporter [Brucella melitensis bv. 1 str.
           16M]
 gi|263001638|gb|EEZ14213.1| amino acid ABC transporter permease [Brucella melitensis bv. 1 str.
           Rev.1]
          Length = 343

 Score =  427 bits (1097), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 209/343 (60%), Positives = 269/343 (78%), Gaps = 1/343 (0%)

Query: 45  LTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYE 104
           +T   + L+++ +P II W+F++A W G++RT C T +QGG QPDGW+ ACWAF+  +YE
Sbjct: 1   MTIFGLVLVVWFVPPIIEWLFINAAWTGTSRTACLTAAQGGAQPDGWSGACWAFVNAKYE 60

Query: 105 QFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGG- 163
           QF++G YP+++RWR  L  L  + LL P+LIP  P+K LN+IL F +FP+ +FF+L GG 
Sbjct: 61  QFLYGRYPISERWRVDLTALIFAALLVPLLIPKIPKKGLNAILFFLVFPVVAFFLLVGGW 120

Query: 164 LGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGV 223
            GL  VET LWGGLLVTLV+SF GI +S+PLGI+ ALGR S +PV++   I FIE+ RGV
Sbjct: 121 FGLPYVETPLWGGLLVTLVLSFVGIAVSLPLGIVPALGRRSKLPVIKTLSIIFIEMVRGV 180

Query: 224 PLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAA 283
           PLVTVLFMAS+MLPLFLP     DKLLRAL+GV+ FASAY+AEV+RGGLQ+I +GQ+E A
Sbjct: 181 PLVTVLFMASVMLPLFLPPGVTFDKLLRALIGVALFASAYMAEVVRGGLQAIPRGQYEGA 240

Query: 284 NSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSES 343
           ++LGLSY QK  L+++PQ +K VIPGIVNTFIGLFKD+SL+ II MFDLLGIVR NFS++
Sbjct: 241 DALGLSYWQKTGLVVLPQALKLVIPGIVNTFIGLFKDTSLVYIIGMFDLLGIVRQNFSDA 300

Query: 344 TWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
            W S  TP TGLIF GFVFWIFCF++S YS+F+E+ L  G K+
Sbjct: 301 NWASPQTPATGLIFAGFVFWIFCFAMSRYSIFMERRLDTGHKR 343


>gi|163760313|ref|ZP_02167396.1| amino acid ABC transporter, permease protein [Hoeflea phototrophica
           DFL-43]
 gi|162282712|gb|EDQ33000.1| amino acid ABC transporter, permease protein [Hoeflea phototrophica
           DFL-43]
          Length = 377

 Score =  390 bits (1003), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 205/389 (52%), Positives = 268/389 (68%), Gaps = 15/389 (3%)

Query: 1   MIDSCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGI 60
           M  + K   YVR        PPV   G+  W+ +N F + +D +LT L   LLL+ +P I
Sbjct: 1   MDANQKTVAYVRSEESPRMAPPVTSSGVAGWLKENLFASTRDTVLTILTFLLLLWMVPPI 60

Query: 61  IHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPI 120
           + W FL AVW G +R  C     G         ACWAF+  ++ QFI+G YP+ +RWR  
Sbjct: 61  VDWAFLSAVWTGESREDCIVPGAG---------ACWAFVEAKFGQFIYGRYPVEERWR-- 109

Query: 121 LVFLTGSIL---LTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGL 177
            V LTG +L   L P+ IPS P K  N++ L  +FPI  F +L G LGL+ VET+LWGGL
Sbjct: 110 -VDLTGLLLIAGLVPIAIPSLPYKRENALYLLVVFPILGFILLTGQLGLAPVETALWGGL 168

Query: 178 LVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLP 237
           LVTLV++  GI++S PLGILLALGR S +P+++  CI FIE +RGVPL+TVLFM+S+MLP
Sbjct: 169 LVTLVVAIVGIVVSFPLGILLALGRRSEMPIVKMFCIIFIEFWRGVPLITVLFMSSVMLP 228

Query: 238 LFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLI 297
           LFLP+    DKLLRAL+GV+ F+SAY+AEV+RGGLQ+I KGQ+EAAN++ L++ Q  RL+
Sbjct: 229 LFLPEGVTFDKLLRALIGVALFSSAYMAEVIRGGLQAIPKGQYEAANAMALTFWQGTRLV 288

Query: 298 IMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIF 357
           IMPQ +K VIPGIVNTFIGLFKD+SL+ II +FDLLGIV+ N ++  WIS  TP TG +F
Sbjct: 289 IMPQALKLVIPGIVNTFIGLFKDTSLVLIIGLFDLLGIVQQNMNDPNWISPATPATGFVF 348

Query: 358 IGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
              VF+IFCF +S YS ++E+ L  G K 
Sbjct: 349 AALVFFIFCFGMSRYSAYMERRLDTGHKS 377


>gi|189023947|ref|YP_001934715.1| Tetracycline resistance protein [Brucella abortus S19]
 gi|189019519|gb|ACD72241.1| Tetracycline resistance protein [Brucella abortus S19]
          Length = 289

 Score =  364 bits (935), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 183/286 (63%), Positives = 229/286 (80%), Gaps = 1/286 (0%)

Query: 102 RYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLY 161
           +YEQF++G YP+++RWR  L  L  + LL P+LIP  P+K LN+IL F +FP+ +FF+L 
Sbjct: 4   KYEQFLYGRYPISERWRVDLTALIFAALLVPLLIPKIPKKGLNAILFFLVFPVVAFFLLV 63

Query: 162 GG-LGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELF 220
           GG  GL  VET LWGGLLVTLV+SF GI +S+PLGI+LALGR S +PV++   I FIE+ 
Sbjct: 64  GGWFGLPYVETPLWGGLLVTLVLSFVGIAVSLPLGIVLALGRRSKLPVIKTLSIIFIEMV 123

Query: 221 RGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQF 280
           RGVPLVTVLFMAS+MLPLFLP     DKLLRAL+GV+ FASAY+AEV+RGGLQ+I +GQ+
Sbjct: 124 RGVPLVTVLFMASVMLPLFLPPGVTFDKLLRALIGVALFASAYMAEVVRGGLQAIPRGQY 183

Query: 281 EAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNF 340
           E A++LGLSY QK  L+++PQ +K VIPGIVNTFIGLFKD+SL+ II MFDLLGIVR NF
Sbjct: 184 EGADALGLSYWQKTGLVVLPQALKLVIPGIVNTFIGLFKDTSLVYIIGMFDLLGIVRQNF 243

Query: 341 SESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
           S++ W S  TP TGLIF GFVFWIFCF++S YS+F+E+ L  G K+
Sbjct: 244 SDANWASPQTPATGLIFAGFVFWIFCFAMSRYSIFMERRLDTGHKR 289


>gi|328543626|ref|YP_004303735.1| ABC transporter, permease protein [Polymorphum gilvum SL003B-26A1]
 gi|326413370|gb|ADZ70433.1| ABC transporter, permease protein [Polymorphum gilvum SL003B-26A1]
          Length = 385

 Score =  362 bits (928), Expect = 8e-98,   Method: Compositional matrix adjust.
 Identities = 197/392 (50%), Positives = 264/392 (67%), Gaps = 13/392 (3%)

Query: 1   MIDSCKEFPYVRKRLLQPSLP-PVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPG 59
           M  +  E   +RK    P LP PV   G++ W+  N F +  + LLT + + L  + I  
Sbjct: 1   MTMANAELFQIRKEE-APLLPAPVSTTGVVGWMRANLFSSWSNTLLTLVGLLLAYWLIAP 59

Query: 60  IIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRP 119
            I + F+DAVW G NR  C        Q  G   ACWA++   + QFI+G YP+A+ WR 
Sbjct: 60  FIRFAFIDAVWTGDNRAACAP------QDGGHVGACWAYVKAYFPQFIYGRYPVAEVWRV 113

Query: 120 ILVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYG-----GLGLSIVETSLW 174
            +VF   + LL P+ IPS P K  N++L    FP+ ++F+L G      + L IVETS+W
Sbjct: 114 NVVFALFAALLIPLAIPSVPFKRTNAVLFLVAFPVVAYFLLTGLIVNGRVILPIVETSVW 173

Query: 175 GGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASI 234
           GGLLVTLVI+  GI+ S+PLG+LLALGR S +PV+R   + FIE +RGVPL+TVLFM+S+
Sbjct: 174 GGLLVTLVIAVTGIVASLPLGVLLALGRRSQMPVVRLVSVIFIEFWRGVPLITVLFMSSV 233

Query: 235 MLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKM 294
           MLPLFLP+    +KLLR L+GV+ F++AY+AEV+RGGLQ+I KGQ+E A +LGL Y Q M
Sbjct: 234 MLPLFLPEGVTFNKLLRVLIGVTLFSAAYMAEVVRGGLQAIPKGQYEGAMALGLRYWQMM 293

Query: 295 RLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTG 354
            LII+PQ +K VIPGIVNTFIGLFKD++L+ I+ MFDLLG ++ +FS+ TW S     TG
Sbjct: 294 GLIILPQALKLVIPGIVNTFIGLFKDTTLVLIVGMFDLLGQIQSSFSDPTWSSPTQGHTG 353

Query: 355 LIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
            +F G VFWIFCF +S YS+F+EK L+ G K+
Sbjct: 354 YLFAGMVFWIFCFGMSRYSIFMEKRLNTGHKR 385


>gi|254501118|ref|ZP_05113269.1| ABC transporter, permease protein [Labrenzia alexandrii DFL-11]
 gi|222437189|gb|EEE43868.1| ABC transporter, permease protein [Labrenzia alexandrii DFL-11]
          Length = 383

 Score =  356 bits (914), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 181/375 (48%), Positives = 259/375 (69%), Gaps = 12/375 (3%)

Query: 18  PSLP-PVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
           P LP P+   G+I W+ +N F +  + +LT + + L    +   I + F+DAVW G NR 
Sbjct: 15  PLLPAPISTTGVIGWMRQNLFSSIGNTILTLIGVLLAYSMLAPFIQFAFIDAVWTGDNRE 74

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            C        Q  G + ACWA++   + QFI+G YP+ +R+R  +V+   ++LL P+ IP
Sbjct: 75  ACLP------QDGGHSGACWAYVEAYFPQFIYGRYPVEERYRVDIVYALFALLLVPLAIP 128

Query: 137 SFPRKFLNSILLFGLFPIFSFFVLYG-----GLGLSIVETSLWGGLLVTLVISFFGIIIS 191
           S P K +N+IL   +FPI ++F+L G      + L IVET++WGGLLVTLVI+  GI+ S
Sbjct: 129 SAPFKKINAILFLVVFPIIAYFLLTGLVIGDNVVLPIVETAVWGGLLVTLVIAVTGIVAS 188

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +PLG+ LALGR S +P+++   I FIE +RGVPL+TVLFM+S+MLPLFLP+    DKLLR
Sbjct: 189 LPLGVALALGRRSKMPIIKLVSIIFIEFWRGVPLITVLFMSSVMLPLFLPEGVTFDKLLR 248

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
            L+GV+ F++AY+AEV+RGGLQ+I KGQ+E A +LGL +   M LII+PQ +K VIPGIV
Sbjct: 249 VLIGVTLFSAAYMAEVVRGGLQAIPKGQYEGAMALGLRFWPMMYLIILPQALKLVIPGIV 308

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISL 371
           NTFIGLFKD++L+ I+ MFDLLG ++ +F++ TW +     TG +F   +F++FCF +S 
Sbjct: 309 NTFIGLFKDTTLVLIVGMFDLLGQIQSSFTDPTWSTPSQGHTGYLFAAIIFFVFCFGMSR 368

Query: 372 YSVFIEKTLHKGSKK 386
           YS+++EK LH G K+
Sbjct: 369 YSIYMEKKLHTGHKR 383


>gi|104783490|ref|YP_609988.1| general amino acid ABC transporter permease [Pseudomonas
           entomophila L48]
 gi|95112477|emb|CAK17204.1| general amino acid ABC transporter, permease protein [Pseudomonas
           entomophila L48]
          Length = 365

 Score =  355 bits (912), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 180/375 (48%), Positives = 250/375 (66%), Gaps = 15/375 (4%)

Query: 14  RLLQPSLPP-VYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
            + +P +PP V   G++AW+  N F +  + LLT   + L+   +P ++ W F+DA W+G
Sbjct: 4   HVFKPDMPPPVKTVGVLAWMRANLFSSWLNTLLTLFALYLVWLIVPPLVQWAFIDANWVG 63

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
           + R  CT              ACW FI  R+ QF++G YP   RWR  L      +   P
Sbjct: 64  TTRADCTK-----------EGACWVFIQQRFGQFMYGYYPTELRWRVDLTVWLAVLGAAP 112

Query: 133 MLIPSFPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIIS 191
           + I  FPRK +  +    L+P+ ++ +L+GG LGL+ V+TS WGGL++TLVI+  GI+ +
Sbjct: 113 LFIKRFPRKAVYGLGFLVLYPVLAYTLLHGGYLGLATVQTSQWGGLMLTLVIATVGIVGA 172

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +PLGILLALGR SN+P ++  C+TFIE +RGVPL+TVLFM+S+MLPLFLP+    DKLLR
Sbjct: 173 LPLGILLALGRRSNMPAVKVVCVTFIEFWRGVPLITVLFMSSVMLPLFLPEGMSFDKLLR 232

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
           A++GV  F SAYIAEV+RGGLQ+I KGQ+EAA ++GL Y + M L+I+PQ +K VIPGIV
Sbjct: 233 AMIGVILFQSAYIAEVVRGGLQAIPKGQYEAAAAMGLGYWRAMGLVILPQALKLVIPGIV 292

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISL 371
           NTFI LFKD+SL+ II +FDLL  V+   ++ TW+     T G +F   VFWIFCF +S 
Sbjct: 293 NTFIALFKDTSLVIIIGLFDLLNSVKQAAADPTWLGMA--TEGYVFAALVFWIFCFGMSR 350

Query: 372 YSVFIEKTLHKGSKK 386
           YS+ +E+ L  G K+
Sbjct: 351 YSMHLERKLDTGHKR 365


>gi|307942364|ref|ZP_07657715.1| general L-amino acid transport system permease protein AapM
           [Roseibium sp. TrichSKD4]
 gi|307774650|gb|EFO33860.1| general L-amino acid transport system permease protein AapM
           [Roseibium sp. TrichSKD4]
          Length = 384

 Score =  354 bits (909), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 189/389 (48%), Positives = 263/389 (67%), Gaps = 12/389 (3%)

Query: 4   SCKEFPYVRKRLLQPSLP-PVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIH 62
           +  E  +VR     P LP PV   G I W+ +N F +  + +LT + I +    I  II 
Sbjct: 2   ANAEMFHVRTEE-APLLPAPVSTTGAIGWMRQNLFSSIGNTILTVIGIFIAYSMIMPIIQ 60

Query: 63  WVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILV 122
           + F+DAVW G +RT C        +P     ACWA++    +QFI+G YP  + +R  +V
Sbjct: 61  FAFIDAVWTGEDRTACLAA-----EPGEKVGACWAYVGAYMKQFIYGRYPYEELYRVNIV 115

Query: 123 FLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYG-GLG----LSIVETSLWGGL 177
           +   ++LL P+ +PS P K LN+ L   +FPI ++++L G   G      IVET++WGGL
Sbjct: 116 YGLFALLLIPLAMPSVPAKGLNAFLFLVMFPIAAYYLLTGLEFGSFVVFPIVETAVWGGL 175

Query: 178 LVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLP 237
           LVTLVI+  GI+ S+PLG+ LALGR S +P+++   I FIE +RGVPL+TVLFMAS+MLP
Sbjct: 176 LVTLVIAVTGIVASLPLGVALALGRRSQMPIIKLVSIIFIEFWRGVPLITVLFMASVMLP 235

Query: 238 LFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLI 297
           LFLP+  + DKLLR L+GV+ F++AY+AEV+RGGLQ+I KGQ+E A +LGL +   M LI
Sbjct: 236 LFLPEGVNFDKLLRVLIGVTLFSAAYMAEVVRGGLQAIPKGQYEGAMALGLRFWPMMYLI 295

Query: 298 IMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIF 357
           I+PQ +K VIPGIVNTFIGLFKD++L+ I+ MFDLLG ++ +FS+STW +     TG +F
Sbjct: 296 ILPQALKLVIPGIVNTFIGLFKDTTLVLIVGMFDLLGQIKSSFSDSTWATPSQGPTGYLF 355

Query: 358 IGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
            G VF++FCF +S YS+F+EK LH G K+
Sbjct: 356 AGVVFFLFCFGMSRYSIFMEKKLHTGHKR 384


>gi|118589036|ref|ZP_01546443.1| amino acid ABC transporter, permease protein [Stappia aggregata IAM
           12614]
 gi|118438365|gb|EAV44999.1| amino acid ABC transporter, permease protein [Stappia aggregata IAM
           12614]
          Length = 367

 Score =  354 bits (908), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 181/370 (48%), Positives = 253/370 (68%), Gaps = 11/370 (2%)

Query: 22  PVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTV 81
           P+   G+I W+ +N F +  + +LT + I +    I  +I + F+DAVW G NR  C   
Sbjct: 4   PISTTGVIGWMRQNLFSSIGNTVLTVIGILIAYSLIAPLIQFAFIDAVWTGENREACLP- 62

Query: 82  SQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRK 141
                Q  G + ACWA++   + QFI+G YP  + WR  +V+   + LL P+ IP+ P K
Sbjct: 63  -----QEGGHSGACWAYVEAYFPQFIYGRYPTEEVWRVNVVYFLFAALLIPLAIPNAPFK 117

Query: 142 FLNSILLFGLFPIFSFFVLYG-----GLGLSIVETSLWGGLLVTLVISFFGIIISMPLGI 196
            +N+IL   +FPI ++++L G      + L IVET++WGGLLVTLVI+  GI+ S+PLGI
Sbjct: 118 KINAILFLVVFPIVAYYLLTGLVFGDVVILPIVETAVWGGLLVTLVIAVTGIVASLPLGI 177

Query: 197 LLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGV 256
            LALGR S +P+++   I FIE +RGVPL+TVLFM+S++LPLFLPD    DKLLR L+GV
Sbjct: 178 ALALGRRSKMPIIKLVSIIFIEFWRGVPLITVLFMSSVVLPLFLPDGVTFDKLLRVLIGV 237

Query: 257 SAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIG 316
           + F++AY+AEV+RGGLQ+I KGQ+E A +LGL +   M LII+PQ +K VIPGIVNTFIG
Sbjct: 238 TLFSAAYMAEVVRGGLQAIPKGQYEGAMALGLRFWPMMYLIILPQALKLVIPGIVNTFIG 297

Query: 317 LFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFI 376
           LFKD++L+ I+ MFDLLG ++ +F++ TW +  T  TG +F   VFW FCF +S YS+F+
Sbjct: 298 LFKDTTLVLIVGMFDLLGQIQSSFTDPTWSTPSTGHTGYLFAAVVFWTFCFGMSRYSIFM 357

Query: 377 EKTLHKGSKK 386
           E  LH G K+
Sbjct: 358 ENKLHTGHKR 367


>gi|197335791|ref|YP_002156347.1| general L-amino acid transport system permease protein AapM [Vibrio
           fischeri MJ11]
 gi|197317281|gb|ACH66728.1| general L-amino acid transport system permease protein AapM [Vibrio
           fischeri MJ11]
          Length = 365

 Score =  353 bits (906), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 176/372 (47%), Positives = 255/372 (68%), Gaps = 15/372 (4%)

Query: 17  QPSLPPVYQR-GIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNR 75
           QP LPP     G + W+ K+ F  P + +LT +I  L +  +  ++ W  ++A WIG+ R
Sbjct: 7   QPDLPPPANTVGAVTWLKKHLFNGPINSILTLIIAYLAIVGLWNVVSWGLINADWIGTTR 66

Query: 76  TVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLI 135
             C++             ACW  I  R++QF++G YP  + WRP L +   +I +  +  
Sbjct: 67  DACSS-----------EGACWVMINVRWDQFMYGFYPSEELWRPQLFYGLLAIFVALLAY 115

Query: 136 PSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPL 194
              P+KF   ++   +FPIF+ F+LYGG+ GL +V+T LWGGLL+TLVI+  GI++S+P+
Sbjct: 116 EHTPKKFAIWLVFVNIFPIFAAFLLYGGVFGLPVVDTHLWGGLLITLVIAIVGIVVSLPI 175

Query: 195 GILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALL 254
           G+ LALGR S +P++R  C  +IE++RGVPL+TVLFMAS+MLPLFL +  ++DKL RAL+
Sbjct: 176 GVALALGRRSEMPIIRSMCTVYIEIWRGVPLITVLFMASVMLPLFLSEGMELDKLFRALI 235

Query: 255 GVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTF 314
           GV  F++AY+AEV+RGGLQ+I KGQ+EAA++LGL Y +KMRLII+PQ +K  IP IVNTF
Sbjct: 236 GVVLFSAAYMAEVVRGGLQAIPKGQYEAADALGLGYWKKMRLIILPQALKITIPSIVNTF 295

Query: 315 IGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSV 374
           IGLFKD+SL+ II MFD+LGI +   ++  W+   T +   +F+  VFW+FCFS+S YS+
Sbjct: 296 IGLFKDTSLVLIIGMFDVLGIGQAANTDPEWLGFSTES--YVFVALVFWVFCFSMSRYSI 353

Query: 375 FIEKTLHKGSKK 386
           ++E  LH G K+
Sbjct: 354 YLENKLHTGHKR 365


>gi|70728432|ref|YP_258181.1| general amino acid ABC transporter permease [Pseudomonas
           fluorescens Pf-5]
 gi|68342731|gb|AAY90337.1| general amino acid ABC transporter, permease protein [Pseudomonas
           fluorescens Pf-5]
          Length = 365

 Score =  353 bits (905), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 184/372 (49%), Positives = 249/372 (66%), Gaps = 15/372 (4%)

Query: 17  QPSLPPVYQR-GIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNR 75
           +P +PP  +  G++AW+  N F    + LLT     L+   +P ++HW  LDA W+G++R
Sbjct: 7   KPDMPPPSRSIGVLAWMRANMFSNWLNTLLTLFAFYLIYLVVPPLLHWAILDANWVGTSR 66

Query: 76  TVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLI 135
             CT   +GG        ACW FI  R+ QF++G YP+  RWR  L      I   P+ I
Sbjct: 67  ADCT---RGG--------ACWVFIQQRFGQFMYGYYPVELRWRVDLSVWLAVIGAAPLFI 115

Query: 136 PSFPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISMPL 194
             FPRK +  +     +PI ++ +L+GG LGLS V TS WGGL++TLVI+  GI  ++PL
Sbjct: 116 SRFPRKAIYGLCFLVGYPIIAYSLLHGGYLGLSTVATSQWGGLMLTLVIATVGIAGALPL 175

Query: 195 GILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALL 254
           GILLALGR SN+P +R  C+TFIE +RGVPL+TVLFM+S+MLPLFLP+  + DKLLRAL+
Sbjct: 176 GILLALGRRSNLPAIRVVCVTFIEFWRGVPLITVLFMSSVMLPLFLPEGMNFDKLLRALI 235

Query: 255 GVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTF 314
           GV  F SAY+AEV+RGGLQ+I KGQ+EAA ++GL Y + M L+I+PQ +K VIPGIVNTF
Sbjct: 236 GVILFQSAYVAEVVRGGLQAIPKGQYEAAAAMGLGYWRAMGLVILPQALKLVIPGIVNTF 295

Query: 315 IGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSV 374
           I LFKD+SL+ II +FDLL  V+   ++  W+     T G +F   VFWIFCF +S YS+
Sbjct: 296 IALFKDTSLVIIIGLFDLLNSVKQAAADPKWLG--MATEGYVFAALVFWIFCFGMSRYSM 353

Query: 375 FIEKTLHKGSKK 386
            +E+ L  G K+
Sbjct: 354 HLERKLDTGHKR 365


>gi|90410650|ref|ZP_01218666.1| putative ABC-type amino acid transport system, permease component
           [Photobacterium profundum 3TCK]
 gi|90328891|gb|EAS45175.1| putative ABC-type amino acid transport system, permease component
           [Photobacterium profundum 3TCK]
          Length = 365

 Score =  352 bits (902), Expect = 8e-95,   Method: Compositional matrix adjust.
 Identities = 175/372 (47%), Positives = 253/372 (68%), Gaps = 15/372 (4%)

Query: 17  QPSLPPVYQR-GIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNR 75
           QP LPP     GII W  ++ F +  + ++T  +    +  +  +I W F++A W+G  R
Sbjct: 7   QPDLPPPANTVGIIGWARQHLFSSITNSIMTIFLAYFAITGLWAVIQWAFINADWVGDTR 66

Query: 76  TVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLI 135
             C++           + ACW FI  R++QF+FG YP  Q WRP L + T +I ++ ++I
Sbjct: 67  DACSS-----------DGACWVFINVRFDQFMFGFYPADQLWRPKLFYFTLAIFISLLVI 115

Query: 136 PSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPL 194
              P +    +    ++P F+ F+LYGG+ GL +V+T LWGGLLVTLVI+  GI++S+P+
Sbjct: 116 EKTPGRKWIWLFFVNVYPFFAAFLLYGGVFGLEVVDTHLWGGLLVTLVIAIVGIVVSLPI 175

Query: 195 GILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALL 254
           G+ LALGR S +P++R  C  +IE++RGVPL+TVLFMAS++LPLFL    ++DKL RAL+
Sbjct: 176 GVALALGRRSEMPIIRSICTVYIEIWRGVPLITVLFMASVLLPLFLTSEMEMDKLFRALI 235

Query: 255 GVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTF 314
           GV  F++AY+AEV+RGGLQ+I +GQ+EAA++LGLSY + M LI++PQ +K  IP IVNTF
Sbjct: 236 GVVLFSAAYMAEVIRGGLQAIPRGQYEAADALGLSYWKSMYLIVLPQALKITIPSIVNTF 295

Query: 315 IGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSV 374
           IGLFKD+SL+ II MFD+LGI +   S+  W+   T +   IF+  VFW+FCFS+S YS+
Sbjct: 296 IGLFKDTSLVLIIGMFDVLGIGQAANSDPDWLGFATES--YIFVALVFWVFCFSMSRYSI 353

Query: 375 FIEKTLHKGSKK 386
           F+E  LH G K+
Sbjct: 354 FLENKLHTGHKR 365


>gi|260768538|ref|ZP_05877472.1| amino acid ABC transporter permease protein [Vibrio furnissii CIP
           102972]
 gi|260616568|gb|EEX41753.1| amino acid ABC transporter permease protein [Vibrio furnissii CIP
           102972]
 gi|315180250|gb|ADT87164.1| general L-amino acid transport system permease protein AapM [Vibrio
           furnissii NCTC 11218]
          Length = 365

 Score =  351 bits (901), Expect = 8e-95,   Method: Compositional matrix adjust.
 Identities = 174/378 (46%), Positives = 255/378 (67%), Gaps = 15/378 (3%)

Query: 11  VRKRLLQPSLPP-VYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAV 69
           ++    QPSLPP     G++ W+ KN F +P + ++T ++  +   +I  ++ W  + A 
Sbjct: 1   MKTHQFQPSLPPPANTTGVVGWLRKNLFNSPLNSVVTLILAYIAFSAIWHVLDWAIIKAD 60

Query: 70  WIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSIL 129
           W+G+ R  CT            + ACW FI  R+EQF++G YP A+ WRP + F T +I 
Sbjct: 61  WVGATRDACTR-----------DGACWVFISVRWEQFMYGFYPQAELWRPRIFFATLAIF 109

Query: 130 LTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGI 188
           +  +     P++    +    ++P     +LYGG+ GL +V T  WGGLLVTL+I+  GI
Sbjct: 110 IALLAYERTPKRTWIWLFFVNIYPFLMAGLLYGGVFGLEVVSTHKWGGLLVTLIIALVGI 169

Query: 189 IISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDK 248
           ++S+P+G+ LALGR S++PV+R  C  +IE++RGVPL+TVLFMAS+MLPLFL +  + DK
Sbjct: 170 VVSLPIGVALALGRRSDMPVIRSLCTVYIEVWRGVPLITVLFMASVMLPLFLSEGSETDK 229

Query: 249 LLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIP 308
           LLRAL+GV  F++AY+AEV+RGGLQ+I KGQ+EAA++LGLSY +KM LII+PQ +K  IP
Sbjct: 230 LLRALIGVVMFSAAYMAEVIRGGLQAIPKGQYEAADALGLSYWKKMGLIILPQALKITIP 289

Query: 309 GIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFS 368
            IVNTFIGLFKD+SL+ II MFD+LGI +   ++  W+   T +   +F+  VFW+FCF 
Sbjct: 290 SIVNTFIGLFKDTSLVLIIGMFDVLGIGQAANTDPEWLGFATES--YVFVALVFWVFCFG 347

Query: 369 ISLYSVFIEKTLHKGSKK 386
           +S YS+++E+ LH G K+
Sbjct: 348 MSRYSIWLERKLHTGHKR 365


>gi|330811532|ref|YP_004355994.1| Putative amino acid ABC transporter, permease component
           [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
 gi|327379640|gb|AEA70990.1| Putative amino acid ABC transporter, permease component
           [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
          Length = 365

 Score =  351 bits (901), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 181/372 (48%), Positives = 246/372 (66%), Gaps = 15/372 (4%)

Query: 17  QPSLPPVYQR-GIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNR 75
           +P +PP     G++AW+  N F +  + LLT     L+   +P ++HW  LDA W+G+ R
Sbjct: 7   KPDMPPPGSSIGVVAWMRANMFSSWINTLLTLFAFYLIYLIVPPLLHWAILDANWVGTTR 66

Query: 76  TVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLI 135
             CT              ACW FI  R+ QF++G YP   RWR  L      I + P+ I
Sbjct: 67  ADCTK-----------EGACWVFIQQRFGQFMYGYYPTDLRWRVDLTVWLAVIGVAPLFI 115

Query: 136 PSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPL 194
             FPRK +  +    L+PI ++ +L+GG+ GL  V TS WGGL++TLVI+  GI+ ++PL
Sbjct: 116 SRFPRKAIYGLSFLVLYPIIAWCLLHGGVFGLDAVATSQWGGLMLTLVIATVGIVGALPL 175

Query: 195 GILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALL 254
           GI+LALGR SN+P +R  C+TFIE +RGVPL+TVLFM+S+MLPLFLP+  + DKLLRAL+
Sbjct: 176 GIVLALGRRSNMPAIRVVCVTFIEFWRGVPLITVLFMSSVMLPLFLPEGMNFDKLLRALI 235

Query: 255 GVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTF 314
           GV  F SAYIAEV+RGGLQ+I KGQ+EAA ++GL Y + M L+I+PQ +K VIPGIVNTF
Sbjct: 236 GVILFQSAYIAEVVRGGLQAIPKGQYEAAAAMGLGYWRSMGLVILPQALKLVIPGIVNTF 295

Query: 315 IGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSV 374
           I LFKD+SL+ II +FDLL  V+   ++  W+     T G +F   VFWIFCF +S YS+
Sbjct: 296 IALFKDTSLVIIIGLFDLLNSVKQAAADPKWLG--MATEGYVFAALVFWIFCFGMSRYSM 353

Query: 375 FIEKTLHKGSKK 386
            +E+ L  G K+
Sbjct: 354 HLERKLDTGHKR 365


>gi|156974645|ref|YP_001445552.1| hypothetical protein VIBHAR_02363 [Vibrio harveyi ATCC BAA-1116]
 gi|156526239|gb|ABU71325.1| hypothetical protein VIBHAR_02363 [Vibrio harveyi ATCC BAA-1116]
          Length = 365

 Score =  351 bits (901), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 176/372 (47%), Positives = 253/372 (68%), Gaps = 15/372 (4%)

Query: 17  QPSLPPVYQR-GIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNR 75
           QP LPP     G+I W+ KN F  P + ++T ++  ++  ++  II W F++A WIG+ R
Sbjct: 7   QPDLPPPANTVGVIGWLRKNLFNGPVNSIVTLILAYIVFSALWNIIDWAFINADWIGATR 66

Query: 76  TVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLI 135
             CT              ACW FI  R+EQF++G YP A+ WRP L ++T +I    +  
Sbjct: 67  DDCTR-----------EGACWVFISVRWEQFMYGFYPEAELWRPRLFYITLAIFTVLLAY 115

Query: 136 PSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPL 194
              P++    +    ++P     +LYGG+ GL +VET  WGGLLVTL+I+  GI++S+P+
Sbjct: 116 EKTPKRIWIWLFFVNIYPFIIAALLYGGVFGLEVVETHKWGGLLVTLIIALVGIVVSLPI 175

Query: 195 GILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALL 254
           G+ LALGR S++P++R  C  +IE++RGVPL+TVLFMAS+MLPLFL +  + DKL+RAL+
Sbjct: 176 GVALALGRRSDMPIIRSICTVYIEVWRGVPLITVLFMASVMLPLFLAEGSETDKLIRALI 235

Query: 255 GVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTF 314
           GV  F++AY+AEV+RGGLQ+I KGQ+EAA++LGLSY +KM LII+PQ +K  IP IVNTF
Sbjct: 236 GVVMFSAAYMAEVVRGGLQAIPKGQYEAADALGLSYWKKMGLIILPQALKITIPSIVNTF 295

Query: 315 IGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSV 374
           IGLFKD+SL+ II MFD+LGI +   ++  W+   T +   +F+  VFW+FCF +S YS+
Sbjct: 296 IGLFKDTSLVLIIGMFDVLGIGQAANTDPEWLGFATES--YVFVALVFWVFCFGMSRYSI 353

Query: 375 FIEKTLHKGSKK 386
           ++E  LH G K+
Sbjct: 354 WLENKLHTGHKR 365


>gi|59712141|ref|YP_204917.1| amino-acid transporter permease [Vibrio fischeri ES114]
 gi|59480242|gb|AAW86029.1| predicted amino-acid transporter permease [Vibrio fischeri ES114]
          Length = 365

 Score =  351 bits (901), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 176/372 (47%), Positives = 254/372 (68%), Gaps = 15/372 (4%)

Query: 17  QPSLPPVYQR-GIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNR 75
           QP LPP     G + W+ K+ F  P + +LT +I  L +  +  +I W  ++A WIG+ R
Sbjct: 7   QPDLPPPANTVGAVTWLKKHLFNGPINSILTLIIAYLAIIGLWNVISWGLINADWIGTTR 66

Query: 76  TVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLI 135
             C++             ACW  I  R++QF++G YP  + WRP L +   +I +  +  
Sbjct: 67  DACSS-----------EGACWVMISVRWDQFMYGFYPSDELWRPQLFYGLLAIFVALLAY 115

Query: 136 PSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPL 194
              P+KF   ++   +FPIF+ F+LYGG+  L +V+T LWGGLL+TLVI+  GI++S+P+
Sbjct: 116 EHTPKKFAIWLIFVNIFPIFAAFLLYGGVFDLPVVDTHLWGGLLITLVIAIVGIVVSLPI 175

Query: 195 GILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALL 254
           G+ LALGR S +P++R  C  +IE++RGVPL+TVLFMAS+MLPLFL +  ++DKL RAL+
Sbjct: 176 GVALALGRRSEMPIIRSMCTVYIEIWRGVPLITVLFMASVMLPLFLSEGMELDKLFRALI 235

Query: 255 GVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTF 314
           GV  F++AY+AEV+RGGLQ+I KGQ+EAA++LGL Y +KMRLII+PQ +K  IP IVNTF
Sbjct: 236 GVVLFSAAYMAEVVRGGLQAIPKGQYEAADALGLGYWKKMRLIILPQALKITIPSIVNTF 295

Query: 315 IGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSV 374
           IGLFKD+SL+ II MFD+LGI +   ++  W+   T +   +F+  VFW+FCFS+S YS+
Sbjct: 296 IGLFKDTSLVLIIGMFDVLGIGQAANTDPEWLGFSTES--YVFVALVFWVFCFSMSRYSI 353

Query: 375 FIEKTLHKGSKK 386
           ++E  LH G K+
Sbjct: 354 YLENKLHTGHKR 365


>gi|262165599|ref|ZP_06033336.1| amino acid ABC transporter permease protein [Vibrio mimicus VM223]
 gi|262025315|gb|EEY43983.1| amino acid ABC transporter permease protein [Vibrio mimicus VM223]
          Length = 365

 Score =  350 bits (899), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 181/378 (47%), Positives = 254/378 (67%), Gaps = 15/378 (3%)

Query: 11  VRKRLLQPSLPP-VYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAV 69
           ++    QPSLPP     G I W+ KN F  P + + T  +  L +  I  I+ W  ++A 
Sbjct: 1   MKTHQFQPSLPPPTNTTGPIGWLRKNLFNGPFNTIATLALGYLAVQGIWNILDWAIINAN 60

Query: 70  WIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSIL 129
           W G+ R  CT              ACW FI  R+EQF++G YP A+ WRP L F+T +I 
Sbjct: 61  WSGTTRNDCTL-----------EGACWVFISARWEQFMYGFYPAAELWRPRLFFITLAIF 109

Query: 130 LTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGI 188
           +  +     P++    ++   ++P F+  +LYGGL GL +VET  WGGLLVTL+I+  GI
Sbjct: 110 VALLAYEKTPKRGWIWLVFVNIYPFFAAILLYGGLFGLEVVETHKWGGLLVTLIIALVGI 169

Query: 189 IISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDK 248
           I S+P+G+ LALGR S++P++R  C  +IE++RGVPL+TVLFMAS+MLPLFL +  +++K
Sbjct: 170 IASLPIGVALALGRRSDMPIIRSLCTVYIEVWRGVPLITVLFMASVMLPLFLSEGSEINK 229

Query: 249 LLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIP 308
           LLRAL+GV  F++AY+AEV+RGGLQ+I KGQ+EAA++LGLSY +KM LII+PQ +K  IP
Sbjct: 230 LLRALIGVVMFSAAYMAEVIRGGLQAIPKGQYEAADALGLSYWKKMGLIILPQALKITIP 289

Query: 309 GIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFS 368
            IVNTFIGLFKD+SL+ II MFD+LGI +   ++  W+   T +   +F+  VFWIFCF 
Sbjct: 290 SIVNTFIGLFKDTSLVLIIGMFDVLGIGQSANTDPNWLGFATES--YVFVALVFWIFCFG 347

Query: 369 ISLYSVFIEKTLHKGSKK 386
           +S YS+++E  LH G K+
Sbjct: 348 MSRYSIWLEGKLHTGHKR 365


>gi|261210915|ref|ZP_05925205.1| amino acid ABC transporter permease protein [Vibrio sp. RC341]
 gi|260839890|gb|EEX66490.1| amino acid ABC transporter permease protein [Vibrio sp. RC341]
          Length = 365

 Score =  350 bits (899), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 181/378 (47%), Positives = 254/378 (67%), Gaps = 15/378 (3%)

Query: 11  VRKRLLQPSLPPV-YQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAV 69
           ++    QPSLPP     G I W+ KN F +P + + T ++    L  I  I+ W  ++A 
Sbjct: 1   MKTHQFQPSLPPPGNTTGFIGWLRKNLFNSPFNSVATLVLGYFALQGIWHILDWAIINAN 60

Query: 70  WIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSIL 129
           W GS R  CT            + ACW FI  R+EQF++G YP A+ WRP L F T ++ 
Sbjct: 61  WSGSTRNDCTL-----------DGACWVFISVRWEQFMYGFYPAAELWRPRLFFFTLALF 109

Query: 130 LTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGI 188
           +  +     P++    ++   ++P F+  +LYGGL GL +VET  WGGLLVTL+I+  GI
Sbjct: 110 VALLAYEKTPKRTWVWLVFVNIYPFFAAILLYGGLFGLEVVETHKWGGLLVTLIIALVGI 169

Query: 189 IISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDK 248
           I S+P+G+ LALGR S++P++R  C  +IE++RGVPL+TVLFMAS+MLPLFL    ++DK
Sbjct: 170 IASLPIGVALALGRRSDMPIIRSLCTVYIEVWRGVPLITVLFMASVMLPLFLSQGSEIDK 229

Query: 249 LLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIP 308
           LLRAL+GV  F++AY+AEV+RGGLQ+I KGQ+EAA++LGLSY +KM LII+PQ +K  IP
Sbjct: 230 LLRALIGVVMFSAAYMAEVIRGGLQAIPKGQYEAADALGLSYWKKMGLIILPQALKITIP 289

Query: 309 GIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFS 368
            IVNTFIGLFKD+SL+ II MFD+LGI +   ++  W+   T +   +F+  VFW+FCF 
Sbjct: 290 SIVNTFIGLFKDTSLVLIIGMFDVLGIGQSANTDPNWLGFATES--YVFVALVFWVFCFG 347

Query: 369 ISLYSVFIEKTLHKGSKK 386
           +S YS+++E  LH G K+
Sbjct: 348 MSRYSIWLEGKLHTGHKR 365


>gi|37679739|ref|NP_934348.1| ABC-type amino acid transport system, permease component [Vibrio
           vulnificus YJ016]
 gi|37198484|dbj|BAC94319.1| ABC-type amino acid transport system, permease component [Vibrio
           vulnificus YJ016]
          Length = 372

 Score =  350 bits (899), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 175/372 (47%), Positives = 251/372 (67%), Gaps = 15/372 (4%)

Query: 17  QPSLPPVYQR-GIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNR 75
           QP LPP     G+I W+ KN F +P + +LT ++    + ++  +  W FL A W+GS R
Sbjct: 14  QPDLPPPANTVGVIGWMRKNLFNSPVNSVLTLVLAYFAISTLWYVADWAFLSADWVGSTR 73

Query: 76  TVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLI 135
             CT              ACW FI  R+EQF++G YP A+ WRP L ++T +I    +  
Sbjct: 74  DACTR-----------EGACWVFISVRWEQFMYGFYPEAELWRPRLFYITLAIFTVLLAY 122

Query: 136 PSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPL 194
              P++    +    ++P     +LYGG+ GL +VET  WGGLLVTL+I+  GI++S+P+
Sbjct: 123 EKTPKRMWIWLFFVNIYPFIVAALLYGGVFGLEVVETHKWGGLLVTLIIALVGIVVSLPI 182

Query: 195 GILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALL 254
           G+ LALGR S++P++R  C  +IE++RGVPL+TVLFMAS+MLPLFL +  + DKL+RAL+
Sbjct: 183 GVALALGRRSDMPIIRSLCTVYIEVWRGVPLITVLFMASVMLPLFLSEGSETDKLIRALI 242

Query: 255 GVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTF 314
           GV  F++AY+AEV+RGGLQ+I KGQ+EAA++LGL+Y +KM LII+PQ +K  IP IVNTF
Sbjct: 243 GVVMFSAAYMAEVVRGGLQAIPKGQYEAADALGLTYWKKMGLIILPQALKITIPSIVNTF 302

Query: 315 IGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSV 374
           IGLFKD+SL+ II MFD+LGI +   ++  W+   T +   +F+  VFW+FCF +S YS+
Sbjct: 303 IGLFKDTSLVLIIGMFDVLGIGQAANTDPEWLGFATES--YVFVALVFWVFCFGMSRYSI 360

Query: 375 FIEKTLHKGSKK 386
           ++E  LH G K+
Sbjct: 361 WLENKLHTGHKR 372


>gi|320156511|ref|YP_004188890.1| amino acid ABC transporterpermease [Vibrio vulnificus MO6-24/O]
 gi|319931823|gb|ADV86687.1| amino acid ABC transporter, permease protein [Vibrio vulnificus
           MO6-24/O]
          Length = 365

 Score =  350 bits (898), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 175/372 (47%), Positives = 251/372 (67%), Gaps = 15/372 (4%)

Query: 17  QPSLPPVYQR-GIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNR 75
           QP LPP     G+I W+ KN F +P + +LT ++    + ++  +  W FL A W+GS R
Sbjct: 7   QPDLPPPANTVGVIGWMRKNLFNSPVNSVLTLVLAYFAISTLWYVADWAFLSADWVGSTR 66

Query: 76  TVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLI 135
             CT              ACW FI  R+EQF++G YP A+ WRP L ++T +I    +  
Sbjct: 67  DACTR-----------EGACWVFISVRWEQFMYGFYPEAELWRPRLFYITLAIFTVLLAY 115

Query: 136 PSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPL 194
              P++    +    ++P     +LYGG+ GL +VET  WGGLLVTL+I+  GI++S+P+
Sbjct: 116 EKTPKRMWIWLFFVNIYPFIVAALLYGGVFGLEVVETHKWGGLLVTLIIALVGIVVSLPI 175

Query: 195 GILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALL 254
           G+ LALGR S++P++R  C  +IE++RGVPL+TVLFMAS+MLPLFL +  + DKL+RAL+
Sbjct: 176 GVALALGRRSDMPIIRSLCTVYIEVWRGVPLITVLFMASVMLPLFLSEGSETDKLIRALI 235

Query: 255 GVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTF 314
           GV  F++AY+AEV+RGGLQ+I KGQ+EAA++LGL+Y +KM LII+PQ +K  IP IVNTF
Sbjct: 236 GVVMFSAAYMAEVVRGGLQAIPKGQYEAADALGLTYWKKMGLIILPQALKITIPSIVNTF 295

Query: 315 IGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSV 374
           IGLFKD+SL+ II MFD+LGI +   ++  W+   T +   +F+  VFW+FCF +S YS+
Sbjct: 296 IGLFKDTSLVLIIGMFDVLGIGQAANTDPEWLGFATES--YVFVALVFWVFCFGMSRYSI 353

Query: 375 FIEKTLHKGSKK 386
           ++E  LH G K+
Sbjct: 354 WLENKLHTGHKR 365


>gi|323492612|ref|ZP_08097756.1| hypothetical protein VIBR0546_00040 [Vibrio brasiliensis LMG 20546]
 gi|323312987|gb|EGA66107.1| hypothetical protein VIBR0546_00040 [Vibrio brasiliensis LMG 20546]
          Length = 365

 Score =  350 bits (898), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 173/372 (46%), Positives = 252/372 (67%), Gaps = 15/372 (4%)

Query: 17  QPSLPPVYQR-GIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNR 75
           QP LPP     G++ W+ KN F  P + ++T ++  L    +  +++W FL+A W+G+ R
Sbjct: 7   QPDLPPPANTVGLVGWLRKNLFNGPVNSVVTVILTVLSAMLLWEVVNWAFLNADWVGTTR 66

Query: 76  TVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLI 135
             C+              ACW FI  R++QF++G YP A+ WRP L ++T +I    +  
Sbjct: 67  DACSR-----------EGACWVFIAVRWDQFMYGFYPEAELWRPQLFYVTLAIFTVLLAY 115

Query: 136 PSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPL 194
              P++    +    ++P F   +LYGG+ GL +VET  WGGLLVTL+I+  GI++S+P+
Sbjct: 116 EKTPKRLWIWLFFVNVYPFFIAALLYGGVFGLEVVETHKWGGLLVTLIIALVGIVVSLPI 175

Query: 195 GILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALL 254
           G+ LALGR S +P++R  C  +IE++RGVPL+TVLFMAS+MLPLFL +  + DKL+RAL+
Sbjct: 176 GVALALGRRSEMPIIRSICTVYIEVWRGVPLITVLFMASVMLPLFLSEGSETDKLIRALI 235

Query: 255 GVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTF 314
           GV  F++AY+AEV+RGGLQ+I KGQ+EAA++LGLSY +KM LII+PQ +K  IP IVNTF
Sbjct: 236 GVVMFSAAYMAEVVRGGLQAIPKGQYEAADALGLSYWKKMGLIILPQALKITIPSIVNTF 295

Query: 315 IGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSV 374
           IGLFKD+SL+ II MFD+LGI +   ++  W+   T +   +F+  VFW+FCF +S YS+
Sbjct: 296 IGLFKDTSLVLIIGMFDVLGIGQAANTDPEWLGFATES--YVFVALVFWVFCFGMSRYSI 353

Query: 375 FIEKTLHKGSKK 386
           ++E  LH G K+
Sbjct: 354 WLENKLHTGHKR 365


>gi|258621543|ref|ZP_05716576.1| amino acid ABC transporter, permease protein [Vibrio mimicus VM573]
 gi|262171611|ref|ZP_06039289.1| amino acid ABC transporter permease protein [Vibrio mimicus MB-451]
 gi|258586161|gb|EEW10877.1| amino acid ABC transporter, permease protein [Vibrio mimicus VM573]
 gi|261892687|gb|EEY38673.1| amino acid ABC transporter permease protein [Vibrio mimicus MB-451]
          Length = 365

 Score =  350 bits (898), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 181/378 (47%), Positives = 253/378 (66%), Gaps = 15/378 (3%)

Query: 11  VRKRLLQPSLPP-VYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAV 69
           ++    QPSLPP     G I W+ KN F  P + + T  +  L    I  I+ W  ++A 
Sbjct: 1   MKTHQFQPSLPPPANTTGPIGWLRKNLFNGPFNTIATLALGYLAAQGIWNILDWAIINAN 60

Query: 70  WIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSIL 129
           W G+ R  CT              ACW FI  R+EQF++G YP A+ WRP L F+T +I 
Sbjct: 61  WSGTTRNDCTL-----------EGACWVFISARWEQFMYGFYPAAELWRPRLFFITLAIF 109

Query: 130 LTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGI 188
           +  +     P++    ++   ++P F+  +LYGGL GL +VET  WGGLLVTL+I+  GI
Sbjct: 110 VALLAYEKTPKRGWIWLVFVNIYPFFAAILLYGGLFGLEVVETHKWGGLLVTLIIALVGI 169

Query: 189 IISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDK 248
           I S+P+G+ LALGR S++P++R  C  +IE++RGVPL+TVLFMAS+MLPLFL +  +++K
Sbjct: 170 IASLPIGVALALGRRSDMPIIRSLCTVYIEVWRGVPLITVLFMASVMLPLFLSEGSEINK 229

Query: 249 LLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIP 308
           LLRAL+GV  F++AY+AEV+RGGLQ+I KGQ+EAA++LGLSY +KM LII+PQ +K  IP
Sbjct: 230 LLRALIGVVMFSAAYMAEVIRGGLQAIPKGQYEAADALGLSYWKKMGLIILPQALKITIP 289

Query: 309 GIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFS 368
            IVNTFIGLFKD+SL+ II MFD+LGI +   ++  W+   T +   +F+  VFWIFCF 
Sbjct: 290 SIVNTFIGLFKDTSLVLIIGMFDVLGIGQSANTDPNWLGFATES--YVFVALVFWIFCFG 347

Query: 369 ISLYSVFIEKTLHKGSKK 386
           +S YS+++E  LH G K+
Sbjct: 348 MSRYSIWLEGKLHTGHKR 365


>gi|258627558|ref|ZP_05722335.1| amino acid ABC transporter, permease protein [Vibrio mimicus VM603]
 gi|258580140|gb|EEW05112.1| amino acid ABC transporter, permease protein [Vibrio mimicus VM603]
          Length = 365

 Score =  350 bits (898), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 181/378 (47%), Positives = 253/378 (66%), Gaps = 15/378 (3%)

Query: 11  VRKRLLQPSLPP-VYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAV 69
           ++    QPSLPP     G I W+ KN F  P + + T  +  L    I  I+ W  ++A 
Sbjct: 1   MKTHQFQPSLPPPANTTGPIGWLRKNLFNGPFNTIATLTLGYLAAQGIWNILDWAIINAN 60

Query: 70  WIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSIL 129
           W G+ R  CT              ACW FI  R+EQF++G YP A+ WRP L F+T +I 
Sbjct: 61  WSGTTRNDCTL-----------EGACWVFISARWEQFMYGFYPAAELWRPRLFFITLAIF 109

Query: 130 LTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGI 188
           +  +     P++    ++   ++P F+  +LYGGL GL +VET  WGGLLVTL+I+  GI
Sbjct: 110 VALLAYEKTPKRGWIWLVFVNIYPFFAAILLYGGLFGLEVVETHKWGGLLVTLIIALVGI 169

Query: 189 IISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDK 248
           I S+P+G+ LALGR S++P++R  C  +IE++RGVPL+TVLFMAS+MLPLFL +  +++K
Sbjct: 170 IASLPIGVALALGRRSDMPIIRSLCTVYIEVWRGVPLITVLFMASVMLPLFLSEGSEINK 229

Query: 249 LLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIP 308
           LLRAL+GV  F++AY+AEV+RGGLQ+I KGQ+EAA++LGLSY +KM LII+PQ +K  IP
Sbjct: 230 LLRALIGVVMFSAAYMAEVIRGGLQAIPKGQYEAADALGLSYWKKMGLIILPQALKITIP 289

Query: 309 GIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFS 368
            IVNTFIGLFKD+SL+ II MFD+LGI +   ++  W+   T +   +F+  VFWIFCF 
Sbjct: 290 SIVNTFIGLFKDTSLVLIIGMFDVLGIGQSANTDPNWLGFATES--YVFVALVFWIFCFG 347

Query: 369 ISLYSVFIEKTLHKGSKK 386
           +S YS+++E  LH G K+
Sbjct: 348 MSRYSIWLEGKLHTGHKR 365


>gi|27365996|ref|NP_761524.1| amino acid ABC transporter permease [Vibrio vulnificus CMCP6]
 gi|27362196|gb|AAO11051.1| Amino acid ABC transporter, permease protein [Vibrio vulnificus
           CMCP6]
          Length = 365

 Score =  350 bits (897), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 175/372 (47%), Positives = 251/372 (67%), Gaps = 15/372 (4%)

Query: 17  QPSLPPVYQR-GIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNR 75
           QP LPP     G+I W+ KN F +P + +LT ++    + ++  +  W FL A W+GS R
Sbjct: 7   QPDLPPPANTVGVIGWMRKNLFNSPVNSVLTLVLAYFAISTLWYVADWAFLSADWVGSTR 66

Query: 76  TVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLI 135
             CT              ACW FI  R+EQF++G YP A+ WRP L ++T +I    +  
Sbjct: 67  DACTR-----------EGACWVFISVRWEQFMYGFYPEAELWRPRLFYITLAIFTLLLAY 115

Query: 136 PSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPL 194
              P++    +    ++P     +LYGG+ GL +VET  WGGLLVTL+I+  GI++S+P+
Sbjct: 116 EKTPKRMWIWLFFVNIYPFIVAALLYGGVFGLEVVETHKWGGLLVTLIIALVGIVVSLPI 175

Query: 195 GILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALL 254
           G+ LALGR S++P++R  C  +IE++RGVPL+TVLFMAS+MLPLFL +  + DKL+RAL+
Sbjct: 176 GVALALGRRSDMPIIRSLCTVYIEVWRGVPLITVLFMASVMLPLFLSEGSETDKLIRALI 235

Query: 255 GVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTF 314
           GV  F++AY+AEV+RGGLQ+I KGQ+EAA++LGL+Y +KM LII+PQ +K  IP IVNTF
Sbjct: 236 GVVMFSAAYMAEVVRGGLQAIPKGQYEAADALGLTYWKKMGLIILPQALKITIPSIVNTF 295

Query: 315 IGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSV 374
           IGLFKD+SL+ II MFD+LGI +   ++  W+   T +   +F+  VFW+FCF +S YS+
Sbjct: 296 IGLFKDTSLVLIIGMFDVLGIGQAANTDPEWLGFATES--YVFVALVFWVFCFGMSRYSI 353

Query: 375 FIEKTLHKGSKK 386
           ++E  LH G K+
Sbjct: 354 WLENKLHTGHKR 365


>gi|153835217|ref|ZP_01987884.1| general L-amino acid transport system permease protein AapM [Vibrio
           harveyi HY01]
 gi|148868283|gb|EDL67415.1| general L-amino acid transport system permease protein AapM [Vibrio
           harveyi HY01]
          Length = 365

 Score =  350 bits (897), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 175/372 (47%), Positives = 253/372 (68%), Gaps = 15/372 (4%)

Query: 17  QPSLPPVYQR-GIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNR 75
           QP LPP     G+I W+ KN F  P + ++T ++  ++  ++  II W F++A WIG+ R
Sbjct: 7   QPDLPPPANTVGVIGWLRKNLFNGPVNSIVTLILAYIVFSALWNIIDWAFVNADWIGATR 66

Query: 76  TVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLI 135
             CT              ACW FI  R+EQF++G YP ++ WRP L ++T +I    +  
Sbjct: 67  DDCTR-----------EGACWVFISVRWEQFMYGFYPESELWRPRLFYITLAIFTVLLAY 115

Query: 136 PSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPL 194
              P++    +    ++P     +LYGG+ GL +VET  WGGLLVTL+I+  GI++S+P+
Sbjct: 116 EKTPKRIWIWLFFVNIYPFIIAALLYGGVFGLEVVETHKWGGLLVTLIIALVGIVVSLPI 175

Query: 195 GILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALL 254
           G+ LALGR S++P++R  C  +IE++RGVPL+TVLFMAS+MLPLFL +  + DKL+RAL+
Sbjct: 176 GVALALGRRSDMPIIRSICTVYIEVWRGVPLITVLFMASVMLPLFLAEGSETDKLIRALI 235

Query: 255 GVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTF 314
           GV  F++AY+AEV+RGGLQ+I KGQ+EAA++LGLSY +KM LII+PQ +K  IP IVNTF
Sbjct: 236 GVVMFSAAYMAEVVRGGLQAIPKGQYEAADALGLSYWKKMGLIILPQALKITIPSIVNTF 295

Query: 315 IGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSV 374
           IGLFKD+SL+ II MFD+LGI +   ++  W+   T +   +F+  VFW+FCF +S YS+
Sbjct: 296 IGLFKDTSLVLIIGMFDVLGIGQAANTDPEWLGFATES--YVFVALVFWVFCFGMSRYSI 353

Query: 375 FIEKTLHKGSKK 386
           ++E  LH G K+
Sbjct: 354 WLENKLHTGHKR 365


>gi|2961078|gb|AAC05642.1| unknown [Pseudomonas marginalis pv. alfalfae]
          Length = 365

 Score =  349 bits (896), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 181/372 (48%), Positives = 246/372 (66%), Gaps = 15/372 (4%)

Query: 17  QPSLPPVYQR-GIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNR 75
           +P +PP  +  G +AW+  N F +  + LLT L   L+   +P I+ W  LDA W+G+ R
Sbjct: 7   KPDMPPPSKVFGPMAWMRANLFSSWLNTLLTLLAFYLIYLVVPPILQWAILDANWVGTTR 66

Query: 76  TVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLI 135
             CT              ACW FI  R+ QF++G YP   RWR  L      + + P+ I
Sbjct: 67  ADCTK-----------EGACWVFIQQRFGQFMYGYYPGDLRWRVDLTVWLAIVGVAPLFI 115

Query: 136 PSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPL 194
             FPRK +  +    L+PI ++F+L+GG+ GL+ V TS WGGL++TLVI+  GI  ++PL
Sbjct: 116 SRFPRKAVYGLSFLVLYPIIAYFLLHGGIFGLTNVATSQWGGLMLTLVIATVGIAGALPL 175

Query: 195 GILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALL 254
           GI+LALGR SN+P +R  C+TFIE +RGVPL+TVLFM+S+MLPLFLP+   +DKLLRAL+
Sbjct: 176 GIVLALGRRSNMPAIRVVCVTFIEFWRGVPLITVLFMSSVMLPLFLPEGMGIDKLLRALI 235

Query: 255 GVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTF 314
           GV  F SAY+AEV+RGGLQ+I KGQ+EAA ++GL Y + M L+I+PQ +K VIPGIVNTF
Sbjct: 236 GVILFQSAYVAEVVRGGLQAIPKGQYEAAAAMGLGYWRSMGLVILPQALKMVIPGIVNTF 295

Query: 315 IGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSV 374
           I LFKD+SL+ II +FDLL  V+   ++  W+     T G +F   VFWIFCF +S YS+
Sbjct: 296 IALFKDTSLVIIIGLFDLLNSVKQAAADPKWLG--MATEGYVFAALVFWIFCFGMSRYSI 353

Query: 375 FIEKTLHKGSKK 386
            +E  L  G K+
Sbjct: 354 HLEHKLDTGHKR 365


>gi|66044327|ref|YP_234168.1| amino acid ABC transporter permease [Pseudomonas syringae pv.
           syringae B728a]
 gi|63255034|gb|AAY36130.1| Amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine [Pseudomonas syringae pv. syringae
           B728a]
          Length = 365

 Score =  348 bits (894), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 179/372 (48%), Positives = 249/372 (66%), Gaps = 15/372 (4%)

Query: 17  QPSLPPVYQR-GIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNR 75
           +P +PP  +  G +AW+ +N F +  + LLT   + L+   +P II W  LDA WIG+ +
Sbjct: 7   KPDMPPPGKVFGPMAWMRQNLFSSWINTLLTLFSLYLIYLVVPPIISWALLDANWIGTTK 66

Query: 76  TVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLI 135
             CT              ACW FI  R+ QF++G +P   RWR  L  +   +   P+ I
Sbjct: 67  ADCTKA-----------GACWVFIEQRFGQFMYGYFPNELRWRVDLTAILAIVGAAPLFI 115

Query: 136 PSFPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISMPL 194
             FPRK +  I    ++P+ +F++L+GG  GL+ V TS WGGL++TLVI+  GI+ ++PL
Sbjct: 116 SKFPRKAVYGIAFLVIYPVVAFYLLHGGAFGLTNVPTSQWGGLMLTLVIATVGIVGALPL 175

Query: 195 GILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALL 254
           GILLALGR SN+P +R  C+TFIE +RGVPL+TVLFM+S+MLPLF+P+  + DKLLRAL+
Sbjct: 176 GILLALGRRSNMPAVRVVCVTFIEFWRGVPLITVLFMSSVMLPLFMPEGMNFDKLLRALI 235

Query: 255 GVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTF 314
           GV  F SAYIAEV+RGG+Q+I KGQ+EAA+++GL Y + M L+I+PQ +K VIPGIVNTF
Sbjct: 236 GVILFQSAYIAEVVRGGMQAIPKGQYEAASAMGLGYWRSMGLVILPQALKMVIPGIVNTF 295

Query: 315 IGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSV 374
           I LFKD+SL+ II +FDLL  V+   ++  W+     T G +F   VFWIFCF +S YS+
Sbjct: 296 IALFKDTSLVIIIGLFDLLNSVKQATADPAWLGMA--TEGYVFAALVFWIFCFGMSRYSM 353

Query: 375 FIEKTLHKGSKK 386
            +E+ L  G K+
Sbjct: 354 HLERKLDTGHKR 365


>gi|54309365|ref|YP_130385.1| putative ABC-type amino acid transport system, permease component
           [Photobacterium profundum SS9]
 gi|46913801|emb|CAG20583.1| putative ABC-type amino acid transport system, permease component
           [Photobacterium profundum SS9]
          Length = 365

 Score =  348 bits (894), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 176/372 (47%), Positives = 253/372 (68%), Gaps = 15/372 (4%)

Query: 17  QPSLPPVYQR-GIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNR 75
           QP LPP     GII W  ++ F +  + ++T  +    +  +  +I W F++A WIG  R
Sbjct: 7   QPDLPPPANTVGIIGWSRQHLFSSITNSIVTLFLAYFAITGLWAVIQWAFINADWIGDTR 66

Query: 76  TVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLI 135
             C+            + ACW FI  R++QF+FG YP  Q WRP L + T +I ++ ++I
Sbjct: 67  DACSR-----------DGACWVFINVRFDQFMFGFYPADQLWRPKLFYFTLAIFISLLVI 115

Query: 136 PSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPL 194
              P +    +    ++P F+ F+LYGG+ GL +V+T LWGGLLVTLVI+  GI++S+P+
Sbjct: 116 EKTPGRKWIWLFFVNVYPFFAGFLLYGGVFGLEVVDTHLWGGLLVTLVIAIVGIVVSLPI 175

Query: 195 GILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALL 254
           G+ LALGR S++P++R  C  +IE++RGVPL+TVLFMAS++LPLFL    ++DKL RAL+
Sbjct: 176 GVALALGRRSDMPIIRSICTIYIEIWRGVPLITVLFMASVLLPLFLTSEMEMDKLFRALI 235

Query: 255 GVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTF 314
           GV  F++AY+AEV+RGGLQ+I +GQ+EAA++LGLSY + M LI++PQ +K  IP IVNTF
Sbjct: 236 GVVLFSAAYMAEVVRGGLQAIPRGQYEAADALGLSYWKSMYLIVLPQALKITIPSIVNTF 295

Query: 315 IGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSV 374
           IGLFKD+SL+ II MFD+LGI +   S+  W+   T +   IF+  VFW+FCFS+S YS+
Sbjct: 296 IGLFKDTSLVLIIGMFDVLGIGQAANSDPEWLGFSTES--YIFVALVFWVFCFSMSRYSI 353

Query: 375 FIEKTLHKGSKK 386
           F+E  LH G K+
Sbjct: 354 FLENKLHTGHKR 365


>gi|312959112|ref|ZP_07773631.1| amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine [Pseudomonas fluorescens WH6]
 gi|311286882|gb|EFQ65444.1| amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine [Pseudomonas fluorescens WH6]
          Length = 365

 Score =  348 bits (894), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 181/372 (48%), Positives = 247/372 (66%), Gaps = 15/372 (4%)

Query: 17  QPSLPPVYQR-GIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNR 75
           +P +PP  +  G +AW+  N F +  + LLT L I L+   +P I+HW  LDA W+G+ R
Sbjct: 7   KPDMPPPSKVFGPVAWMRANLFSSWLNTLLTLLSIYLVYLVVPPILHWAILDANWVGTTR 66

Query: 76  TVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLI 135
             CT              ACW FI  R+ QF++G YP   RWR  L      + + P+ I
Sbjct: 67  ADCTK-----------EGACWVFIQQRFGQFMYGYYPGDLRWRVDLTVWLAIVGVAPLFI 115

Query: 136 PSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPL 194
             F  K +  +    L+PI ++F+L+GG+ GL+ V TS WGGL++TLVI+  GI  ++PL
Sbjct: 116 SRFAHKAIYGLSFLVLYPIVAYFLLHGGVFGLANVATSQWGGLMLTLVIATVGIAGALPL 175

Query: 195 GILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALL 254
           GI+LALGR SN+P +R  C+TFIE +RGVPL+TVLFM+S+MLPLFLP+  + DKLLRAL+
Sbjct: 176 GIVLALGRRSNMPAIRVVCVTFIEFWRGVPLITVLFMSSVMLPLFLPEGMNFDKLLRALI 235

Query: 255 GVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTF 314
           GV  F SAY+AEV+RGGLQ+I KGQ+EAA ++GL Y + M L+I+PQ +K VIPGIVNTF
Sbjct: 236 GVILFQSAYVAEVVRGGLQAIPKGQYEAAAAMGLGYWRSMGLVILPQALKLVIPGIVNTF 295

Query: 315 IGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSV 374
           I LFKD+SL+ II +FDLL  V+   ++  W+     T G +F   VFWIFCF +S YS+
Sbjct: 296 IALFKDTSLVIIIGLFDLLNSVKQAAADPKWLG--MATEGYVFAALVFWIFCFGMSRYSM 353

Query: 375 FIEKTLHKGSKK 386
            +E+ L  G K+
Sbjct: 354 HLERKLDTGHKR 365


>gi|330975708|gb|EGH75774.1| amino acid ABC transporter permease [Pseudomonas syringae pv.
           aptata str. DSM 50252]
          Length = 365

 Score =  348 bits (894), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 179/372 (48%), Positives = 249/372 (66%), Gaps = 15/372 (4%)

Query: 17  QPSLPPVYQR-GIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNR 75
           +P +PP  +  G +AW+ +N F +  + LLT   + L+   +P II W  LDA WIG+ +
Sbjct: 7   KPDMPPPGKVFGPVAWMRQNLFSSWINTLLTLFSLYLIYLVVPPIISWSLLDANWIGTTK 66

Query: 76  TVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLI 135
             CT              ACW FI  R+ QF++G +P   RWR  L  +   +   P+ I
Sbjct: 67  ADCTKA-----------GACWVFIEQRFGQFMYGYFPNELRWRVDLTAILAIVGAAPLFI 115

Query: 136 PSFPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISMPL 194
             FPRK +  I    ++P+ +F++L+GG  GL+ V TS WGGL++TLVI+  GI+ ++PL
Sbjct: 116 SKFPRKAVYGIAFLVIYPVVAFYLLHGGAFGLTNVPTSQWGGLMLTLVIATVGIVGALPL 175

Query: 195 GILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALL 254
           GILLALGR SN+P +R  C+TFIE +RGVPL+TVLFM+S+MLPLF+P+  + DKLLRAL+
Sbjct: 176 GILLALGRRSNMPAVRVVCVTFIEFWRGVPLITVLFMSSVMLPLFMPEGMNFDKLLRALI 235

Query: 255 GVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTF 314
           GV  F SAYIAEV+RGG+Q+I KGQ+EAA+++GL Y + M L+I+PQ +K VIPGIVNTF
Sbjct: 236 GVILFQSAYIAEVVRGGMQAIPKGQYEAASAMGLGYWRSMGLVILPQALKMVIPGIVNTF 295

Query: 315 IGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSV 374
           I LFKD+SL+ II +FDLL  V+   ++  W+     T G +F   VFWIFCF +S YS+
Sbjct: 296 IALFKDTSLVIIIGLFDLLNSVKQATADPAWLGMA--TEGYVFAALVFWIFCFGMSRYSM 353

Query: 375 FIEKTLHKGSKK 386
            +E+ L  G K+
Sbjct: 354 HLERKLDTGHKR 365


>gi|312881585|ref|ZP_07741363.1| hypothetical protein VIBC2010_10047 [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309370648|gb|EFP98122.1| hypothetical protein VIBC2010_10047 [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 365

 Score =  348 bits (894), Expect = 7e-94,   Method: Compositional matrix adjust.
 Identities = 176/372 (47%), Positives = 249/372 (66%), Gaps = 15/372 (4%)

Query: 17  QPSLPPVYQR-GIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNR 75
           QP LPP     G + W+ KN F  P + ++T ++  LL + +  I  W FL A WIG+ R
Sbjct: 7   QPDLPPPANTIGTVGWLRKNLFNGPVNSIVTIVLGYLLFWLLWNIFDWAFLKADWIGTTR 66

Query: 76  TVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLI 135
             C+              ACW FI +R+ QF++G YP  Q WRP L ++T +I    +  
Sbjct: 67  DACSK-----------EGACWVFIKERWGQFMYGFYPEEQLWRPRLFYITLAIFTALLAY 115

Query: 136 PSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPL 194
              P++F   +    ++P     +LYGG+ GL +VET  WGGLLVTL+I+  GI++S+P+
Sbjct: 116 EKTPKRFWIWLFFVNIYPFIIGALLYGGIFGLEVVETHKWGGLLVTLIIALVGIVVSLPI 175

Query: 195 GILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALL 254
           GI LALGR S +P++R  C  +IE++RGVPL+TVLFMAS+MLPLFL +  + DKL+RAL+
Sbjct: 176 GIALALGRRSEMPIIRSICTVYIEIWRGVPLITVLFMASVMLPLFLAEGSETDKLIRALI 235

Query: 255 GVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTF 314
           GV  F++AY+AEV+RGGLQ+I KGQ+EAA++LGL+Y +KM LII+PQ +K  IP IVNTF
Sbjct: 236 GVVMFSAAYMAEVIRGGLQAIPKGQYEAADALGLTYWKKMGLIILPQALKITIPSIVNTF 295

Query: 315 IGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSV 374
           IGLFKD+SL+ II MFD+LGI +   ++  W+   T +   +F+  VFW+FCF +S YS+
Sbjct: 296 IGLFKDTSLVLIIGMFDVLGIGQAANTDPEWLGFATES--YVFVALVFWVFCFGMSRYSI 353

Query: 375 FIEKTLHKGSKK 386
           ++E  LH G K+
Sbjct: 354 WLENKLHTGHKR 365


>gi|330962157|gb|EGH62417.1| amino acid ABC transporter permease [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 365

 Score =  348 bits (893), Expect = 9e-94,   Method: Compositional matrix adjust.
 Identities = 179/372 (48%), Positives = 249/372 (66%), Gaps = 15/372 (4%)

Query: 17  QPSLPPVYQR-GIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNR 75
           +P +PP  +  G +AW+ +N F +  + LLT   + L+   +P I+ W  LDA WIG+ +
Sbjct: 7   KPDMPPPGKVFGPVAWMRQNLFSSWINTLLTLFSLYLIYLIVPPILSWALLDANWIGTTK 66

Query: 76  TVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLI 135
             CT              ACW FI  R+ QF++G +P   RWR  L  +   +   P+ I
Sbjct: 67  EDCTKA-----------GACWVFIEQRFGQFMYGYFPNELRWRVDLTAILAIVGAAPLFI 115

Query: 136 PSFPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISMPL 194
             FPRK +  I    ++PI +F++L+GG  GL+ V TS WGGL++TLVI+  GI+ ++PL
Sbjct: 116 SKFPRKAVYGICFLVIYPIVAFYLLHGGAFGLTNVPTSQWGGLMLTLVIATVGIVGALPL 175

Query: 195 GILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALL 254
           GILLALGR SN+P +R  C+TFIE +RGVPL+TVLFM+S+MLPLF+P+  + DKLLRAL+
Sbjct: 176 GILLALGRRSNMPAVRVVCVTFIEFWRGVPLITVLFMSSVMLPLFMPEGMNFDKLLRALI 235

Query: 255 GVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTF 314
           GV  F SAYIAEV+RGG+Q+I KGQ+EAA+++GL Y + M L+I+PQ +K VIPGIVNTF
Sbjct: 236 GVILFQSAYIAEVVRGGMQAIPKGQYEAASAMGLGYWRSMGLVILPQALKMVIPGIVNTF 295

Query: 315 IGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSV 374
           I LFKD+SL+ II +FDLL  V+   ++  W+     T G +F   VFWIFCF +S YS+
Sbjct: 296 IALFKDTSLVIIIGLFDLLNSVKQATADPAWLGMA--TEGYVFAALVFWIFCFGMSRYSM 353

Query: 375 FIEKTLHKGSKK 386
            +E+ L  G K+
Sbjct: 354 HLERKLDTGHKR 365


>gi|209695502|ref|YP_002263431.1| general L-amino acid ABC transporter permease protein [Aliivibrio
           salmonicida LFI1238]
 gi|208009454|emb|CAQ79740.1| general L-amino acid ABC transporter permease protein [Aliivibrio
           salmonicida LFI1238]
          Length = 365

 Score =  348 bits (892), Expect = 9e-94,   Method: Compositional matrix adjust.
 Identities = 177/372 (47%), Positives = 253/372 (68%), Gaps = 15/372 (4%)

Query: 17  QPSLPPVYQR-GIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNR 75
           QP LPP     G + W+ ++ F  P + +LT +I  L    +   + W  ++A WIG+ R
Sbjct: 7   QPDLPPPPNTVGAVTWLKRHLFNGPINSILTLIIGYLAFSGLWNAVSWALINADWIGTTR 66

Query: 76  TVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLI 135
             C   S GG        ACW  I  R++QF++G YP A+ WRP L +   +I +  +  
Sbjct: 67  DAC---SSGG--------ACWVMINVRWDQFMYGFYPTAELWRPQLFYALLAIFVALLAY 115

Query: 136 PSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPL 194
              P+K    ++   +FP F+ F+LYGG+ GL +V+T LWGGLL+TLVI+  GI++S+P+
Sbjct: 116 EHTPKKVAIWLVFVNIFPFFAAFLLYGGVFGLPVVDTHLWGGLLITLVIAIVGIVVSLPI 175

Query: 195 GILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALL 254
           G+ LALGR S +P++R  C  +IE++RGVPL+TVLFMAS+MLPLFL +  ++DKL RAL+
Sbjct: 176 GVALALGRRSEMPIIRSMCTIYIEIWRGVPLITVLFMASVMLPLFLSEGMELDKLFRALI 235

Query: 255 GVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTF 314
           GV  F++AY+AEV+RGGLQ+I KGQ+EAA++LGL Y +KMRLII+PQ +K  IP IVNTF
Sbjct: 236 GVVLFSAAYMAEVIRGGLQAIPKGQYEAADALGLGYWKKMRLIILPQALKITIPSIVNTF 295

Query: 315 IGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSV 374
           IGLFKD+SL+ II MFD+LGI +   ++  W+   T +   +F+  VFW+FCFS+S YS+
Sbjct: 296 IGLFKDTSLVLIIGMFDVLGIGQAANTDPEWLGFSTES--YVFVALVFWVFCFSMSRYSI 353

Query: 375 FIEKTLHKGSKK 386
           ++E  LH G K+
Sbjct: 354 YLENKLHTGHKR 365


>gi|307546907|ref|YP_003899386.1| ABC transporter permease [Halomonas elongata DSM 2581]
 gi|307218931|emb|CBV44201.1| ABC-type transport system permease protein [Halomonas elongata DSM
           2581]
          Length = 364

 Score =  348 bits (892), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 174/374 (46%), Positives = 243/374 (64%), Gaps = 14/374 (3%)

Query: 12  RKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWI 71
           R  +++   PP  +RG++ W+H N F  P +  L+ + I LL  ++  +  W  +DA W+
Sbjct: 4   RTEMIEARRPPDMRRGVVGWLHANLFNGPLNSALSLVTIVLLAMALWPLAKWALIDADWL 63

Query: 72  GSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLT 131
           GS R  CT              ACW FI  R+E  I+G YP A+RWR  +V    ++L+ 
Sbjct: 64  GSTREACTG-----------EGACWVFISARFETIIYGFYPHAERWRVDIVLAMMALLIA 112

Query: 132 PMLIPSFPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIII 190
            + IP  P K    +     FPI +F +L GG  GL  V T  WGGL++TL ++  GI+ 
Sbjct: 113 WLAIPRLPAKRWAGLFALVGFPILAFVLLLGGHFGLEAVPTRQWGGLMLTLTVATVGIVG 172

Query: 191 SMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLL 250
           S+P+G++LALGR S +P++R  C+ FIE +RGVPL+TVLFMAS+MLPLF+P   + DKLL
Sbjct: 173 SLPIGVVLALGRRSKMPLVRSLCVVFIEFWRGVPLITVLFMASVMLPLFVPTEVEFDKLL 232

Query: 251 RALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGI 310
           RAL+G+  F SAY+AEV+RGGLQ+I  GQ EAA +LG+ Y ++M LI++PQ +K VIPGI
Sbjct: 233 RALIGIMFFWSAYMAEVVRGGLQAIPSGQEEAAKALGMGYWRRMGLIVLPQALKLVIPGI 292

Query: 311 VNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSIS 370
           VNTFI LFKD+SL+ II +FDLL I+R   ++S W+     T G +F   +FW+FCFS+S
Sbjct: 293 VNTFIALFKDTSLVLIIGLFDLLAIIRAGLTDSNWLGFA--TEGYVFAALMFWVFCFSMS 350

Query: 371 LYSVFIEKTLHKGS 384
            YS +IE+ LH G 
Sbjct: 351 RYSQYIERRLHTGH 364


>gi|269964207|ref|ZP_06178498.1| amino acid ABC transporter, permease protein [Vibrio harveyi 1DA3]
 gi|269831056|gb|EEZ85224.1| amino acid ABC transporter, permease protein [Vibrio harveyi 1DA3]
          Length = 365

 Score =  348 bits (892), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 172/372 (46%), Positives = 252/372 (67%), Gaps = 15/372 (4%)

Query: 17  QPSLPPVYQR-GIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNR 75
           QP LPP     G++ W+ KN F  P + ++T ++  ++  ++  I+ W F++A W+G+ R
Sbjct: 7   QPDLPPPANTVGVVGWLRKNLFNGPINSIVTLILAYIVFSALWNIVDWAFINADWVGTTR 66

Query: 76  TVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLI 135
             CT              ACW FI  R+EQF++G YP A+ WRP L ++T +I    +  
Sbjct: 67  DDCTR-----------EGACWVFISVRWEQFMYGFYPEAELWRPRLFYITLAIFTVLLAY 115

Query: 136 PSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPL 194
              P++    +    ++P     +LYGG+ GL +VET  WGGLLVTL+I+  GI++S+P+
Sbjct: 116 EKTPKRIWIWLFFVNIYPFIIAALLYGGVFGLEVVETHKWGGLLVTLIIALVGIVVSLPI 175

Query: 195 GILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALL 254
           G+ LALGR S++P++R  C  +IE++RGVPL+TVLFMAS+MLPLFL    + DKL+RAL+
Sbjct: 176 GVALALGRRSDMPIIRSICTVYIEVWRGVPLITVLFMASVMLPLFLAQGSETDKLIRALI 235

Query: 255 GVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTF 314
           GV  F++AY+AEV+RGGLQ+I KGQ+EAA++LGL+Y +KM LII+PQ +K  IP IVNTF
Sbjct: 236 GVVMFSAAYMAEVVRGGLQAIPKGQYEAADALGLTYWKKMGLIILPQALKITIPSIVNTF 295

Query: 315 IGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSV 374
           IGLFKD+SL+ II MFD+LGI +   ++  W+   T +   +F+  VFW+FCF +S YS+
Sbjct: 296 IGLFKDTSLVLIIGMFDVLGIGQAANTDPEWLGFATES--YVFVALVFWVFCFGMSRYSI 353

Query: 375 FIEKTLHKGSKK 386
           ++E  LH G K+
Sbjct: 354 WLENKLHTGHKR 365


>gi|170720092|ref|YP_001747780.1| polar amino acid ABC transporter inner membrane subunit
           [Pseudomonas putida W619]
 gi|169758095|gb|ACA71411.1| polar amino acid ABC transporter, inner membrane subunit
           [Pseudomonas putida W619]
          Length = 365

 Score =  347 bits (890), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 178/378 (47%), Positives = 247/378 (65%), Gaps = 15/378 (3%)

Query: 11  VRKRLLQPSLPP-VYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAV 69
           +   + +P +PP V   G++AW+  N F +  + LLT   + L+   +P ++ W  +DA 
Sbjct: 1   MNAHVFKPDMPPPVKTVGVLAWMRVNLFSSWLNTLLTLFAVYLVWLIVPPLLQWALIDAN 60

Query: 70  WIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSIL 129
           W+G+ R  CT              ACW FI  R+ QF++G YP   RWR  L      + 
Sbjct: 61  WVGTTRADCTK-----------EGACWVFIQQRFGQFMYGYYPAELRWRVDLTVWLAVLG 109

Query: 130 LTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGI 188
             P+ I  FPRK +  +    ++PI ++ +L+GG LGL  V TS WGGL++TLVI+  GI
Sbjct: 110 AAPLFIKRFPRKAVYGLGFLVVYPILAYTLLHGGYLGLESVPTSQWGGLMLTLVIATVGI 169

Query: 189 IISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDK 248
           + ++PLGILLALGR SN+P ++  C+TFIE +RGVPL+TVLFM+S+MLPLFLP+    DK
Sbjct: 170 VGALPLGILLALGRRSNMPAVKVVCVTFIEFWRGVPLITVLFMSSVMLPLFLPEGMSFDK 229

Query: 249 LLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIP 308
           LLRA++GV  F SAYIAEV+RGGLQ+I KGQ+EAA ++GL Y + M L+I+PQ +K VIP
Sbjct: 230 LLRAMIGVILFQSAYIAEVVRGGLQAIPKGQYEAAAAMGLGYWRSMGLVILPQALKLVIP 289

Query: 309 GIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFS 368
           GIVNTFI LFKD+SL+ II +FDLL  V+   ++  W+     T G +F   VFWIFCF 
Sbjct: 290 GIVNTFIALFKDTSLVIIIGLFDLLNSVKQAAADPAWLG--MATEGYVFAALVFWIFCFG 347

Query: 369 ISLYSVFIEKTLHKGSKK 386
           +S YS+ +E+ L  G K+
Sbjct: 348 MSRYSMHLERKLDTGHKR 365


>gi|330873113|gb|EGH07262.1| amino acid ABC transporter permease [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
 gi|330963201|gb|EGH63461.1| amino acid ABC transporter permease [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 365

 Score =  347 bits (890), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 178/372 (47%), Positives = 248/372 (66%), Gaps = 15/372 (4%)

Query: 17  QPSLPPVYQR-GIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNR 75
           +P +PP  +  G +AW+ +N F +  + LLT   + L+   +P I+ W  LDA WIG+ +
Sbjct: 7   KPDMPPPGKVFGPVAWMRQNLFSSWINTLLTLFSLYLIYLVVPPILSWALLDANWIGTTK 66

Query: 76  TVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLI 135
             CT              ACW FI  R+ QF++G +P   RWR  L  +   +   P+ I
Sbjct: 67  EDCTKA-----------GACWVFIEQRFGQFMYGYFPNELRWRVDLTAILAIVGAAPLFI 115

Query: 136 PSFPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISMPL 194
             FPRK +  I    ++P+ +F++L+GG  GL+ V TS WGGL++TLVI+  GI+ ++PL
Sbjct: 116 SKFPRKAVYGICFLVIYPVVAFYLLHGGAFGLTNVPTSQWGGLMLTLVIATVGIVGALPL 175

Query: 195 GILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALL 254
           GILLALGR SN+P +R  C+TFIE +RGVPL+TVLFM+S+MLPLF+P+  + DKLLRAL+
Sbjct: 176 GILLALGRRSNMPAVRVVCVTFIEFWRGVPLITVLFMSSVMLPLFMPEGMNFDKLLRALI 235

Query: 255 GVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTF 314
           GV  F SAYIAEV+RGG+Q+I KGQ+EAA+++GL Y + M L+I+PQ +K VIPGIVNTF
Sbjct: 236 GVILFQSAYIAEVVRGGMQAIPKGQYEAASAMGLGYWRAMGLVILPQALKMVIPGIVNTF 295

Query: 315 IGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSV 374
           I LFKD+SL+ II +FDLL  V+   ++  W+     T G +F   VFWIFCF +S YS+
Sbjct: 296 IALFKDTSLVIIIGLFDLLNSVKQATADPAWLGMA--TEGYVFAALVFWIFCFGMSRYSM 353

Query: 375 FIEKTLHKGSKK 386
            +E  L  G K+
Sbjct: 354 HLEHKLDTGHKR 365


>gi|153839325|ref|ZP_01991992.1| general L-amino acid transport system permease protein AapM [Vibrio
           parahaemolyticus AQ3810]
 gi|260366018|ref|ZP_05778496.1| general L-amino acid transport system permease protein AapM [Vibrio
           parahaemolyticus K5030]
 gi|260898003|ref|ZP_05906499.1| general L-amino acid transport system permease protein AapM [Vibrio
           parahaemolyticus Peru-466]
 gi|149747157|gb|EDM58145.1| general L-amino acid transport system permease protein AapM [Vibrio
           parahaemolyticus AQ3810]
 gi|308088044|gb|EFO37739.1| general L-amino acid transport system permease protein AapM [Vibrio
           parahaemolyticus Peru-466]
 gi|308114204|gb|EFO51744.1| general L-amino acid transport system permease protein AapM [Vibrio
           parahaemolyticus K5030]
 gi|328473626|gb|EGF44461.1| amino acid ABC transporter permease [Vibrio parahaemolyticus 10329]
          Length = 365

 Score =  347 bits (890), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 173/372 (46%), Positives = 252/372 (67%), Gaps = 15/372 (4%)

Query: 17  QPSLPPVYQR-GIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNR 75
           QP LPP     G++ W+ KN F  P + ++T ++  ++  ++  I+ W F++A WIGS R
Sbjct: 7   QPDLPPPSNTVGVVGWLRKNLFNGPVNSIVTLILAYIVFNALWHIVDWAFINADWIGSTR 66

Query: 76  TVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLI 135
             C+              ACW FI  R+EQF++G YP A+ WRP L ++T +I    +  
Sbjct: 67  DDCSR-----------EGACWVFISVRWEQFMYGFYPEAELWRPRLFYITLAIFTVLLAY 115

Query: 136 PSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPL 194
              P++    +    ++P     +LYGG+ GL +VET  WGGLLVTL+I+  GI++S+P+
Sbjct: 116 EKTPKRLWIWLFFVNIYPFIVAALLYGGVFGLEVVETHKWGGLLVTLIIALVGIVVSLPI 175

Query: 195 GILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALL 254
           G+ LALGR S++P++R  C  +IE++RGVPL+TVLFMAS+MLPLFL +  + DKL+RAL+
Sbjct: 176 GVALALGRRSDMPIIRSICTIYIEVWRGVPLITVLFMASVMLPLFLAEGSETDKLIRALI 235

Query: 255 GVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTF 314
           GV  F++AY+AEV+RGGLQ+I KGQ+EAA++LGLSY +K  LII+PQ +K  IP IVNTF
Sbjct: 236 GVVMFSAAYMAEVVRGGLQAIPKGQYEAADALGLSYWKKTGLIILPQALKITIPSIVNTF 295

Query: 315 IGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSV 374
           IGLFKD+SL+ II MFD+LGI +   ++  W+   T +   +F+  VFW+FCF +S YS+
Sbjct: 296 IGLFKDTSLVLIIGMFDVLGIGQAANTDPEWLGFATES--YVFVALVFWVFCFGMSRYSI 353

Query: 375 FIEKTLHKGSKK 386
           ++E  LH G K+
Sbjct: 354 WLENKLHTGHKR 365


>gi|262394186|ref|YP_003286040.1| amino acid ABC transporter permease [Vibrio sp. Ex25]
 gi|262337780|gb|ACY51575.1| amino acid ABC transporter permease protein [Vibrio sp. Ex25]
          Length = 365

 Score =  347 bits (889), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 174/372 (46%), Positives = 251/372 (67%), Gaps = 15/372 (4%)

Query: 17  QPSLPPVYQR-GIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNR 75
           QP LPP     G + W+ KN F  P + ++T ++  L+  +I  I+ W F++A WIGS R
Sbjct: 7   QPDLPPPANTVGFVGWMRKNLFNGPVNSIVTVILAYLVFSAIWHIVDWAFINADWIGSTR 66

Query: 76  TVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLI 135
             C+              ACW FI  R+EQF++G YP ++ WRP L ++T +I    +  
Sbjct: 67  DDCSR-----------EGACWVFISVRWEQFMYGFYPESELWRPRLFYITLAIFTVLLAY 115

Query: 136 PSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPL 194
              P++    +    ++P     +LYGG+ GL +V+T  WGGLLVTL+I+  GI++S+P+
Sbjct: 116 EKTPKRIWIWLFFVNIYPFIIAGLLYGGIFGLEVVDTHKWGGLLVTLIIALVGIVVSLPI 175

Query: 195 GILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALL 254
           G++LALGR S +P++R  C  +IE++RGVPL+TVLFMAS+MLPLF+ +  + DKL+RAL+
Sbjct: 176 GVVLALGRRSEMPIIRSICTVYIEVWRGVPLITVLFMASVMLPLFMSEGSETDKLIRALI 235

Query: 255 GVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTF 314
           GV  FASAY+AEV+RGGLQ+I KGQ+EAA++LGLSY +K  LII+PQ +K  IP IVNTF
Sbjct: 236 GVVMFASAYMAEVVRGGLQAIPKGQYEAADALGLSYWKKTGLIILPQALKITIPSIVNTF 295

Query: 315 IGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSV 374
           IGLFKD+SL+ II MFD+LGI +   ++  W+   T +   +F+  VFW+FCF +S YS+
Sbjct: 296 IGLFKDTSLVLIIGMFDVLGIGQAANTDPDWLGFATES--YVFVALVFWVFCFGMSRYSI 353

Query: 375 FIEKTLHKGSKK 386
           ++E  LH G K+
Sbjct: 354 WLENKLHTGHKR 365


>gi|229588543|ref|YP_002870662.1| putative amino acid ABC transporter membrane protein [Pseudomonas
           fluorescens SBW25]
 gi|229360409|emb|CAY47266.1| putative amino acid ABC transport system, membrane protein
           [Pseudomonas fluorescens SBW25]
          Length = 365

 Score =  346 bits (888), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 179/372 (48%), Positives = 245/372 (65%), Gaps = 15/372 (4%)

Query: 17  QPSLPPVYQR-GIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNR 75
           +P +PP  +  G +AW+  N F +  + LLT L   L+   +P I+ W  +DA W+G+ R
Sbjct: 7   KPDMPPPNKVFGPMAWMRANLFSSWLNTLLTLLAFYLIYLVVPPILSWAIIDANWVGTTR 66

Query: 76  TVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLI 135
             CT              ACW FI  R+ QF++G YP   RWR  L      + + P+ +
Sbjct: 67  ADCTK-----------EGACWVFIQQRFGQFMYGYYPGDLRWRVDLTVWLAIVGVAPLFV 115

Query: 136 PSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPL 194
             F RK +  +    L+PI +FF+L+GG+ GL+ V TS WGGL++TLVI+  GI  ++PL
Sbjct: 116 SRFQRKAIYGLSFLVLYPIIAFFLLHGGIFGLANVATSQWGGLMLTLVIATVGIAGALPL 175

Query: 195 GILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALL 254
           GI+LALGR SN+P +R  C+TFIE +RGVPL+TVLFM+S+MLPLFLP+   +DKLLRAL+
Sbjct: 176 GIMLALGRRSNMPAIRVVCVTFIEFWRGVPLITVLFMSSVMLPLFLPEGMGIDKLLRALI 235

Query: 255 GVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTF 314
           GV  F SAY+AEV+RGGLQ+I KGQ+EAA ++GL Y + M L+I+PQ +K VIPGIVNTF
Sbjct: 236 GVILFQSAYVAEVVRGGLQAIPKGQYEAAAAMGLGYWRSMGLVILPQALKMVIPGIVNTF 295

Query: 315 IGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSV 374
           I LFKD+SL+ II +FDLL  V+   ++  W+     T G +F   VFWIFCF +S YS+
Sbjct: 296 IALFKDTSLVIIIGLFDLLNSVKQAAADPKWLG--MATEGYVFAALVFWIFCFGMSRYSI 353

Query: 375 FIEKTLHKGSKK 386
            +E  L  G K+
Sbjct: 354 HLEHKLDTGHKR 365


>gi|269968793|ref|ZP_06182782.1| amino acid ABC transporter, permease protein [Vibrio alginolyticus
           40B]
 gi|269826605|gb|EEZ80950.1| amino acid ABC transporter, permease protein [Vibrio alginolyticus
           40B]
          Length = 365

 Score =  346 bits (888), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 173/372 (46%), Positives = 253/372 (68%), Gaps = 15/372 (4%)

Query: 17  QPSLPPVYQR-GIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNR 75
           QP LPP     G + W+ KN F  P + ++T ++  +++ +I  I+ W F++A WIGS R
Sbjct: 7   QPDLPPPANTVGFVGWMRKNLFNGPINSIVTVILAYIVVTAIWYIVDWAFINADWIGSTR 66

Query: 76  TVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLI 135
             C+            + ACW FI  R+EQF++G YP ++ WRP L ++T +I    +  
Sbjct: 67  DDCSR-----------DGACWVFISVRWEQFMYGFYPESELWRPRLFYITLAIFTVLLAY 115

Query: 136 PSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPL 194
              P++    +    ++P     +LYGG+ GL +V+T  WGGLLVTL+I+  GI++S+P+
Sbjct: 116 EKTPKRMWIWLFFVNIYPFIIAGLLYGGVFGLEVVDTHKWGGLLVTLIIALVGIVVSLPI 175

Query: 195 GILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALL 254
           G++LALGR S +P++R  C  +IE++RGVPL+TVLFMAS+MLPLF+ +  + DKL+RAL+
Sbjct: 176 GVVLALGRRSEMPIIRSICTVYIEVWRGVPLITVLFMASVMLPLFMSEGSETDKLIRALI 235

Query: 255 GVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTF 314
           GV  FASAY+AEV+RGGLQ+I KGQ+EAA++LGLSY +K  LII+PQ +K  IP IVNTF
Sbjct: 236 GVVMFASAYMAEVVRGGLQAIPKGQYEAADALGLSYWKKTGLIILPQALKITIPSIVNTF 295

Query: 315 IGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSV 374
           IGLFKD+SL+ II MFD+LGI +   ++  W+   T +   +F+  VFW+FCF +S YS+
Sbjct: 296 IGLFKDTSLVLIIGMFDVLGIGQAANTDPEWLGFATES--YVFVALVFWVFCFGMSRYSI 353

Query: 375 FIEKTLHKGSKK 386
           ++E  LH G K+
Sbjct: 354 WLENKLHTGHKR 365


>gi|28868468|ref|NP_791087.1| amino acid ABC transporter permease [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|213967084|ref|ZP_03395233.1| amino acid ABC transporter, permease protein [Pseudomonas syringae
           pv. tomato T1]
 gi|301386370|ref|ZP_07234788.1| amino acid ABC transporter, permease protein [Pseudomonas syringae
           pv. tomato Max13]
 gi|302062366|ref|ZP_07253907.1| amino acid ABC transporter, permease protein [Pseudomonas syringae
           pv. tomato K40]
 gi|302133058|ref|ZP_07259048.1| amino acid ABC transporter, permease protein [Pseudomonas syringae
           pv. tomato NCPPB 1108]
 gi|28851706|gb|AAO54782.1| amino acid ABC transporter, permease protein [Pseudomonas syringae
           pv. tomato str. DC3000]
 gi|213927926|gb|EEB61472.1| amino acid ABC transporter, permease protein [Pseudomonas syringae
           pv. tomato T1]
 gi|331015250|gb|EGH95306.1| amino acid ABC transporter, permease protein [Pseudomonas syringae
           pv. lachrymans str. M302278PT]
          Length = 365

 Score =  346 bits (888), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 178/372 (47%), Positives = 248/372 (66%), Gaps = 15/372 (4%)

Query: 17  QPSLPPVYQR-GIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNR 75
           +P +PP  +  G +AW+ +N F +  + LLT   + L+   +P I+ W  LDA WIG+ +
Sbjct: 7   KPDMPPPGKVFGPVAWMRQNLFSSWINTLLTLFSLYLIYLIVPPILSWALLDANWIGTTK 66

Query: 76  TVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLI 135
             CT              ACW FI  R+ QF++G +P   RWR  L  +   +   P+ I
Sbjct: 67  EDCTKA-----------GACWVFIEQRFGQFMYGYFPNELRWRVDLTAILAIVGAAPLFI 115

Query: 136 PSFPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISMPL 194
             FPRK +  I    ++P+ +F++L+GG  GL+ V TS WGGL++TLVI+  GI+ ++PL
Sbjct: 116 SKFPRKAVYGICFLLIYPVVAFYLLHGGAFGLTNVPTSQWGGLMLTLVIATVGIVGALPL 175

Query: 195 GILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALL 254
           GILLALGR SN+P +R  C+TFIE +RGVPL+TVLFM+S+MLPLF+P+  + DKLLRAL+
Sbjct: 176 GILLALGRRSNMPAVRVVCVTFIEFWRGVPLITVLFMSSVMLPLFMPEGMNFDKLLRALI 235

Query: 255 GVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTF 314
           GV  F SAYIAEV+RGG+Q+I KGQ+EAA+++GL Y + M L+I+PQ +K VIPGIVNTF
Sbjct: 236 GVILFQSAYIAEVVRGGMQAIPKGQYEAASAMGLGYWRAMGLVILPQALKMVIPGIVNTF 295

Query: 315 IGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSV 374
           I LFKD+SL+ II +FDLL  V+   ++  W+     T G +F   VFWIFCF +S YS+
Sbjct: 296 IALFKDTSLVIIIGLFDLLNSVKQATADPAWLGMA--TEGYVFAALVFWIFCFGMSRYSM 353

Query: 375 FIEKTLHKGSKK 386
            +E  L  G K+
Sbjct: 354 HLEHKLDTGHKR 365


>gi|330969252|gb|EGH69318.1| amino acid ABC transporter permease [Pseudomonas syringae pv.
           aceris str. M302273PT]
          Length = 365

 Score =  346 bits (888), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 178/372 (47%), Positives = 248/372 (66%), Gaps = 15/372 (4%)

Query: 17  QPSLPPVYQR-GIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNR 75
           +P +PP  +  G +AW+ +N F +  + LLT   + L+   +P II W  LDA WIG+ +
Sbjct: 7   KPDMPPPGKVFGPMAWMRQNLFSSWINTLLTLFSLYLIYLVVPPIISWALLDANWIGTTK 66

Query: 76  TVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLI 135
             CT              ACW FI  R+ QF++G +P   RWR  L  +   +   P+ I
Sbjct: 67  ADCTKA-----------GACWVFIEQRFGQFMYGYFPNELRWRVDLTAILAIVGAAPLFI 115

Query: 136 PSFPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISMPL 194
             FPRK +  I    ++P+ +F++L+GG  GL+ V TS WGGL++T VI+  GI+ ++PL
Sbjct: 116 SKFPRKAVYGIAFLVIYPVVAFYLLHGGAFGLTNVPTSQWGGLMLTPVIATVGIVGALPL 175

Query: 195 GILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALL 254
           GILLALGR SN+P +R  C+TFIE +RGVPL+TVLFM+S+MLPLF+P+  + DKLLRAL+
Sbjct: 176 GILLALGRRSNMPAVRVVCVTFIEFWRGVPLITVLFMSSVMLPLFMPEGMNFDKLLRALI 235

Query: 255 GVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTF 314
           GV  F SAYIAEV+RGG+Q+I KGQ+EAA+++GL Y + M L+I+PQ +K VIPGIVNTF
Sbjct: 236 GVILFQSAYIAEVVRGGMQAIPKGQYEAASAMGLGYWRSMGLVILPQALKMVIPGIVNTF 295

Query: 315 IGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSV 374
           I LFKD+SL+ II +FDLL  V+   ++  W+     T G +F   VFWIFCF +S YS+
Sbjct: 296 IALFKDTSLVIIIGLFDLLNSVKQATADPAWLGMA--TEGYVFAALVFWIFCFGMSRYSM 353

Query: 375 FIEKTLHKGSKK 386
            +E+ L  G K+
Sbjct: 354 HLERKLDTGHKR 365


>gi|26988034|ref|NP_743459.1| polar amino acid ABC transporter inner membrane subunit
           [Pseudomonas putida KT2440]
 gi|24982754|gb|AAN66923.1|AE016320_11 general amino acid ABC transporter, permease protein [Pseudomonas
           putida KT2440]
 gi|313500472|gb|ADR61838.1| AapM [Pseudomonas putida BIRD-1]
          Length = 365

 Score =  346 bits (888), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 177/378 (46%), Positives = 245/378 (64%), Gaps = 15/378 (3%)

Query: 11  VRKRLLQPSLPP-VYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAV 69
           +   + +P +PP V   G++AW+  N F +  + LLT   I L+   +P ++ W  +DA 
Sbjct: 1   MNAHVFKPDMPPPVKTVGVLAWMRANLFSSWLNTLLTLFAIYLVWLIVPPLLQWALIDAN 60

Query: 70  WIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSIL 129
           W+G+ R  CT              ACW F+  R+ QF++G YP   RWR  L      + 
Sbjct: 61  WVGTTRADCTK-----------EGACWVFVQQRFGQFMYGYYPTELRWRVDLTVWLAVLG 109

Query: 130 LTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGI 188
             P+ I  FPRK    +    L+P+ ++ +L+GG LGL  V TS WGGL++TLVI+  GI
Sbjct: 110 AAPLFIKRFPRKAFYGLGFLVLYPVLAYTLLHGGYLGLESVPTSQWGGLMLTLVIATVGI 169

Query: 189 IISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDK 248
           + ++PLGILLALGR S +P ++  C+TFIE +RGVPL+TVLFM+S+MLPLFLP+    DK
Sbjct: 170 VGALPLGILLALGRRSRMPAVKVVCVTFIEFWRGVPLITVLFMSSVMLPLFLPEGMSFDK 229

Query: 249 LLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIP 308
           LLRA++GV  F SAYIAEV+RGGLQ+I KGQ+EAA ++GL Y + M L+I+PQ +K VIP
Sbjct: 230 LLRAMIGVILFQSAYIAEVVRGGLQAIPKGQYEAAAAMGLGYWRSMGLVILPQALKLVIP 289

Query: 309 GIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFS 368
           GIVNTFI LFKD+SL+ II +FDLL  V+   ++  W+     T G +F   VFWIFCF 
Sbjct: 290 GIVNTFIALFKDTSLVIIIGLFDLLNSVKQAAADPAWLGMA--TEGYVFAALVFWIFCFG 347

Query: 369 ISLYSVFIEKTLHKGSKK 386
           +S YS+ +E+ L  G K+
Sbjct: 348 MSRYSMHLERKLDTGHKR 365


>gi|89073070|ref|ZP_01159617.1| putative ABC-type amino acid transport system, permease component
           [Photobacterium sp. SKA34]
 gi|89051288|gb|EAR56744.1| putative ABC-type amino acid transport system, permease component
           [Photobacterium sp. SKA34]
          Length = 365

 Score =  346 bits (887), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 176/378 (46%), Positives = 251/378 (66%), Gaps = 15/378 (3%)

Query: 11  VRKRLLQPSLPPVYQR-GIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAV 69
           + K   QP LPP     G+I W+  N F +    + T ++    +  I  I+ W F++A 
Sbjct: 1   MNKHQFQPDLPPPANTVGVIGWLRTNLFSSLTSSIATFILGYFAILGIWYIVEWAFINAD 60

Query: 70  WIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSIL 129
           W G +R  CT+ S           ACW FI  R++QF+FG YP  + WRP L + T ++ 
Sbjct: 61  WTGDSRDACTSSS-----------ACWTFINVRFDQFMFGFYPTEELWRPKLFYATLALF 109

Query: 130 LTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGI 188
           +  +     P +    +    ++P  + F+LYGG+ GL IVET LWGGLL+TLVI+  GI
Sbjct: 110 IGLLAYEKTPYRGWIWLFFVNIYPFLAGFLLYGGVFGLPIVETHLWGGLLITLVIAIVGI 169

Query: 189 IISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDK 248
           ++S+P+G++LALGR S +P++R  C  +IEL+RGVPL+TVLFMAS+MLPLFL    + +K
Sbjct: 170 VVSLPIGVVLALGRRSEMPIIRSICTVYIELWRGVPLITVLFMASVMLPLFLSAEMETNK 229

Query: 249 LLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIP 308
           L+RAL+GV  F++AY+AEV+RGGLQ+I KGQ+EAA++LGL+Y +KM LI++PQ +K  IP
Sbjct: 230 LIRALIGVVMFSAAYMAEVIRGGLQAIPKGQYEAADALGLTYWKKMYLIVLPQALKITIP 289

Query: 309 GIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFS 368
            IVNTFIGLFKD+SL+ II MFD+LGI +   S+  W+   T +   +F+  VFWIFCF 
Sbjct: 290 SIVNTFIGLFKDTSLVLIIGMFDVLGIGQAATSDPEWLGFATES--YVFVALVFWIFCFG 347

Query: 369 ISLYSVFIEKTLHKGSKK 386
           +S YS+++E  LH G K+
Sbjct: 348 MSRYSIYLENKLHTGHKR 365


>gi|254508776|ref|ZP_05120888.1| ABC-type amino acid transport system, permease component [Vibrio
           parahaemolyticus 16]
 gi|219548296|gb|EED25309.1| ABC-type amino acid transport system, permease component [Vibrio
           parahaemolyticus 16]
          Length = 365

 Score =  345 bits (886), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 172/378 (45%), Positives = 251/378 (66%), Gaps = 15/378 (3%)

Query: 11  VRKRLLQPSLPPVYQR-GIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAV 69
           +++    P LPP     G++ W+ KN F  P + ++T ++  L    +  I+ W FL A 
Sbjct: 1   MKEHQFLPDLPPPSNTVGVVGWLRKNLFNGPVNSVVTVILAYLAAVLLWNIVDWAFLKAD 60

Query: 70  WIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSIL 129
           W+G+ R  C+            + ACW FI  R+EQF++G YP  + WRP L ++T +I 
Sbjct: 61  WVGTTRDACSR-----------DGACWVFISVRWEQFMYGFYPQEELWRPRLFYITLAIF 109

Query: 130 LTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGI 188
              +     P++    +    ++P     +LYGG+ GL +VET  WGGLLVTL+I+  GI
Sbjct: 110 TVLLAYEKTPKRMWIWLFFVNVYPFIIAALLYGGVFGLEVVETHKWGGLLVTLIIALVGI 169

Query: 189 IISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDK 248
           ++S+P+G+ LALGR S +P++R  C  +IE++RGVPL+TVLFMAS+MLPLFL +  + DK
Sbjct: 170 VVSLPIGVALALGRRSEMPIIRSICTVYIEVWRGVPLITVLFMASVMLPLFLSEGSETDK 229

Query: 249 LLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIP 308
           L+RAL+GV  F++AY+AEV+RGGLQ+I KGQ+EAA++LGLSY +KM LII+PQ +K  IP
Sbjct: 230 LIRALIGVVMFSAAYMAEVVRGGLQAIPKGQYEAADALGLSYWKKMGLIILPQALKITIP 289

Query: 309 GIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFS 368
            IVNTFIGLFKD+SL+ II MFD+LGI +   ++  W+   T +   +F+  VFW+FCF 
Sbjct: 290 SIVNTFIGLFKDTSLVLIIGMFDVLGIGQAANTDPEWLGFATES--YVFVALVFWVFCFG 347

Query: 369 ISLYSVFIEKTLHKGSKK 386
           +S YS+++E  LH G K+
Sbjct: 348 MSRYSIWLENKLHTGHKR 365


>gi|71737094|ref|YP_273400.1| amino acid ABC transporter permease [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|71557647|gb|AAZ36858.1| amino acid ABC transporter, permease protein [Pseudomonas syringae
           pv. phaseolicola 1448A]
          Length = 365

 Score =  345 bits (886), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 178/372 (47%), Positives = 248/372 (66%), Gaps = 15/372 (4%)

Query: 17  QPSLPPVYQR-GIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNR 75
           +P +PP  +  G +AW+ +N F +  + LLT   + L+   +P II W  LDA W+G+ +
Sbjct: 7   KPDMPPPGKVFGPMAWMRQNLFSSWINTLLTLFSLYLIYLVVPPIISWALLDANWVGTTK 66

Query: 76  TVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLI 135
             CT              ACW FI  R+ QF++G +P   RWR  L  +   +   P+ I
Sbjct: 67  ADCTKA-----------GACWVFIEQRFGQFMYGYFPNELRWRVDLTAILAIVGAAPLFI 115

Query: 136 PSFPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISMPL 194
             F RK +  I    ++PI +F++L+GG  GL+ V TS WGGL++TLVI+  GI+ ++PL
Sbjct: 116 SKFQRKAVYGIAFLVIYPIVAFYLLHGGAFGLTNVPTSQWGGLMLTLVIATVGIVGALPL 175

Query: 195 GILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALL 254
           GILLALGR SN+P +R  C+TFIE +RGVPL+TVLFM+S+MLPLF+P+  + DKLLRAL+
Sbjct: 176 GILLALGRRSNMPAVRVVCVTFIEFWRGVPLITVLFMSSVMLPLFMPEGMNFDKLLRALI 235

Query: 255 GVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTF 314
           GV  F SAYIAEV+RGG+Q+I KGQ+EAA+++GL Y + M L+I+PQ +K VIPGIVNTF
Sbjct: 236 GVILFQSAYIAEVVRGGMQAIPKGQYEAASAMGLGYWRSMGLVILPQALKMVIPGIVNTF 295

Query: 315 IGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSV 374
           I LFKD+SL+ II +FDLL  V+   ++  W+     T G +F   VFWIFCF +S YS+
Sbjct: 296 IALFKDTSLVIIIGLFDLLNSVKQATADPAWLGMA--TEGYVFAALVFWIFCFGMSRYSM 353

Query: 375 FIEKTLHKGSKK 386
            +E+ L  G K+
Sbjct: 354 HLERKLDTGHKR 365


>gi|330887727|gb|EGH20388.1| amino acid ABC transporter permease [Pseudomonas syringae pv. mori
           str. 301020]
          Length = 365

 Score =  345 bits (886), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 178/372 (47%), Positives = 248/372 (66%), Gaps = 15/372 (4%)

Query: 17  QPSLPPVYQR-GIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNR 75
           +P +PP  +  G +AW+ +N F +  + LLT   + L+   +P II W  LDA W+G+ +
Sbjct: 7   KPDMPPPGKVFGPMAWMRQNLFSSWINTLLTLFSLYLIYLVVPPIISWALLDANWVGTTK 66

Query: 76  TVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLI 135
             CT              ACW FI  R+ QF++G +P   RWR  L  +   +   P+ I
Sbjct: 67  EDCTKA-----------GACWVFIEQRFGQFMYGYFPNELRWRVDLTAILAIVGAAPLFI 115

Query: 136 PSFPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISMPL 194
             F RK +  I    ++PI +F++L+GG  GL+ V TS WGGL++TLVI+  GI+ ++PL
Sbjct: 116 SKFQRKAVYGIAFLVIYPIVAFYLLHGGAFGLTNVPTSQWGGLMLTLVIATVGIVGALPL 175

Query: 195 GILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALL 254
           GILLALGR SN+P +R  C+TFIE +RGVPL+TVLFM+S+MLPLF+P+  + DKLLRAL+
Sbjct: 176 GILLALGRRSNMPAVRVVCVTFIEFWRGVPLITVLFMSSVMLPLFMPEGMNFDKLLRALI 235

Query: 255 GVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTF 314
           GV  F SAYIAEV+RGG+Q+I KGQ+EAA+++GL Y + M L+I+PQ +K VIPGIVNTF
Sbjct: 236 GVILFQSAYIAEVVRGGMQAIPKGQYEAASAMGLGYWRSMGLVILPQALKMVIPGIVNTF 295

Query: 315 IGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSV 374
           I LFKD+SL+ II +FDLL  V+   ++  W+     T G +F   VFWIFCF +S YS+
Sbjct: 296 IALFKDTSLVIIIGLFDLLNSVKQATADPAWLGMA--TEGYVFAALVFWIFCFGMSRYSM 353

Query: 375 FIEKTLHKGSKK 386
            +E+ L  G K+
Sbjct: 354 HLERKLDTGHKR 365


>gi|91227963|ref|ZP_01262073.1| amino acid ABC transporter, permease protein [Vibrio alginolyticus
           12G01]
 gi|91188284|gb|EAS74582.1| amino acid ABC transporter, permease protein [Vibrio alginolyticus
           12G01]
          Length = 365

 Score =  345 bits (886), Expect = 6e-93,   Method: Compositional matrix adjust.
 Identities = 172/372 (46%), Positives = 253/372 (68%), Gaps = 15/372 (4%)

Query: 17  QPSLPPVYQR-GIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNR 75
           QP LPP     G + W+ KN F  P + ++T ++  +++ +I  I+ W F++A WIGS R
Sbjct: 7   QPDLPPPANTVGFVGWMRKNLFNGPINSIVTVILAYIVVTAIWYIVDWAFINADWIGSTR 66

Query: 76  TVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLI 135
             C+            + ACW FI  R+EQF++G YP ++ WRP L ++T ++    +  
Sbjct: 67  DDCSR-----------DGACWVFISVRWEQFMYGFYPESELWRPRLFYITLAMFTVLLAY 115

Query: 136 PSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPL 194
              P++    +    ++P     +LYGG+ GL +V+T  WGGLLVTL+I+  GI++S+P+
Sbjct: 116 EKTPKRMWIWLFFVNIYPFIIAGLLYGGVFGLEVVDTHKWGGLLVTLIIALVGIVVSLPI 175

Query: 195 GILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALL 254
           G++LALGR S +P++R  C  +IE++RGVPL+TVLFMAS+MLPLF+ +  + DKL+RAL+
Sbjct: 176 GVVLALGRRSEMPIIRSICTVYIEVWRGVPLITVLFMASVMLPLFMSEGSETDKLIRALI 235

Query: 255 GVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTF 314
           GV  FASAY+AEV+RGGLQ+I KGQ+EAA++LGLSY +K  LII+PQ +K  IP IVNTF
Sbjct: 236 GVVMFASAYMAEVVRGGLQAIPKGQYEAADALGLSYWKKTGLIILPQALKIAIPSIVNTF 295

Query: 315 IGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSV 374
           IGLFKD+SL+ II MFD+LGI +   ++  W+   T +   +F+  VFW+FCF +S YS+
Sbjct: 296 IGLFKDTSLVLIIGMFDVLGIGQAANTDPEWLGFATES--YVFVALVFWVFCFGMSRYSI 353

Query: 375 FIEKTLHKGSKK 386
           ++E  LH G K+
Sbjct: 354 WLENKLHTGHKR 365


>gi|257487408|ref|ZP_05641449.1| amino acid ABC transporter, permease protein [Pseudomonas syringae
           pv. tabaci ATCC 11528]
 gi|289628607|ref|ZP_06461561.1| amino acid ABC transporter, permease protein [Pseudomonas syringae
           pv. aesculi str. NCPPB3681]
 gi|330867830|gb|EGH02539.1| amino acid ABC transporter permease [Pseudomonas syringae pv.
           aesculi str. 0893_23]
 gi|331009000|gb|EGH89056.1| amino acid ABC transporter permease [Pseudomonas syringae pv.
           tabaci ATCC 11528]
          Length = 365

 Score =  345 bits (885), Expect = 6e-93,   Method: Compositional matrix adjust.
 Identities = 178/372 (47%), Positives = 248/372 (66%), Gaps = 15/372 (4%)

Query: 17  QPSLPPVYQR-GIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNR 75
           +P +PP  +  G +AW+ +N F +  + LLT   + L+   +P II W  LDA W+G+ +
Sbjct: 7   KPDMPPPGKVFGPMAWMRQNLFSSWINTLLTLFSLYLIYLVVPPIISWALLDANWVGTTK 66

Query: 76  TVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLI 135
             CT              ACW FI  R+ QF++G +P   RWR  L  +   +   P+ I
Sbjct: 67  EDCTKA-----------GACWVFIEQRFGQFMYGYFPNELRWRVDLTAVLAIVGAAPLFI 115

Query: 136 PSFPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISMPL 194
             F RK +  I    ++PI +F++L+GG  GL+ V TS WGGL++TLVI+  GI+ ++PL
Sbjct: 116 SKFQRKAVYGIAFLVIYPIVAFYLLHGGAFGLTNVPTSQWGGLMLTLVIATVGIVGALPL 175

Query: 195 GILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALL 254
           GILLALGR SN+P +R  C+TFIE +RGVPL+TVLFM+S+MLPLF+P+  + DKLLRAL+
Sbjct: 176 GILLALGRRSNMPAVRVVCVTFIEFWRGVPLITVLFMSSVMLPLFMPEGMNFDKLLRALI 235

Query: 255 GVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTF 314
           GV  F SAYIAEV+RGG+Q+I KGQ+EAA+++GL Y + M L+I+PQ +K VIPGIVNTF
Sbjct: 236 GVILFQSAYIAEVVRGGMQAIPKGQYEAASAMGLGYWRSMGLVILPQALKMVIPGIVNTF 295

Query: 315 IGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSV 374
           I LFKD+SL+ II +FDLL  V+   ++  W+     T G +F   VFWIFCF +S YS+
Sbjct: 296 IALFKDTSLVIIIGLFDLLNSVKQATADPAWLGMA--TEGYVFAALVFWIFCFGMSRYSM 353

Query: 375 FIEKTLHKGSKK 386
            +E+ L  G K+
Sbjct: 354 HLERKLDTGHKR 365


>gi|298485802|ref|ZP_07003881.1| ABC-type amino acid transport system, permease component yhdY
           [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
 gi|298159828|gb|EFI00870.1| ABC-type amino acid transport system, permease component yhdY
           [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
          Length = 365

 Score =  345 bits (885), Expect = 7e-93,   Method: Compositional matrix adjust.
 Identities = 178/372 (47%), Positives = 248/372 (66%), Gaps = 15/372 (4%)

Query: 17  QPSLPPVYQR-GIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNR 75
           +P +PP  +  G +AW+ +N F +  + LLT   + L+   +P II W  LDA W+G+ +
Sbjct: 7   KPDMPPPGKVFGPMAWLRQNLFSSWINTLLTLFSLYLIYLVVPPIISWALLDANWVGTTK 66

Query: 76  TVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLI 135
             CT              ACW FI  R+ QF++G +P   RWR  L  +   +   P+ I
Sbjct: 67  EDCTKA-----------GACWVFIEQRFGQFMYGYFPNELRWRVDLTAVLAIVGAAPLFI 115

Query: 136 PSFPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISMPL 194
             F RK +  I    ++PI +F++L+GG  GL+ V TS WGGL++TLVI+  GI+ ++PL
Sbjct: 116 SKFQRKAVYGIAFLVIYPIVAFYLLHGGAFGLTNVPTSQWGGLMLTLVIATVGIVGALPL 175

Query: 195 GILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALL 254
           GILLALGR SN+P +R  C+TFIE +RGVPL+TVLFM+S+MLPLF+P+  + DKLLRAL+
Sbjct: 176 GILLALGRRSNMPAVRVVCVTFIEFWRGVPLITVLFMSSVMLPLFMPEGMNFDKLLRALI 235

Query: 255 GVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTF 314
           GV  F SAYIAEV+RGG+Q+I KGQ+EAA+++GL Y + M L+I+PQ +K VIPGIVNTF
Sbjct: 236 GVILFQSAYIAEVVRGGMQAIPKGQYEAASAMGLGYWRSMGLVILPQALKMVIPGIVNTF 295

Query: 315 IGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSV 374
           I LFKD+SL+ II +FDLL  V+   ++  W+     T G +F   VFWIFCF +S YS+
Sbjct: 296 IALFKDTSLVIIIGLFDLLNSVKQATADPAWLGMA--TEGYVFAALVFWIFCFGMSRYSM 353

Query: 375 FIEKTLHKGSKK 386
            +E+ L  G K+
Sbjct: 354 HLERKLDTGHKR 365


>gi|148549628|ref|YP_001269730.1| polar amino acid ABC transporter inner membrane subunit
           [Pseudomonas putida F1]
 gi|148513686|gb|ABQ80546.1| polar amino acid ABC transporter, inner membrane subunit
           [Pseudomonas putida F1]
          Length = 365

 Score =  345 bits (885), Expect = 8e-93,   Method: Compositional matrix adjust.
 Identities = 176/378 (46%), Positives = 245/378 (64%), Gaps = 15/378 (3%)

Query: 11  VRKRLLQPSLPP-VYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAV 69
           +   + +P +PP V   G++AW+  N F +  + LLT   + L+   +P ++ W  +DA 
Sbjct: 1   MNAHVFKPDMPPPVKTVGVLAWMRANLFSSWLNTLLTLFALYLVWLIVPPLLQWALIDAN 60

Query: 70  WIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSIL 129
           W+G+ R  CT              ACW F+  R+ QF++G YP   RWR  L      + 
Sbjct: 61  WVGTTRADCTK-----------EGACWVFVQQRFGQFMYGYYPTELRWRVDLTVWLAMLG 109

Query: 130 LTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGI 188
             P+ I  FPRK    +    L+P+ ++ +L+GG LGL  V TS WGGL++TLVI+  GI
Sbjct: 110 AAPLFIKRFPRKAFYGLGFLVLYPVLAYTLLHGGYLGLESVPTSQWGGLMLTLVIATVGI 169

Query: 189 IISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDK 248
           + ++PLGILLALGR S +P ++  C+TFIE +RGVPL+TVLFM+S+MLPLFLP+    DK
Sbjct: 170 VGALPLGILLALGRRSRMPAVKVVCVTFIEFWRGVPLITVLFMSSVMLPLFLPEGMSFDK 229

Query: 249 LLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIP 308
           LLRA++GV  F SAYIAEV+RGGLQ+I KGQ+EAA ++GL Y + M L+I+PQ +K VIP
Sbjct: 230 LLRAMIGVILFQSAYIAEVVRGGLQAIPKGQYEAAAAMGLGYWRSMGLVILPQALKLVIP 289

Query: 309 GIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFS 368
           GIVNTFI LFKD+SL+ II +FDLL  V+   ++  W+     T G +F   VFWIFCF 
Sbjct: 290 GIVNTFIALFKDTSLVIIIGLFDLLNSVKQAAADPAWLGMA--TEGYVFAALVFWIFCFG 347

Query: 369 ISLYSVFIEKTLHKGSKK 386
           +S YS+ +E+ L  G K+
Sbjct: 348 MSRYSMHLERKLDTGHKR 365


>gi|330988311|gb|EGH86414.1| amino acid ABC transporter permease [Pseudomonas syringae pv.
           lachrymans str. M301315]
          Length = 365

 Score =  345 bits (884), Expect = 8e-93,   Method: Compositional matrix adjust.
 Identities = 178/372 (47%), Positives = 247/372 (66%), Gaps = 15/372 (4%)

Query: 17  QPSLPPVYQR-GIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNR 75
           +P +PP  +  G +AW+ +N F    + LLT   + L+   +P II W  LDA W+G+ +
Sbjct: 7   KPDMPPPGKVFGPMAWMRQNLFSNWINTLLTLFSLYLIYLVVPPIISWALLDANWVGTTK 66

Query: 76  TVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLI 135
             CT              ACW FI  R+ QF++G +P   RWR  L  +   +   P+ I
Sbjct: 67  EDCTKA-----------GACWVFIEQRFGQFMYGYFPNELRWRVDLTAVLAIVGAAPLFI 115

Query: 136 PSFPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISMPL 194
             F RK +  I    ++PI +F++L+GG  GL+ V TS WGGL++TLVI+  GI+ ++PL
Sbjct: 116 SKFQRKAVYGIAFLVIYPIVAFYLLHGGAFGLTNVPTSQWGGLMLTLVIATVGIVGALPL 175

Query: 195 GILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALL 254
           GILLALGR SN+P +R  C+TFIE +RGVPL+TVLFM+S+MLPLF+P+  + DKLLRAL+
Sbjct: 176 GILLALGRRSNMPAVRVVCVTFIEFWRGVPLITVLFMSSVMLPLFMPEGMNFDKLLRALI 235

Query: 255 GVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTF 314
           GV  F SAYIAEV+RGG+Q+I KGQ+EAA+++GL Y + M L+I+PQ +K VIPGIVNTF
Sbjct: 236 GVILFQSAYIAEVVRGGMQAIPKGQYEAASAMGLGYWRSMGLVILPQALKMVIPGIVNTF 295

Query: 315 IGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSV 374
           I LFKD+SL+ II +FDLL  V+   ++  W+     T G +F   VFWIFCF +S YS+
Sbjct: 296 IALFKDTSLVIIIGLFDLLNSVKQATADPAWLGMA--TEGYVFAALVFWIFCFGMSRYSM 353

Query: 375 FIEKTLHKGSKK 386
            +E+ L  G K+
Sbjct: 354 HLERKLDTGHKR 365


>gi|254225348|ref|ZP_04918960.1| amino acid ABC transporter, permease protein [Vibrio cholerae V51]
 gi|125622189|gb|EAZ50511.1| amino acid ABC transporter, permease protein [Vibrio cholerae V51]
          Length = 365

 Score =  345 bits (884), Expect = 8e-93,   Method: Compositional matrix adjust.
 Identities = 178/372 (47%), Positives = 250/372 (67%), Gaps = 15/372 (4%)

Query: 17  QPSLPP-VYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNR 75
           QPSLPP     G++ W+ KN F    + + T ++  L +  +  I+ W   +A W G+ R
Sbjct: 7   QPSLPPPSNTTGVVGWLRKNLFNGVFNSIATLVLGYLAIQGLLNILDWAIFNANWSGTTR 66

Query: 76  TVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLI 135
             CT              ACW FI  R+EQF++G YP A+ WRP L F T ++ +  +  
Sbjct: 67  NDCTL-----------EGACWVFISVRWEQFMYGFYPTAELWRPRLFFFTLALFVALLAY 115

Query: 136 PSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPL 194
              P++    ++   L+P F+  +LYGG+ GL +VET  WGGLLVTL+I+  GII S+P+
Sbjct: 116 EKTPKRGWIWLVFVNLYPFFAALLLYGGVFGLEVVETHKWGGLLVTLIIALVGIIASLPI 175

Query: 195 GILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALL 254
           G+ LALGR S++P++R  C  +IE++RGVPL+TVLFMAS+MLPLFL    ++DKLLRAL+
Sbjct: 176 GVALALGRRSDMPIIRSLCTVYIEVWRGVPLITVLFMASVMLPLFLSQGSEIDKLLRALI 235

Query: 255 GVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTF 314
           GV  F++AY+AEV+RGGLQ+I KGQ+EAA++LGLSY +KM LII+PQ +K  IP IVNTF
Sbjct: 236 GVVMFSAAYMAEVIRGGLQAIPKGQYEAADALGLSYWKKMGLIILPQALKITIPSIVNTF 295

Query: 315 IGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSV 374
           IGLFKD+SL+ II MFD+LGI +   ++  W+   T +   +F+  VFWIFCF +S YS+
Sbjct: 296 IGLFKDTSLVLIIGMFDVLGIGQSANTDPNWLGFATES--YVFVALVFWIFCFGMSRYSI 353

Query: 375 FIEKTLHKGSKK 386
           ++E  LH G K+
Sbjct: 354 WLEGKLHTGHKR 365


>gi|163800830|ref|ZP_02194730.1| amino acid ABC transporter, permease protein [Vibrio sp. AND4]
 gi|159175179|gb|EDP59976.1| amino acid ABC transporter, permease protein [Vibrio sp. AND4]
          Length = 365

 Score =  345 bits (884), Expect = 9e-93,   Method: Compositional matrix adjust.
 Identities = 172/372 (46%), Positives = 251/372 (67%), Gaps = 15/372 (4%)

Query: 17  QPSLPPVYQR-GIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNR 75
           QP LPP     G++ W+ KN F  P + ++T  +  ++  ++  I+ W F++A WIG+ R
Sbjct: 7   QPDLPPPANTIGVVGWLRKNLFNGPINSIVTLFLAYIVFSALWNILDWAFINADWIGTTR 66

Query: 76  TVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLI 135
             C+              ACW FI  R+EQF++G YP A+ WRP L ++T +I    +  
Sbjct: 67  DDCSR-----------EGACWVFISVRWEQFMYGFYPEAELWRPRLFYITLAIFTVLLAY 115

Query: 136 PSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPL 194
              P++    +    ++P     +LYGG+ GL +VET  WGGLLVTL+I+  GI++S+P+
Sbjct: 116 EKTPKRIWIWLFFVNIYPFIIAALLYGGVFGLEVVETHKWGGLLVTLIIALVGIVVSLPI 175

Query: 195 GILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALL 254
           G+ LALGR S++P++R  C  +IE++RGVPL+TVLFMAS+MLPLFL +  + DKL+RAL+
Sbjct: 176 GVALALGRRSDMPIIRSICTVYIEVWRGVPLITVLFMASVMLPLFLSEGSETDKLIRALI 235

Query: 255 GVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTF 314
           GV  F++AY+AEV+RGGLQ+I KGQ+EAA++LGLSY +K  LII+PQ +K  IP IVNTF
Sbjct: 236 GVVMFSAAYMAEVVRGGLQAIPKGQYEAADALGLSYWKKTGLIILPQALKITIPSIVNTF 295

Query: 315 IGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSV 374
           IGLFKD+SL+ II MFD+LGI +   ++  W+   T +   +F+  VFW+FCF +S YS+
Sbjct: 296 IGLFKDTSLVLIIGMFDVLGIGQAANTDPEWLGFATES--YVFVALVFWVFCFGMSRYSI 353

Query: 375 FIEKTLHKGSKK 386
           ++E  LH G K+
Sbjct: 354 WLENKLHTGHKR 365


>gi|229521466|ref|ZP_04410885.1| amino acid ABC transporter permease protein [Vibrio cholerae TM
           11079-80]
 gi|297578945|ref|ZP_06940873.1| amino acid ABC transporter [Vibrio cholerae RC385]
 gi|229341564|gb|EEO06567.1| amino acid ABC transporter permease protein [Vibrio cholerae TM
           11079-80]
 gi|297536539|gb|EFH75372.1| amino acid ABC transporter [Vibrio cholerae RC385]
          Length = 365

 Score =  345 bits (884), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 178/372 (47%), Positives = 250/372 (67%), Gaps = 15/372 (4%)

Query: 17  QPSLPP-VYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNR 75
           QPSLPP     G++ W+ KN F    + + T ++  L +  +  I+ W   +A W G+ R
Sbjct: 7   QPSLPPPSNTTGVVGWLRKNLFNGVFNSIATLVLGYLAIQGLLNILDWAIFNANWSGTTR 66

Query: 76  TVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLI 135
             CT              ACW FI  R+EQF++G YP A+ WRP L F T ++ +  +  
Sbjct: 67  NDCTL-----------EGACWVFISVRWEQFMYGFYPAAELWRPRLFFFTLALFVALLAY 115

Query: 136 PSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPL 194
              P++    ++   L+P F+  +LYGG+ GL +VET  WGGLLVTL+I+  GII S+P+
Sbjct: 116 EKTPKRGWIWLVFVNLYPFFAALLLYGGVFGLEVVETHKWGGLLVTLIIALVGIIASLPI 175

Query: 195 GILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALL 254
           G+ LALGR S++P++R  C  +IE++RGVPL+TVLFMAS+MLPLFL    ++DKLLRAL+
Sbjct: 176 GVALALGRRSDMPIIRSLCTVYIEVWRGVPLITVLFMASVMLPLFLSQGSEIDKLLRALI 235

Query: 255 GVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTF 314
           GV  F++AY+AEV+RGGLQ+I KGQ+EAA++LGLSY +KM LII+PQ +K  IP IVNTF
Sbjct: 236 GVVMFSAAYMAEVIRGGLQAIPKGQYEAADALGLSYWKKMGLIILPQALKITIPSIVNTF 295

Query: 315 IGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSV 374
           IGLFKD+SL+ II MFD+LGI +   ++  W+   T +   +F+  VFWIFCF +S YS+
Sbjct: 296 IGLFKDTSLVLIIGMFDVLGIGQSANTDPNWLGFATES--YVFVALVFWIFCFGMSRYSI 353

Query: 375 FIEKTLHKGSKK 386
           ++E  LH G K+
Sbjct: 354 WLEGKLHTGHKR 365


>gi|167035541|ref|YP_001670772.1| polar amino acid ABC transporter inner membrane subunit
           [Pseudomonas putida GB-1]
 gi|166862029|gb|ABZ00437.1| polar amino acid ABC transporter, inner membrane subunit
           [Pseudomonas putida GB-1]
          Length = 365

 Score =  344 bits (883), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 175/378 (46%), Positives = 245/378 (64%), Gaps = 15/378 (3%)

Query: 11  VRKRLLQPSLPP-VYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAV 69
           +   + +P +PP V   G++AW+  N F +  + LLT   + L+   +P ++ W  +DA 
Sbjct: 1   MNAHVFKPDMPPPVKTVGVLAWMRANLFSSWLNTLLTLFALYLVWLIVPPLLQWALIDAN 60

Query: 70  WIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSIL 129
           W+G+ R  CT              ACW F+  R+ QF++G YP   RWR  L      + 
Sbjct: 61  WVGTTRADCTK-----------EGACWVFVQQRFGQFMYGYYPAELRWRVDLTVWLAVLG 109

Query: 130 LTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGI 188
             P+ I  FPRK    +    L+P+ ++ +L+GG LGL  V TS WGGL++TLVI+  GI
Sbjct: 110 AAPLFIKRFPRKAFYGLGFLVLYPVLAYTLLHGGYLGLDSVPTSQWGGLMLTLVIATVGI 169

Query: 189 IISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDK 248
           + ++PLGILLALGR S +P ++  C+TFIE +RGVPL+TVLFM+S+MLPLFLP+    DK
Sbjct: 170 VGALPLGILLALGRRSRMPAVKVVCVTFIEFWRGVPLITVLFMSSVMLPLFLPEGMSFDK 229

Query: 249 LLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIP 308
           LLRA++GV  F SAYIAEV+RGGLQ+I KGQ+EAA ++GL Y + M L+I+PQ +K VIP
Sbjct: 230 LLRAMIGVILFQSAYIAEVVRGGLQAIPKGQYEAAAAMGLGYWRSMGLVILPQALKLVIP 289

Query: 309 GIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFS 368
           GIVNTFI LFKD+SL+ II +FDLL  V+   ++  W+     T G +F   VFW+FCF 
Sbjct: 290 GIVNTFIALFKDTSLVIIIGLFDLLNSVKQAAADPAWLGMA--TEGYVFAALVFWVFCFG 347

Query: 369 ISLYSVFIEKTLHKGSKK 386
           +S YS+ +E+ L  G K+
Sbjct: 348 MSRYSMHLERKLDTGHKR 365


>gi|260778550|ref|ZP_05887442.1| amino acid ABC transporter permease protein [Vibrio coralliilyticus
           ATCC BAA-450]
 gi|260604714|gb|EEX31009.1| amino acid ABC transporter permease protein [Vibrio coralliilyticus
           ATCC BAA-450]
          Length = 365

 Score =  344 bits (883), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 172/372 (46%), Positives = 247/372 (66%), Gaps = 15/372 (4%)

Query: 17  QPSLPPVYQR-GIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNR 75
           QP LPP     G++ W+ KN F  P + +LT ++  L +  +  +  W  L A W+G+ R
Sbjct: 7   QPDLPPPANTVGVVGWLRKNLFNGPVNSILTVVLAYLAISLLWTVFDWSILKADWVGTTR 66

Query: 76  TVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLI 135
             CT            + ACW FI  R+EQF++G YP  + WRP L + T +I    +  
Sbjct: 67  DACTR-----------DGACWVFISVRWEQFMYGFYPQEELWRPRLFYFTLAIFTVLLAY 115

Query: 136 PSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPL 194
              P++    +    ++P     +LYGG+ GL +VET  WGGLLVTL+I+  GI++S+P+
Sbjct: 116 EKTPKRLWIWLFFVNIYPFIIAALLYGGVFGLEVVETHKWGGLLVTLIIALVGIVVSLPI 175

Query: 195 GILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALL 254
           G+ LALGR S +P++R  C  +IE++RGVPL+TVLFMAS+MLPLFL +  + DKL+RAL+
Sbjct: 176 GVALALGRRSEMPIIRSICTVYIEVWRGVPLITVLFMASVMLPLFLAEGSETDKLIRALI 235

Query: 255 GVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTF 314
           GV  F++AY+AEV+RGGLQ+I KGQ+EAA++LGLSY +KM LI++PQ +K  IP IVNTF
Sbjct: 236 GVVMFSAAYMAEVVRGGLQAIPKGQYEAADALGLSYWKKMGLIVLPQALKITIPSIVNTF 295

Query: 315 IGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSV 374
           IGLFKD+SL+ II MFD+LGI +   ++  W+   T +   +F+  VFW+FCF +S YS+
Sbjct: 296 IGLFKDTSLVLIIGMFDVLGIGQAANTDPEWLGFATES--YVFVALVFWVFCFGMSRYSI 353

Query: 375 FIEKTLHKGSKK 386
           ++E  LH G K+
Sbjct: 354 WLENKLHTGHKR 365


>gi|254286188|ref|ZP_04961148.1| amino acid ABC transporter, permease protein [Vibrio cholerae
           AM-19226]
 gi|262192391|ref|ZP_06050544.1| ABC-type amino acid transport system permease component [Vibrio
           cholerae CT 5369-93]
 gi|150423857|gb|EDN15798.1| amino acid ABC transporter, permease protein [Vibrio cholerae
           AM-19226]
 gi|262031744|gb|EEY50329.1| ABC-type amino acid transport system permease component [Vibrio
           cholerae CT 5369-93]
          Length = 365

 Score =  344 bits (882), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 177/372 (47%), Positives = 250/372 (67%), Gaps = 15/372 (4%)

Query: 17  QPSLPP-VYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNR 75
           QPSLPP     G++ W+ KN F    + + T ++  L +  +  I+ W   +A W G+ R
Sbjct: 7   QPSLPPPSNTTGVVGWLRKNLFNGVFNSIATLVLGYLAIQGLLNILDWAIFNANWSGTTR 66

Query: 76  TVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLI 135
             CT              ACW FI  R+EQF++G YP A+ WRP L F T ++ +  +  
Sbjct: 67  NDCTL-----------EGACWVFISVRWEQFMYGFYPTAELWRPRLFFFTLALFVALLAY 115

Query: 136 PSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPL 194
              P++    ++   ++P F+  +LYGG+ GL +VET  WGGLLVTL+I+  GII S+P+
Sbjct: 116 EKTPKRGWIWLVFVNIYPFFAALLLYGGVFGLEVVETHKWGGLLVTLIIALVGIIASLPI 175

Query: 195 GILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALL 254
           G+ LALGR S++P++R  C  +IE++RGVPL+TVLFMAS+MLPLFL    ++DKLLRAL+
Sbjct: 176 GVALALGRRSDMPIIRSLCTVYIEVWRGVPLITVLFMASVMLPLFLSQGSEIDKLLRALI 235

Query: 255 GVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTF 314
           GV  F++AY+AEV+RGGLQ+I KGQ+EAA++LGLSY +KM LII+PQ +K  IP IVNTF
Sbjct: 236 GVVMFSAAYMAEVIRGGLQAIPKGQYEAADALGLSYWKKMGLIILPQALKITIPSIVNTF 295

Query: 315 IGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSV 374
           IGLFKD+SL+ II MFD+LGI +   ++  W+   T +   +F+  VFWIFCF +S YS+
Sbjct: 296 IGLFKDTSLVLIIGMFDVLGIGQSANTDPNWLGFATES--YVFVALVFWIFCFGMSRYSI 353

Query: 375 FIEKTLHKGSKK 386
           ++E  LH G K+
Sbjct: 354 WLEGKLHTGHKR 365


>gi|146308573|ref|YP_001189038.1| polar amino acid ABC transporter, inner membrane subunit
           [Pseudomonas mendocina ymp]
 gi|145576774|gb|ABP86306.1| amino acid ABC transporter membrane protein 2, PAAT family
           [Pseudomonas mendocina ymp]
          Length = 365

 Score =  344 bits (882), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 180/378 (47%), Positives = 244/378 (64%), Gaps = 15/378 (3%)

Query: 11  VRKRLLQPSLPPVYQR-GIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAV 69
           ++    +P LPP     G + W+  N F    + LLT   I L+   +P +I W F+DA 
Sbjct: 1   MQSHTFKPDLPPPRMSVGAVGWLKANLFSNWFNTLLTLFAIYLIWLIVPPLIQWAFIDAT 60

Query: 70  WIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSIL 129
           W GS R  CT    GG        ACW FI  R+ QF++G YP   RWR         I 
Sbjct: 61  WSGSTRADCT----GG-------GACWVFIQQRFGQFMYGFYPSELRWRVDTTLWLAIIG 109

Query: 130 LTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGI 188
             P+ +P  PRK    +    ++P+ ++ +L+GG+ GLS+V TS WGGL++TLVI+  GI
Sbjct: 110 AAPLFVPQMPRKAFYGLAFLVIYPVVAWCLLHGGVFGLSVVPTSQWGGLMLTLVIAAVGI 169

Query: 189 IISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDK 248
             ++PLGILLALGR SN+P +R  C+TFIE +RGVPL+TVLFM+S+MLPLFLP+    DK
Sbjct: 170 TGALPLGILLALGRRSNMPAIRVICVTFIEFWRGVPLITVLFMSSVMLPLFLPEGMHFDK 229

Query: 249 LLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIP 308
           L+RAL+GV  F SAYIAEV+RGGLQ+I KGQ+EAA ++GL Y + M L+I+PQ +K VIP
Sbjct: 230 LMRALIGVILFQSAYIAEVVRGGLQAIPKGQYEAAAAMGLGYWRMMGLVILPQALKLVIP 289

Query: 309 GIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFS 368
           GIVNTFI LFKD+SL+ II +FDLL  ++   ++  W+     T G +F   +FWIFCF 
Sbjct: 290 GIVNTFISLFKDTSLVIIIGLFDLLNSIKQATTDPAWLGMA--TEGYVFAALIFWIFCFG 347

Query: 369 ISLYSVFIEKTLHKGSKK 386
           +S YS+ +E+ L  G K+
Sbjct: 348 MSRYSMHLERKLDTGHKR 365


>gi|15641372|ref|NP_231004.1| amino acid ABC transporter, permease protein [Vibrio cholerae O1
           biovar El Tor str. N16961]
 gi|121587995|ref|ZP_01677747.1| amino acid ABC transporter, permease protein [Vibrio cholerae
           2740-80]
 gi|121728528|ref|ZP_01681551.1| amino acid ABC transporter, permease protein [Vibrio cholerae V52]
 gi|147674160|ref|YP_001216919.1| amino acid ABC transporter, permease protein [Vibrio cholerae O395]
 gi|153212686|ref|ZP_01948343.1| amino acid ABC transporter, permease protein [Vibrio cholerae 1587]
 gi|153819357|ref|ZP_01972024.1| amino acid ABC transporter, permease protein [Vibrio cholerae NCTC
           8457]
 gi|153825276|ref|ZP_01977943.1| amino acid ABC transporter, permease protein [Vibrio cholerae
           MZO-2]
 gi|153828797|ref|ZP_01981464.1| amino acid ABC transporter, permease protein [Vibrio cholerae
           623-39]
 gi|183179358|ref|ZP_02957569.1| amino acid ABC transporter, permease protein [Vibrio cholerae
           MZO-3]
 gi|227081531|ref|YP_002810082.1| amino acid ABC transporter, permease protein [Vibrio cholerae
           M66-2]
 gi|229505059|ref|ZP_04394569.1| amino acid ABC transporter permease protein [Vibrio cholerae BX
           330286]
 gi|229511271|ref|ZP_04400750.1| amino acid ABC transporter permease protein [Vibrio cholerae B33]
 gi|229515732|ref|ZP_04405191.1| amino acid ABC transporter permease protein [Vibrio cholerae TMA
           21]
 gi|229518389|ref|ZP_04407833.1| amino acid ABC transporter permease protein [Vibrio cholerae RC9]
 gi|229523538|ref|ZP_04412943.1| amino acid ABC transporter permease protein [Vibrio cholerae bv.
           albensis VL426]
 gi|229529564|ref|ZP_04418954.1| amino acid ABC transporter permease protein [Vibrio cholerae
           12129(1)]
 gi|229608063|ref|YP_002878711.1| amino acid ABC transporter permease protein [Vibrio cholerae
           MJ-1236]
 gi|254848482|ref|ZP_05237832.1| amino acid ABC transporter [Vibrio cholerae MO10]
 gi|255745747|ref|ZP_05419695.1| amino acid ABC transporter permease protein [Vibrio cholera CIRS
           101]
 gi|262158975|ref|ZP_06030087.1| amino acid ABC transporter permease protein [Vibrio cholerae INDRE
           91/1]
 gi|262169334|ref|ZP_06037026.1| amino acid ABC transporter permease protein [Vibrio cholerae RC27]
 gi|298498556|ref|ZP_07008363.1| amino acid ABC transporter [Vibrio cholerae MAK 757]
 gi|9655853|gb|AAF94518.1| amino acid ABC transporter, permease protein [Vibrio cholerae O1
           biovar El Tor str. N16961]
 gi|121547736|gb|EAX57827.1| amino acid ABC transporter, permease protein [Vibrio cholerae
           2740-80]
 gi|121629192|gb|EAX61632.1| amino acid ABC transporter, permease protein [Vibrio cholerae V52]
 gi|124116336|gb|EAY35156.1| amino acid ABC transporter, permease protein [Vibrio cholerae 1587]
 gi|126510102|gb|EAZ72696.1| amino acid ABC transporter, permease protein [Vibrio cholerae NCTC
           8457]
 gi|146316043|gb|ABQ20582.1| amino acid ABC transporter, permease protein [Vibrio cholerae O395]
 gi|148875750|gb|EDL73885.1| amino acid ABC transporter, permease protein [Vibrio cholerae
           623-39]
 gi|149741104|gb|EDM55163.1| amino acid ABC transporter, permease protein [Vibrio cholerae
           MZO-2]
 gi|183012769|gb|EDT88069.1| amino acid ABC transporter, permease protein [Vibrio cholerae
           MZO-3]
 gi|227009419|gb|ACP05631.1| amino acid ABC transporter, permease protein [Vibrio cholerae
           M66-2]
 gi|227013277|gb|ACP09487.1| amino acid ABC transporter, permease protein [Vibrio cholerae O395]
 gi|229333338|gb|EEN98824.1| amino acid ABC transporter permease protein [Vibrio cholerae
           12129(1)]
 gi|229337119|gb|EEO02136.1| amino acid ABC transporter permease protein [Vibrio cholerae bv.
           albensis VL426]
 gi|229345104|gb|EEO10078.1| amino acid ABC transporter permease protein [Vibrio cholerae RC9]
 gi|229347501|gb|EEO12461.1| amino acid ABC transporter permease protein [Vibrio cholerae TMA
           21]
 gi|229351236|gb|EEO16177.1| amino acid ABC transporter permease protein [Vibrio cholerae B33]
 gi|229357282|gb|EEO22199.1| amino acid ABC transporter permease protein [Vibrio cholerae BX
           330286]
 gi|229370718|gb|ACQ61141.1| amino acid ABC transporter permease protein [Vibrio cholerae
           MJ-1236]
 gi|254844187|gb|EET22601.1| amino acid ABC transporter [Vibrio cholerae MO10]
 gi|255736822|gb|EET92219.1| amino acid ABC transporter permease protein [Vibrio cholera CIRS
           101]
 gi|262022147|gb|EEY40856.1| amino acid ABC transporter permease protein [Vibrio cholerae RC27]
 gi|262029160|gb|EEY47812.1| amino acid ABC transporter permease protein [Vibrio cholerae INDRE
           91/1]
 gi|297542889|gb|EFH78939.1| amino acid ABC transporter [Vibrio cholerae MAK 757]
 gi|327484030|gb|AEA78437.1| Amino acid ABC transporter, permease protein [Vibrio cholerae
           LMA3894-4]
          Length = 365

 Score =  344 bits (882), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 177/372 (47%), Positives = 250/372 (67%), Gaps = 15/372 (4%)

Query: 17  QPSLPP-VYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNR 75
           QPSLPP     G++ W+ KN F    + + T ++  L +  +  I+ W   +A W G+ R
Sbjct: 7   QPSLPPPSNTTGVVGWLRKNLFNGVFNSIATLVLGYLAIQGLLNILDWAIFNANWSGTTR 66

Query: 76  TVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLI 135
             CT              ACW FI  R+EQF++G YP A+ WRP L F T ++ +  +  
Sbjct: 67  NDCTL-----------EGACWVFISVRWEQFMYGFYPAAELWRPRLFFFTLALFVALLAY 115

Query: 136 PSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPL 194
              P++    ++   ++P F+  +LYGG+ GL +VET  WGGLLVTL+I+  GII S+P+
Sbjct: 116 EKTPKRGWIWLVFVNIYPFFAALLLYGGVFGLEVVETHKWGGLLVTLIIALVGIIASLPI 175

Query: 195 GILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALL 254
           G+ LALGR S++P++R  C  +IE++RGVPL+TVLFMAS+MLPLFL    ++DKLLRAL+
Sbjct: 176 GVALALGRRSDMPIIRSLCTVYIEVWRGVPLITVLFMASVMLPLFLSQGSEIDKLLRALI 235

Query: 255 GVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTF 314
           GV  F++AY+AEV+RGGLQ+I KGQ+EAA++LGLSY +KM LII+PQ +K  IP IVNTF
Sbjct: 236 GVVMFSAAYMAEVIRGGLQAIPKGQYEAADALGLSYWKKMGLIILPQALKITIPSIVNTF 295

Query: 315 IGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSV 374
           IGLFKD+SL+ II MFD+LGI +   ++  W+   T +   +F+  VFWIFCF +S YS+
Sbjct: 296 IGLFKDTSLVLIIGMFDVLGIGQSANTDPNWLGFATES--YVFVALVFWIFCFGMSRYSI 353

Query: 375 FIEKTLHKGSKK 386
           ++E  LH G K+
Sbjct: 354 WLEGKLHTGHKR 365


>gi|323498375|ref|ZP_08103375.1| hypothetical protein VISI1226_13938 [Vibrio sinaloensis DSM 21326]
 gi|323316617|gb|EGA69628.1| hypothetical protein VISI1226_13938 [Vibrio sinaloensis DSM 21326]
          Length = 365

 Score =  343 bits (881), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 171/378 (45%), Positives = 252/378 (66%), Gaps = 15/378 (3%)

Query: 11  VRKRLLQPSLPPVYQR-GIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAV 69
           +++    P LPP     G++ W+ KN F +P + ++T ++  L+   +  I+ W  L A 
Sbjct: 1   MKEHQFLPDLPPPANTVGVVGWLRKNLFNSPVNSVVTVILAYLVGMLMWNIVDWGLLKAD 60

Query: 70  WIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSIL 129
           W+G+ R  C+            + ACW FI  R+EQF++G YP  + WRP L ++T +I 
Sbjct: 61  WVGTTRDACSR-----------DGACWVFISVRWEQFMYGFYPQEELWRPRLFYITLAIF 109

Query: 130 LTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGI 188
              +     P++    +    ++P     +LYGG+ GL +VET  WGGLLVTL+I+  GI
Sbjct: 110 TVLLAYEKTPKRLWIWLFFVNVYPFIIAGLLYGGVFGLEVVETHKWGGLLVTLIIALVGI 169

Query: 189 IISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDK 248
           ++S+P+G+ LALGR S +P++R  C  +IE++RGVPL+TVLFMAS+MLPLFL +  + DK
Sbjct: 170 VVSLPIGVALALGRRSEMPIIRSICTVYIEVWRGVPLITVLFMASVMLPLFLSEGSETDK 229

Query: 249 LLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIP 308
           L+RAL+GV  F++AY+AEV+RGGLQ+I KGQ+EAA++LGLSY +KM LII+PQ +K  IP
Sbjct: 230 LIRALIGVVMFSAAYMAEVVRGGLQAIPKGQYEAADALGLSYWKKMGLIILPQALKITIP 289

Query: 309 GIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFS 368
            IVNTFIGLFKD+SL+ II MFD+LGI +   ++  W+   T +   +F+  VFW+FCF 
Sbjct: 290 SIVNTFIGLFKDTSLVLIIGMFDVLGIGQAANTDPEWLGFATES--YVFVALVFWVFCFG 347

Query: 369 ISLYSVFIEKTLHKGSKK 386
           +S YS+++E  LH G K+
Sbjct: 348 MSRYSIWLENKLHTGHKR 365


>gi|289647198|ref|ZP_06478541.1| amino acid ABC transporter, permease protein [Pseudomonas syringae
           pv. aesculi str. 2250]
          Length = 365

 Score =  343 bits (880), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 177/372 (47%), Positives = 247/372 (66%), Gaps = 15/372 (4%)

Query: 17  QPSLPPVYQR-GIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNR 75
           +P +PP  +  G +AW+ +N F +  + LLT   + L+   +P II W  LDA W+G+ +
Sbjct: 7   KPDMPPPGKVFGPMAWMRQNLFSSWINTLLTLFSLYLIYLVVPPIISWALLDANWVGTTK 66

Query: 76  TVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLI 135
             CT              ACW FI  R+ QF++G +P    WR  L  +   +   P+ I
Sbjct: 67  DDCTKA-----------GACWVFIEQRFGQFMYGYFPNELHWRVDLTAVLAIVGAAPLFI 115

Query: 136 PSFPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISMPL 194
             F RK +  I    ++PI +F++L+GG  GL+ V TS WGGL++TLVI+  GI+ ++PL
Sbjct: 116 SKFQRKAVYGIAFLVIYPIVAFYLLHGGAFGLTNVPTSQWGGLMLTLVIATVGIVGALPL 175

Query: 195 GILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALL 254
           GILLALGR SN+P +R  C+TFIE +RGVPL+TVLFM+S+MLPLF+P+  + DKLLRAL+
Sbjct: 176 GILLALGRRSNMPAVRVVCVTFIEFWRGVPLITVLFMSSVMLPLFMPEGMNFDKLLRALI 235

Query: 255 GVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTF 314
           GV  F SAYIAEV+RGG+Q+I KGQ+EAA+++GL Y + M L+I+PQ +K VIPGIVNTF
Sbjct: 236 GVILFQSAYIAEVVRGGMQAIPKGQYEAASAMGLGYWRSMGLVILPQALKMVIPGIVNTF 295

Query: 315 IGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSV 374
           I LFKD+SL+ II +FDLL  V+   ++  W+     T G +F   VFWIFCF +S YS+
Sbjct: 296 IALFKDTSLVIIIGLFDLLNSVKQATADPAWLGMA--TEGYVFAALVFWIFCFGMSRYSM 353

Query: 375 FIEKTLHKGSKK 386
            +E+ L  G K+
Sbjct: 354 HLERKLDTGHKR 365


>gi|320325829|gb|EFW81890.1| amino acid ABC transporter, permease protein [Pseudomonas syringae
           pv. glycinea str. B076]
 gi|320327253|gb|EFW83267.1| amino acid ABC transporter, permease protein [Pseudomonas syringae
           pv. glycinea str. race 4]
          Length = 365

 Score =  343 bits (879), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 177/372 (47%), Positives = 247/372 (66%), Gaps = 15/372 (4%)

Query: 17  QPSLPPVYQR-GIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNR 75
           +P +PP  +  G +AW+ +N F +  + LLT   + L+   +P II W  LDA W+G+ +
Sbjct: 7   KPDMPPPGKVFGPMAWMRQNLFSSWINTLLTLFSLYLIYLVVPPIISWALLDANWVGTTK 66

Query: 76  TVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLI 135
             CT              ACW FI  R+ QF++G +P   RWR  L  +   +   P+ I
Sbjct: 67  ADCTKA-----------GACWVFIEQRFGQFMYGYFPNELRWRVDLTAILAIVGAAPLFI 115

Query: 136 PSFPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISMPL 194
             F RK +  I    ++PI +F++L+GG  GL+ V TS WGGL++TLVI+  GI+ ++PL
Sbjct: 116 SKFQRKAVYGIAFLVIYPIVAFYLLHGGAFGLTNVPTSQWGGLMLTLVIATVGIVGALPL 175

Query: 195 GILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALL 254
           GILLALGR SN+P +R  C+TFIE +RGVPL+TVLFM+S+MLPLF+P+  + DKLLRAL+
Sbjct: 176 GILLALGRRSNMPAVRVVCVTFIEFWRGVPLITVLFMSSVMLPLFMPEGMNFDKLLRALI 235

Query: 255 GVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTF 314
           GV  F SAYIAEV+RGG+Q+I KGQ+EAA+++ L Y + M L+I+PQ +K VIPGIVNTF
Sbjct: 236 GVILFQSAYIAEVVRGGMQAIPKGQYEAASAMDLGYWRSMGLVILPQALKMVIPGIVNTF 295

Query: 315 IGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSV 374
           I LFKD+SL+ II +FDLL  V+   ++  W+     T G +F   VFWIFCF +S YS+
Sbjct: 296 IALFKDTSLVIIIGLFDLLNSVKQATADPAWLGMA--TEGYVFAALVFWIFCFGMSRYSM 353

Query: 375 FIEKTLHKGSKK 386
            +E+ L  G K+
Sbjct: 354 HLERKLDTGHKR 365


>gi|28898396|ref|NP_798001.1| amino acid ABC transporter permease [Vibrio parahaemolyticus RIMD
           2210633]
 gi|28806613|dbj|BAC59885.1| amino acid ABC transporter, permease protein [Vibrio
           parahaemolyticus RIMD 2210633]
          Length = 368

 Score =  343 bits (879), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 174/375 (46%), Positives = 252/375 (67%), Gaps = 18/375 (4%)

Query: 17  QPSLPPVYQR-GIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNR 75
           QP LPP     G++ W+ KN F  P + ++T ++  ++  ++  I+ W F++A WIGS R
Sbjct: 7   QPDLPPPSNTVGVVGWLRKNLFNGPVNSIVTLILAYIVFNALWHIVDWAFINADWIGSTR 66

Query: 76  TVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLI 135
             C+              ACW FI  R+EQF++G YP A+ WRP L ++T +I    +  
Sbjct: 67  DDCSR-----------EGACWVFISVRWEQFMYGFYPEAELWRPRLFYITLAIFTVLLAY 115

Query: 136 PSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPL 194
              P++    +    ++P     +LYGG+ GL +VET  WGGLLVTL+I+  GI++S+P+
Sbjct: 116 EKTPKRLWIWLFFVNIYPFIVAALLYGGVFGLEVVETHKWGGLLVTLIIALVGIVVSLPI 175

Query: 195 GILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKL---LR 251
           G+ LALGR S++P++R  C  +IE++RGVPL+TVLFMAS+MLPLFL +  + DKL   LR
Sbjct: 176 GVALALGRRSDMPIIRSICTIYIEVWRGVPLITVLFMASVMLPLFLAEGSETDKLIRALR 235

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
           AL+GV  F++AY+AEV+RGGLQ+I KGQ+EAA++LGLSY +K  LII+PQ +K  IP IV
Sbjct: 236 ALIGVVMFSAAYMAEVVRGGLQAIPKGQYEAADALGLSYWKKTGLIILPQALKITIPSIV 295

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISL 371
           NTFIGLFKD+SL+ II MFD+LGI +   ++  W+   T +   +F+  VFW+FCF +S 
Sbjct: 296 NTFIGLFKDTSLVLIIGMFDVLGIGQAANTDPEWLGFATES--YVFVALVFWVFCFGMSR 353

Query: 372 YSVFIEKTLHKGSKK 386
           YS+++E  LH G K+
Sbjct: 354 YSIWLENKLHTGHKR 368


>gi|90578889|ref|ZP_01234699.1| putative ABC-type amino acid transport system, permease component
           [Vibrio angustum S14]
 gi|90439722|gb|EAS64903.1| putative ABC-type amino acid transport system, permease component
           [Vibrio angustum S14]
          Length = 365

 Score =  342 bits (878), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 174/378 (46%), Positives = 252/378 (66%), Gaps = 15/378 (3%)

Query: 11  VRKRLLQPSLPPVYQR-GIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAV 69
           ++K    P LPP     GII W+  N F +  + + T L+    +  I   I W F++A 
Sbjct: 1   MKKHEFLPDLPPPANTVGIIGWLRTNLFSSITNSIATLLLGYFAVLGIWYTIDWAFINAD 60

Query: 70  WIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSIL 129
           W G +R  CT+           + ACW FI  R++QF++G YP  + WRP L + T +I 
Sbjct: 61  WSGVSRDACTS-----------SGACWTFINVRFDQFMYGFYPTEELWRPQLFYATLAIF 109

Query: 130 LTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGI 188
           +  +     P +    +    ++P  + F+LYGG+ GL+IVET LWGGLL+TL+I+  GI
Sbjct: 110 IGLLAYEKTPYRGWIWLFFVNIYPFIAGFLLYGGVFGLTIVETHLWGGLLITLIIAIVGI 169

Query: 189 IISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDK 248
           ++S+P+G++LALGR S +P++R  C  +IEL+RGVPL+TVLFMAS+MLPLFL    + +K
Sbjct: 170 VVSLPIGVVLALGRRSEMPIIRSICTVYIELWRGVPLITVLFMASVMLPLFLSSEMETNK 229

Query: 249 LLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIP 308
           L+RAL+GV  F++AY+AEV+RGGLQ+I KGQ+EAA++LGL+Y +KM LI++PQ +K  IP
Sbjct: 230 LIRALMGVVMFSAAYMAEVIRGGLQAIPKGQYEAADALGLTYWKKMYLIVLPQALKITIP 289

Query: 309 GIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFS 368
            IVNTFIGLFKD+SL+ II MFD+LGI +   ++  W+   T +   +F+  VFWIFCF 
Sbjct: 290 SIVNTFIGLFKDTSLVLIIGMFDVLGIGQAATTDPEWLGFATES--YVFVALVFWIFCFG 347

Query: 369 ISLYSVFIEKTLHKGSKK 386
           +S YS+++E  LH G K+
Sbjct: 348 MSRYSIYLENKLHTGHKR 365


>gi|261252932|ref|ZP_05945505.1| amino acid ABC transporter permease protein [Vibrio orientalis CIP
           102891]
 gi|260936323|gb|EEX92312.1| amino acid ABC transporter permease protein [Vibrio orientalis CIP
           102891]
          Length = 365

 Score =  342 bits (878), Expect = 5e-92,   Method: Compositional matrix adjust.
 Identities = 170/372 (45%), Positives = 248/372 (66%), Gaps = 15/372 (4%)

Query: 17  QPSLPPVYQR-GIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNR 75
           QP LPP     G++ W+ KN F  P + ++T ++  +    +     W FL+A W+G+ R
Sbjct: 7   QPDLPPPANTVGVVGWLRKNLFNGPVNSVVTIILGYIAFMLLWNTFDWAFLNADWVGTTR 66

Query: 76  TVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLI 135
             C+              ACW FI  R+EQF++G YP A+ WRP L ++T +I    +  
Sbjct: 67  DACSR-----------EGACWVFISVRWEQFMYGFYPEAELWRPRLFYITLAIFTVLLAY 115

Query: 136 PSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPL 194
              P++    +    ++P     +LYGG+ GL +V+T  WGGLLVTL+I+  GI++S+P+
Sbjct: 116 EKTPKRLWIWLFFVNIYPFIIAALLYGGVFGLEVVDTHKWGGLLVTLIIALVGIVVSLPI 175

Query: 195 GILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALL 254
           G+ LALGR S +P++R  C  +IE++RGVPL+TVLFMAS+MLPLFL +  + DKL+RAL+
Sbjct: 176 GVALALGRRSEMPIIRSMCTVYIEVWRGVPLITVLFMASVMLPLFLAEGSETDKLIRALV 235

Query: 255 GVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTF 314
           GV  F++AY+AEV+RGGLQ+I KGQ+EAA++LGL+Y +KM LII+PQ +K  IP IVNTF
Sbjct: 236 GVVMFSAAYMAEVVRGGLQAIPKGQYEAADALGLTYWKKMGLIILPQALKITIPSIVNTF 295

Query: 315 IGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSV 374
           IGLFKD+SL+ II MFD+LGI +   ++  W+   T +   +F+  VFW+FCF +S YS+
Sbjct: 296 IGLFKDTSLVLIIGMFDVLGIGQAANTDPEWLGFATES--YVFVALVFWVFCFGMSRYSI 353

Query: 375 FIEKTLHKGSKK 386
           ++E  LH G K+
Sbjct: 354 WLENKLHTGHKR 365


>gi|262274331|ref|ZP_06052142.1| amino acid ABC transporter permease protein [Grimontia hollisae CIP
           101886]
 gi|262220894|gb|EEY72208.1| amino acid ABC transporter permease protein [Grimontia hollisae CIP
           101886]
          Length = 366

 Score =  342 bits (877), Expect = 6e-92,   Method: Compositional matrix adjust.
 Identities = 173/377 (45%), Positives = 254/377 (67%), Gaps = 15/377 (3%)

Query: 12  RKRLLQPSLPPVYQR-GIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVW 70
           R+   QP+LPP     G + W+ +N F TP + L+T ++  +    +  II W F+ + W
Sbjct: 3   RQHEFQPNLPPPPNTVGPVGWMKQNLFSTPVNALVTLVLAYIAFQGLWAIIDWAFIHSDW 62

Query: 71  IGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILL 130
           IG+ R  CT+             ACW FI  R++QF+FG YP  + WRP L +   ++  
Sbjct: 63  IGTTREDCTS-----------EGACWVFINVRFDQFMFGFYPQEELWRPQLFYAVLALFT 111

Query: 131 TPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGII 189
             ++    P++    +L    FP+ + F+L+GG+ GL  VET LWGGLL+T++I+  GI+
Sbjct: 112 CLLVYEKTPKRGWILLLFLVAFPLLAVFLLFGGVAGLPNVETHLWGGLLITMIIAIVGIV 171

Query: 190 ISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKL 249
           +S+P+GI+LALGR S++P++R     +IE++RGVPL+TVLFMAS+MLPLF+    + +KL
Sbjct: 172 VSLPIGIVLALGRRSDMPIIRSLSTVYIEVWRGVPLITVLFMASVMLPLFMSGESESNKL 231

Query: 250 LRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPG 309
           +RAL+GV  FASAY+AEV+RGGLQ+I KGQ+EAA++LGL+Y +KM LII+PQ +K  IP 
Sbjct: 232 VRALIGVVMFASAYMAEVVRGGLQAIPKGQYEAADALGLTYWKKMNLIILPQALKISIPS 291

Query: 310 IVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSI 369
           IVNTFIGLFKD+SL+ II MFD+LGI +   ++  W+   T +   +F+  VFWIFCF +
Sbjct: 292 IVNTFIGLFKDTSLVLIIGMFDVLGIGQAANTDPNWLGFATES--YVFVALVFWIFCFGM 349

Query: 370 SLYSVFIEKTLHKGSKK 386
           S YS+++E  LH G ++
Sbjct: 350 SRYSIYLENKLHTGHRR 366


>gi|149191356|ref|ZP_01869609.1| ABC-type amino acid transport system, permease component [Vibrio
           shilonii AK1]
 gi|148834835|gb|EDL51819.1| ABC-type amino acid transport system, permease component [Vibrio
           shilonii AK1]
          Length = 365

 Score =  342 bits (876), Expect = 7e-92,   Method: Compositional matrix adjust.
 Identities = 171/376 (45%), Positives = 248/376 (65%), Gaps = 15/376 (3%)

Query: 13  KRLLQPSLPPVYQR-GIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWI 71
           +   QP LPP     G++ W+ KN F  P + LLT ++    +  +  +  W  L A W+
Sbjct: 3   QHQFQPDLPPPANTVGVVGWLRKNLFNGPVNSLLTIVLGYFAISLLWYVFDWAILKADWV 62

Query: 72  GSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLT 131
           G+ R  C+              ACW FI  R+EQF++G YP A+ WRP L + T +I + 
Sbjct: 63  GTTRDACSR-----------EGACWVFISVRWEQFMYGFYPQAELWRPRLFYATLAIFVA 111

Query: 132 PMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIII 190
            +     P++    +    ++P  +  +LYGG+ GL +VET  WGGLLVTL+I+  GII+
Sbjct: 112 LLAYERTPKRLWIWLFFVNIYPFIAAGLLYGGVFGLEVVETHKWGGLLVTLIIALVGIIV 171

Query: 191 SMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLL 250
           S+P+G+ LALGR S +P++R  C  +IE++RGVPL+TVLFMAS+MLPLF  +  + DKL+
Sbjct: 172 SLPIGVALALGRRSEMPIIRSICTVYIEVWRGVPLITVLFMASVMLPLFFSEGVETDKLI 231

Query: 251 RALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGI 310
           RAL+GV  F++AY+AEV+RGGLQ+I KGQ+EAA++LGL+Y +KM LI++PQ +K  IP I
Sbjct: 232 RALIGVVMFSAAYMAEVIRGGLQAIPKGQYEAADALGLTYWKKMGLIVLPQALKITIPSI 291

Query: 311 VNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSIS 370
           VNTFIGLFKD+SL+ II MFD+LGI +   ++  W+   T +   +F+  VFW+FCF +S
Sbjct: 292 VNTFIGLFKDTSLVLIIGMFDVLGIGQAANTDPEWLGFATES--YVFVALVFWVFCFGMS 349

Query: 371 LYSVFIEKTLHKGSKK 386
            YS+++E  LH G K+
Sbjct: 350 RYSIWLENKLHTGHKR 365


>gi|302188402|ref|ZP_07265075.1| amino acid ABC transporter permease [Pseudomonas syringae pv.
           syringae 642]
          Length = 365

 Score =  341 bits (875), Expect = 9e-92,   Method: Compositional matrix adjust.
 Identities = 180/372 (48%), Positives = 250/372 (67%), Gaps = 15/372 (4%)

Query: 17  QPSLPPVYQR-GIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNR 75
           +P +PP  +  G +AW+ +N F +  + LLT L + L+   +P II W  LDA WIG+ +
Sbjct: 7   KPDMPPPGKVFGPMAWMRQNLFSSWINTLLTLLSLYLIYLVVPPIISWALLDANWIGTTK 66

Query: 76  TVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLI 135
             CT              ACW FI  R+ QF++G +P   RWR  L  +   +   P+ I
Sbjct: 67  ADCTKA-----------GACWVFIEQRFGQFMYGYFPNELRWRVDLTAILAIVGAAPLFI 115

Query: 136 PSFPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISMPL 194
             FPRK +  I    ++P+ +F++L+GG  GL+ V TS WGGL++TLVI+  GI+ ++PL
Sbjct: 116 SKFPRKAVYGIAFLVIYPVVAFYLLHGGAFGLTNVPTSQWGGLMLTLVIATVGIVGALPL 175

Query: 195 GILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALL 254
           GILLALGR SN+P +R  C+TFIE +RGVPL+TVLFM+S+MLPLF+P+  + DKLLRAL+
Sbjct: 176 GILLALGRRSNMPAVRVVCVTFIEFWRGVPLITVLFMSSVMLPLFMPEGMNFDKLLRALI 235

Query: 255 GVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTF 314
           GV  F SAYIAEV+RGG+Q+I KGQ+EAA+++GL Y + M L+I+PQ +K VIPGIVNTF
Sbjct: 236 GVILFQSAYIAEVVRGGMQAIPKGQYEAASAMGLGYWRSMGLVILPQALKMVIPGIVNTF 295

Query: 315 IGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSV 374
           I LFKD+SL+ II +FDLL  V+   ++  W+     T G +F   VFWIFCF +S YS+
Sbjct: 296 IALFKDTSLVIIIGLFDLLNSVKQATADPAWLGMA--TEGYVFAALVFWIFCFGMSRYSM 353

Query: 375 FIEKTLHKGSKK 386
            +E+ L  G K+
Sbjct: 354 HLERKLDTGHKR 365


>gi|330882634|gb|EGH16783.1| amino acid ABC transporter permease [Pseudomonas syringae pv.
           glycinea str. race 4]
          Length = 365

 Score =  341 bits (875), Expect = 9e-92,   Method: Compositional matrix adjust.
 Identities = 176/372 (47%), Positives = 246/372 (66%), Gaps = 15/372 (4%)

Query: 17  QPSLPPVYQR-GIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNR 75
           +P +PP  +  G +AW+ +N F +  + LLT   + L+   +P II W  LDA W+G+ +
Sbjct: 7   KPDMPPPGKVFGPMAWMRQNLFSSWINTLLTLFSLYLIYLVVPPIISWALLDANWVGTTK 66

Query: 76  TVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLI 135
             CT              ACW FI  R+ QF++G +P   RWR  L  +   +   P+ I
Sbjct: 67  ADCTKA-----------GACWVFIEQRFGQFMYGYFPNELRWRVDLTAILAIVGAAPLFI 115

Query: 136 PSFPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISMPL 194
             F RK +  I    ++PI +F++L+GG  GL+ V TS WGGL++TLVI+  GI+ ++PL
Sbjct: 116 SKFQRKAVYGIAFLVIYPIVAFYLLHGGAFGLTNVPTSQWGGLMLTLVIATVGIVGALPL 175

Query: 195 GILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALL 254
           GILLALGR SN+P +R  C+TFIE +RGVPL+TVLFM+S+MLPLF+P+  + DKLLRAL+
Sbjct: 176 GILLALGRRSNMPAVRVVCVTFIEFWRGVPLITVLFMSSVMLPLFMPEGMNFDKLLRALI 235

Query: 255 GVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTF 314
           GV  F SAYIAEV+RGG+Q+I KGQ+EAA+++ L Y + M L+ +PQ +K VIPGIVNTF
Sbjct: 236 GVILFQSAYIAEVVRGGMQAIPKGQYEAASAMDLGYWRSMGLVFLPQALKMVIPGIVNTF 295

Query: 315 IGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSV 374
           I LFKD+SL+ II +FDLL  V+   ++  W+     T G +F   VFWIFCF +S YS+
Sbjct: 296 IALFKDTSLVIIIGLFDLLNSVKQATADPAWLGMA--TEGYVFAALVFWIFCFGMSRYSM 353

Query: 375 FIEKTLHKGSKK 386
            +E+ L  G K+
Sbjct: 354 HLERKLDTGHKR 365


>gi|154253426|ref|YP_001414250.1| polar amino acid ABC transporter inner membrane subunit
           [Parvibaculum lavamentivorans DS-1]
 gi|154157376|gb|ABS64593.1| polar amino acid ABC transporter, inner membrane subunit
           [Parvibaculum lavamentivorans DS-1]
          Length = 369

 Score =  339 bits (870), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 172/359 (47%), Positives = 236/359 (65%), Gaps = 10/359 (2%)

Query: 29  IAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQP 88
           +AW  +N F +  + +LT     LL  +IP  + +    AVW G+ R  C     G    
Sbjct: 20  LAWAQRNLFSSVGNTILTLASFYLLWLTIPPALDFTIFSAVWTGTTREACLEPGAG---- 75

Query: 89  DGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILL 148
                ACW F++   +QFI+G YP ++ WR  L F  G  ++ PMLIP  P + LN +LL
Sbjct: 76  -----ACWPFVWANIDQFIYGRYPPSEIWRVNLTFALGVAVIVPMLIPGLPARRLNLVLL 130

Query: 149 FGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIP 207
             ++P+ +  +L G   GL  V TS WGGLLVTLV++  GI+ S+PLG+LLALGR S++P
Sbjct: 131 LIVYPLVAIVLLAGDRPGLPPVPTSEWGGLLVTLVVAVTGIVASLPLGVLLALGRRSDMP 190

Query: 208 VLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEV 267
            +R  CI FIE +RGVPL+TVLFMAS+MLPLFLP+  + D LLR L+GV+ F+SAY+AEV
Sbjct: 191 AIRMLCIIFIEFWRGVPLITVLFMASVMLPLFLPEGVNPDNLLRCLVGVALFSSAYMAEV 250

Query: 268 LRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISII 327
           +RGGLQ+I  GQ+EAA ++GL+Y Q M  +++PQ ++ VIPGIVNTFIGLFKD++L+ I+
Sbjct: 251 VRGGLQAIPAGQYEAARAVGLTYWQAMGQVVLPQALRHVIPGIVNTFIGLFKDTTLVLIV 310

Query: 328 NMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
            +FDLLG VR   S+  W       TG IF   VFW+FCF +S YS F+E+ L    ++
Sbjct: 311 GIFDLLGQVRAQLSDPNWTIPQGALTGYIFAALVFWVFCFGMSQYSNFMERRLDTTRER 369


>gi|330446207|ref|ZP_08309859.1| amino ABC transporter, permease, 3-TM region, His/Glu/Gln/Arg/opine
           family domain protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328490398|dbj|GAA04356.1| amino ABC transporter, permease, 3-TM region, His/Glu/Gln/Arg/opine
           family domain protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 365

 Score =  339 bits (869), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 172/378 (45%), Positives = 250/378 (66%), Gaps = 15/378 (3%)

Query: 11  VRKRLLQPSLPPVYQR-GIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAV 69
           + K    P LPP     G+I W+  N F +  + + T L+    +  I  II W F++A 
Sbjct: 1   MNKHEFLPDLPPPANTVGMIGWLRTNLFSSITNSIATLLLGYFAVLGIWYIIDWAFINAD 60

Query: 70  WIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSIL 129
           W G +R  CT+           + ACW FI  R++QF++G YP  + WRP L + T +I 
Sbjct: 61  WSGDSRDACTS-----------SGACWTFINVRFDQFMYGFYPTEELWRPQLFYATLAIF 109

Query: 130 LTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGI 188
           +  +     P +    +    ++P  + F+LYGG+  L +VET LWGGLL+TL+I+  GI
Sbjct: 110 IGLLAYEKTPYRGWIWLFFVNIYPFIAGFLLYGGVFDLPVVETHLWGGLLITLIIAIVGI 169

Query: 189 IISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDK 248
           ++S+P+G++LALGR S +P++R  C  +IEL+RGVPL+TVLFMAS+MLPLFL    + +K
Sbjct: 170 VVSLPIGVVLALGRRSEMPIIRSICTVYIELWRGVPLITVLFMASVMLPLFLSSEMETNK 229

Query: 249 LLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIP 308
           L+RAL+GV  F++AY+AEV+RGGLQ+I KGQ+EAA++LGL+Y +KM LI++PQ +K  IP
Sbjct: 230 LIRALMGVVMFSAAYMAEVIRGGLQAIPKGQYEAADALGLTYWKKMYLIVLPQALKITIP 289

Query: 309 GIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFS 368
            IVNTFIGLFKD+SL+ II MFD+LGI +   ++  W+   T +   +F+  VFWIFCF 
Sbjct: 290 SIVNTFIGLFKDTSLVLIIGMFDVLGIGQAATTDPEWLGFATES--YVFVALVFWIFCFG 347

Query: 369 ISLYSVFIEKTLHKGSKK 386
           +S YS+++E  LH G K+
Sbjct: 348 MSRYSIYLENKLHTGHKR 365


>gi|92112257|ref|YP_572185.1| amino acid ABC transporter permease [Chromohalobacter salexigens
           DSM 3043]
 gi|91795347|gb|ABE57486.1| amino acid ABC transporter membrane protein 2, PAAT family
           [Chromohalobacter salexigens DSM 3043]
          Length = 369

 Score =  338 bits (868), Expect = 6e-91,   Method: Compositional matrix adjust.
 Identities = 176/378 (46%), Positives = 242/378 (64%), Gaps = 14/378 (3%)

Query: 10  YVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAV 69
           ++R  +++   PP  +RGI  W H+N F  P + ++T + I LL + +   + W  + A 
Sbjct: 5   FMRDEMIEARRPPDARRGIWRWFHRNLFNGPINSVVTVVTIGLLAWGLWPFVQWALIQAD 64

Query: 70  WIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSIL 129
           WIG +R  C+              ACW FI  R+E  I+G YP A RWR  +VF   + L
Sbjct: 65  WIGDSRQACSG-----------EGACWVFISARFESIIYGFYPEAARWRVDIVFALMAGL 113

Query: 130 LTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGI 188
           L  + IP  P K   +++    FPI ++ +L GG  GL  V T  WGGL++TL ++  GI
Sbjct: 114 LAWLAIPRVPGKRWAAVIAVIGFPIAAYVLLLGGHFGLIYVPTREWGGLMLTLTVATIGI 173

Query: 189 IISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDK 248
           + S+P+GI+LALGR SN+P +R   + FIE +RGVPL+TVLFMAS+MLPLF+P   + DK
Sbjct: 174 VGSLPIGIVLALGRRSNLPFVRAVSVVFIEFWRGVPLITVLFMASVMLPLFVPTQVEFDK 233

Query: 249 LLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIP 308
           LLRAL+G+  F SAY+AEV+RGGLQ+I  GQ EA  +LGL Y Q+M LI++PQ +K VIP
Sbjct: 234 LLRALVGIMLFWSAYMAEVVRGGLQAIPSGQDEAGKALGLGYWQRMGLIVLPQALKLVIP 293

Query: 309 GIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFS 368
           GIVNTFI LFKD+SL+ II +FDLL I+R   ++S W+     T G +F   VFW+FCFS
Sbjct: 294 GIVNTFIALFKDTSLVLIIGLFDLLAIIRAGLTDSDWLGFA--TEGYVFAALVFWVFCFS 351

Query: 369 ISLYSVFIEKTLHKGSKK 386
           +S YS +IE+ L  G   
Sbjct: 352 MSRYSQYIERRLQTGHTS 369


>gi|86148622|ref|ZP_01066904.1| ABC-type amino acid transport system, permease component [Vibrio
           sp. MED222]
 gi|218709392|ref|YP_002417013.1| ABC transporter transmembrane protein [Vibrio splendidus LGP32]
 gi|85833578|gb|EAQ51754.1| ABC-type amino acid transport system, permease component [Vibrio
           sp. MED222]
 gi|218322411|emb|CAV18564.1| ABC transporter: Transmembrane protein [Vibrio splendidus LGP32]
          Length = 365

 Score =  338 bits (867), Expect = 9e-91,   Method: Compositional matrix adjust.
 Identities = 171/372 (45%), Positives = 245/372 (65%), Gaps = 15/372 (4%)

Query: 17  QPSLPPVYQR-GIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNR 75
           QP LPP     G + W+ KN F  P + ++T ++       +  I  W FL A WIG+ R
Sbjct: 7   QPDLPPPANTVGPVGWLRKNLFNGPINSVVTVVLAYFAFTLLWAIADWAFLSADWIGTTR 66

Query: 76  TVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLI 135
             CT+             ACW FI  R++QF++G YP A+ WRP   + T +I +  +  
Sbjct: 67  DACTS-----------EGACWVFISVRWDQFMYGFYPEAELWRPRFFYATLAIFVALLAY 115

Query: 136 PSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPL 194
              P++    +    ++P     +LYGG+ GL +V+T  WGGLLVTL+I+  GI++S+P+
Sbjct: 116 EKTPKRTWIWLFFVNIYPFIIAGLLYGGVFGLEVVDTHKWGGLLVTLIIALVGIVVSLPI 175

Query: 195 GILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALL 254
           G+ LALGR S +P++R  C  +IE++RGVPL+TVLFMAS+MLPLFL +  + DKL+RAL+
Sbjct: 176 GVALALGRRSEMPIIRSMCTVYIEIWRGVPLITVLFMASVMLPLFLSEGMETDKLIRALV 235

Query: 255 GVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTF 314
           GV  F++AY+AEV+RGGLQ+I KGQ+EAA++LGLSY +K  LII+PQ +K  IP IVNTF
Sbjct: 236 GVVLFSAAYMAEVIRGGLQAIPKGQYEAADALGLSYWKKTGLIILPQALKITIPSIVNTF 295

Query: 315 IGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSV 374
           IGLFKD+SL+ II MFD+LGI +   ++  W+   T +   +F+  VFW+FCF +S YS+
Sbjct: 296 IGLFKDTSLVLIIGMFDVLGIGQAANTDPEWLGYSTES--YVFVALVFWVFCFGMSRYSI 353

Query: 375 FIEKTLHKGSKK 386
           ++E  LH G K+
Sbjct: 354 WLENRLHTGHKR 365


>gi|84394263|ref|ZP_00992989.1| ABC-type amino acid transport system, permease component [Vibrio
           splendidus 12B01]
 gi|84375102|gb|EAP92023.1| ABC-type amino acid transport system, permease component [Vibrio
           splendidus 12B01]
          Length = 365

 Score =  338 bits (866), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 171/372 (45%), Positives = 248/372 (66%), Gaps = 15/372 (4%)

Query: 17  QPSLPPVYQR-GIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNR 75
           QP LPP     G + W+ KN F  P + ++T ++       +  I  W F++A WIG+ R
Sbjct: 7   QPDLPPPANTVGPVGWLRKNLFNGPINSVVTVVLGYFAFTLLWAIADWAFINADWIGTTR 66

Query: 76  TVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLI 135
             CT+           + ACW FI  R++QF++G YP A+ WRP L + T +I +  +  
Sbjct: 67  DACTS-----------DGACWVFISVRWDQFMYGFYPEAELWRPRLFYATLAIFVVLLAY 115

Query: 136 PSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPL 194
              P++    +    ++P     +LYGG+ GL +V+T  WGGLLVTL+I+  GI++S+P+
Sbjct: 116 EKTPKRTWIWLFFVNIYPFIIAGLLYGGVFGLEVVDTHKWGGLLVTLIIALVGIVVSLPI 175

Query: 195 GILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALL 254
           G+ LALGR S +P++R  C  +IE++RGVPL+TVLFMAS+MLPLFL +  + DKL+RAL+
Sbjct: 176 GVALALGRRSEMPIIRSMCTVYIEIWRGVPLITVLFMASVMLPLFLSEGMETDKLIRALV 235

Query: 255 GVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTF 314
           GV  F++AY+AEV+RGGLQ+I KGQ+EAA++LGLSY +K  LII+PQ +K  IP IVNTF
Sbjct: 236 GVVLFSAAYMAEVIRGGLQAIPKGQYEAADALGLSYWKKTGLIILPQALKITIPSIVNTF 295

Query: 315 IGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSV 374
           IGLFKD+SL+ II MFD+LGI +   ++  W+   T +   +F+  VFW+FCF +S YS+
Sbjct: 296 IGLFKDTSLVLIIGMFDVLGIGQAANTDPEWLGFSTES--YVFVALVFWVFCFGMSRYSI 353

Query: 375 FIEKTLHKGSKK 386
           ++E  LH G K+
Sbjct: 354 WLENRLHTGHKR 365


>gi|83592338|ref|YP_426090.1| amino acid ABC transporter permease [Rhodospirillum rubrum ATCC
           11170]
 gi|83575252|gb|ABC21803.1| Amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine [Rhodospirillum rubrum ATCC 11170]
          Length = 365

 Score =  338 bits (866), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 182/369 (49%), Positives = 249/369 (67%), Gaps = 18/369 (4%)

Query: 21  PPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTT 80
           PPV   G IAWI +N   +P +I LTAL + +++     ++ W  LDA +IG  +  C  
Sbjct: 12  PPVQTTGPIAWIRQNLLSSPFNIALTALALWIVVSGGSSLVTWAILDATFIGEGQDAC-- 69

Query: 81  VSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPR 140
            S GG        ACWAFI +R + F +G YP A+RWR  L FL  ++ L P  I  F  
Sbjct: 70  -SNGG--------ACWAFIINRLDFFTYGFYPAAERWRVNLGFLMLAVALVPQFITGFSG 120

Query: 141 KFLNSILLFGL--FPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPLGIL 197
           +   ++ LFGL   P+ +  +L GG+ GL  V+TS WGGL++TLV+++ GI+ ++PLG++
Sbjct: 121 R--RALGLFGLTALPVITGVLLVGGVFGLRPVDTSQWGGLMLTLVLAYVGIVAALPLGMV 178

Query: 198 LALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVS 257
           LALGR S++PV+R +C TFIEL+RGVPL++VLFMAS+MLPLFLP     DKLLRAL+G++
Sbjct: 179 LALGRRSSMPVVRISCTTFIELWRGVPLISVLFMASVMLPLFLPTGVTFDKLLRALIGIT 238

Query: 258 AFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGL 317
            F SAY+AEV+RGGLQ+I +GQFEAA++LGL + +   LII+PQ +K VIPG+VNTFI L
Sbjct: 239 LFQSAYMAEVIRGGLQAIPRGQFEAASALGLGFWRSTGLIILPQALKLVIPGVVNTFIAL 298

Query: 318 FKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIE 377
           FKD++L+ II + D+LG V+    +  W  S     G IF GF FWIFCF +S YS  +E
Sbjct: 299 FKDTTLVLIIGLLDILGTVQSAIVDPAW--SRVAVEGYIFAGFCFWIFCFGMSRYSQALE 356

Query: 378 KTLHKGSKK 386
             LH G +K
Sbjct: 357 SKLHTGHRK 365


>gi|237799857|ref|ZP_04588318.1| amino acid ABC transporter permease [Pseudomonas syringae pv.
           oryzae str. 1_6]
 gi|331022712|gb|EGI02769.1| amino acid ABC transporter permease [Pseudomonas syringae pv.
           oryzae str. 1_6]
          Length = 365

 Score =  337 bits (865), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 177/372 (47%), Positives = 250/372 (67%), Gaps = 15/372 (4%)

Query: 17  QPSLPPVYQR-GIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNR 75
           +P +PP  +  G +AW+ +N F +  + LLT L + L+   +P I+ W  LDA W+G+ +
Sbjct: 7   KPDMPPPGKVFGPVAWMRQNLFSSWLNTLLTLLSLYLIYLIVPPILSWALLDANWVGTTK 66

Query: 76  TVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLI 135
             CT              ACW FI  R+ QF++G +P   RWR  L  +   +   P+ I
Sbjct: 67  EDCTKA-----------GACWVFIEQRFGQFMYGYFPNELRWRVDLTAILAIVGAAPLFI 115

Query: 136 PSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPL 194
             F RK +  I    ++P+ +F++L+GG+ GL+ V TS WGGL++TLVI+  GI+ ++PL
Sbjct: 116 SKFQRKAVYGICFLVIYPVVAFYLLHGGVFGLTNVPTSQWGGLMLTLVIATVGIVGALPL 175

Query: 195 GILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALL 254
           GILLALGR SN+P +R  C+TFIE +RGVPL+TVLFM+S+MLPLF+P+  + DKLLRAL+
Sbjct: 176 GILLALGRRSNMPAVRVVCVTFIEFWRGVPLITVLFMSSVMLPLFMPEGMNFDKLLRALI 235

Query: 255 GVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTF 314
           GV  F SAYIAEV+RGG+Q+I KGQ+EAA+++GL Y + M L+I+PQ +K VIPGIVNTF
Sbjct: 236 GVILFQSAYIAEVVRGGMQAIPKGQYEAASAMGLGYWRSMGLVILPQALKMVIPGIVNTF 295

Query: 315 IGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSV 374
           I LFKD+SL+ II +FDLL  V+   ++  W+     T G +F   VFWIFCF +S YS+
Sbjct: 296 IALFKDTSLVIIIGLFDLLNSVKQATADPAWLGMA--TEGYVFAALVFWIFCFGMSRYSM 353

Query: 375 FIEKTLHKGSKK 386
            +E+ L  G K+
Sbjct: 354 HLERKLDTGHKR 365


>gi|77457202|ref|YP_346707.1| amino acid ABC transporter permease [Pseudomonas fluorescens Pf0-1]
 gi|77381205|gb|ABA72718.1| amino acid ABC transporter membrane protein 2, PAAT family
           [Pseudomonas fluorescens Pf0-1]
          Length = 365

 Score =  337 bits (864), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 177/372 (47%), Positives = 241/372 (64%), Gaps = 15/372 (4%)

Query: 17  QPSLPPVYQR-GIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNR 75
           +P +PP  +  G +AWI  N F +  + LLT     L+   +P I+ W  LDA W+G+ R
Sbjct: 7   KPDMPPPAKVFGPMAWIRANMFSSWLNTLLTLFAFYLIYLVVPPILSWAILDANWVGTTR 66

Query: 76  TVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLI 135
             CT              ACW FI  R+ QF++G YP   RWR  L      I + P+ I
Sbjct: 67  ADCTK-----------EGACWVFIQQRFGQFMYGYYPPELRWRVDLTVWLAVIGVAPLFI 115

Query: 136 PSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPL 194
                K +  +    ++PI ++ +L+GG+ GL  V TS WGGL++TLVI+  GI  ++PL
Sbjct: 116 KRVAHKAVYGLSFLVVYPIVAWCLLHGGVFGLDTVATSQWGGLMLTLVIATVGIAGALPL 175

Query: 195 GILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALL 254
           GI+LALGR SN+P +R  C+TFIE +RGVPL+TVLFM+S+MLPLFLP+  + DKLLRAL+
Sbjct: 176 GIVLALGRRSNMPAIRVVCVTFIEFWRGVPLITVLFMSSVMLPLFLPEGMNFDKLLRALI 235

Query: 255 GVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTF 314
           GV  F SAY+AEV+RGGLQ+I KGQ+EAA ++GL Y + M L+I+PQ +K VIPGIVNTF
Sbjct: 236 GVILFQSAYVAEVVRGGLQAIPKGQYEAAAAMGLGYWRAMGLVILPQALKLVIPGIVNTF 295

Query: 315 IGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSV 374
           I LFKD+SL+ II +FDLL  V+   ++  W+     T G +F   VFWIFCF +S YS+
Sbjct: 296 IALFKDTSLVIIIGLFDLLNSVKQAAADPKWLGMA--TEGYVFAALVFWIFCFGMSRYSM 353

Query: 375 FIEKTLHKGSKK 386
            +E+ L  G K+
Sbjct: 354 HLERKLDTGHKR 365


>gi|148980392|ref|ZP_01816035.1| ABC-type amino acid transport system, permease component
           [Vibrionales bacterium SWAT-3]
 gi|145961264|gb|EDK26576.1| ABC-type amino acid transport system, permease component
           [Vibrionales bacterium SWAT-3]
          Length = 366

 Score =  337 bits (863), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 172/374 (45%), Positives = 250/374 (66%), Gaps = 18/374 (4%)

Query: 17  QPSLPPVYQR-GIIAWIHKNFFGTPKDILLTALIICLLLFS--IPGIIHWVFLDAVWIGS 73
           QP LPP     G++ W+ KN F  P + ++T +++  + FS  +     W FL+A W+G+
Sbjct: 7   QPDLPPPANTVGVVGWLRKNLFNGPINSIVT-VVLGYIAFSSLLWTTFDWAFLNADWVGT 65

Query: 74  NRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPM 133
            R  CT+             ACW FI  R++QF++G YP A+ WRP L + T +I +  +
Sbjct: 66  TRDACTS-----------EGACWVFISVRWDQFMYGFYPEAELWRPRLFYATLAIFVALL 114

Query: 134 LIPSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISM 192
                P++    +    ++P     +LYGG+ GL +V+T  WGGLLVTL+I+  GI++S+
Sbjct: 115 AYEKTPKRTWIWLFFVNIYPFIIAGLLYGGVFGLEVVDTHKWGGLLVTLIIALVGIVVSL 174

Query: 193 PLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRA 252
           P+G+ LALGR S +P++R  C  +IE++RGVPL+TVLFMAS+MLPLFL    + DKL RA
Sbjct: 175 PIGVALALGRRSEMPIIRSICTVYIEIWRGVPLITVLFMASVMLPLFLTAGSETDKLFRA 234

Query: 253 LLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVN 312
           L+GV  F++AY+AEV+RGGLQ+I KGQ+EAA++LGL+Y +KM LII+PQ +K  IP IVN
Sbjct: 235 LVGVVLFSAAYMAEVIRGGLQAIPKGQYEAADALGLTYWKKMGLIILPQALKITIPSIVN 294

Query: 313 TFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLY 372
           TFIGLFKD+SL+ II MFD+LGI +   ++  W+   T +   +F+  VFW+FCF +S Y
Sbjct: 295 TFIGLFKDTSLVLIIGMFDVLGIGQAANTDPEWLGFATES--YVFVALVFWVFCFGMSRY 352

Query: 373 SVFIEKTLHKGSKK 386
           S+++E  LH G K+
Sbjct: 353 SIWLENRLHTGHKR 366


>gi|152998390|ref|YP_001343225.1| polar amino acid ABC transporter inner membrane subunit
           [Marinomonas sp. MWYL1]
 gi|150839314|gb|ABR73290.1| polar amino acid ABC transporter, inner membrane subunit
           [Marinomonas sp. MWYL1]
          Length = 366

 Score =  335 bits (859), Expect = 7e-90,   Method: Compositional matrix adjust.
 Identities = 168/376 (44%), Positives = 253/376 (67%), Gaps = 24/376 (6%)

Query: 17  QPSLPP-VYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNR 75
            PSLPP V   G +AW+ +N F +P +I LT   + +L   +P +I W F++A W GS++
Sbjct: 8   SPSLPPPVTSVGAVAWVRQNLFSSPLNIFLTLFSLYILYLLVPPVIEWAFINATWEGSSK 67

Query: 76  TVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLI 135
             CT    GG        ACWAFI   ++QF++G YP A+ WR     +  +++L  +++
Sbjct: 68  AACTA---GG--------ACWAFIGVYFDQFMYGLYPEAETWR-----INLAVILLVVMV 111

Query: 136 PSFPRKFLN----SILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIII 190
            +F  K +N    SI +  ++PI ++F+  GG+ GL +VETSLWGGL +T+++   GI+ 
Sbjct: 112 GAFAVKTINKLYLSIAILVVYPIVAYFLFAGGVFGLEVVETSLWGGLFLTVLLGVIGIVA 171

Query: 191 SMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLL 250
           S PLGI+LALGR S +P+ +  C+ FIE  R VPL+T+LFMAS+M+PLFLP+  + +KLL
Sbjct: 172 SFPLGIVLALGRRSEMPIAKSVCVVFIETIRAVPLITILFMASVMIPLFLPEGLNFNKLL 231

Query: 251 RALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGI 310
           R L+G++ F++AY+AEV+RGGLQ+I KGQ+EAA+++GL+Y Q M L+I+PQ +K VIPGI
Sbjct: 232 RVLIGITLFSAAYMAEVVRGGLQAIPKGQYEAADAMGLTYWQSMILVILPQALKLVIPGI 291

Query: 311 VNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSIS 370
           VN+FI LFKD++L+ I+ MFD LG ++    +S W+   T   G  F   ++W+ CF +S
Sbjct: 292 VNSFIALFKDTTLVYIVGMFDFLGRIQAANHDSNWLG--TTIEGYAFAALIYWVICFGMS 349

Query: 371 LYSVFIEKTLHKGSKK 386
            YS+ +E+ L  G K+
Sbjct: 350 RYSMALERKLETGHKR 365


>gi|325275054|ref|ZP_08141042.1| polar amino acid ABC transporter inner membrane subunit
           [Pseudomonas sp. TJI-51]
 gi|324099817|gb|EGB97675.1| polar amino acid ABC transporter inner membrane subunit
           [Pseudomonas sp. TJI-51]
          Length = 365

 Score =  333 bits (854), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 175/378 (46%), Positives = 246/378 (65%), Gaps = 15/378 (3%)

Query: 11  VRKRLLQPSLPP-VYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAV 69
           +   + +P +PP V   G++AW+  N F +  + LLT   + L+   +P ++ W  +DA 
Sbjct: 1   MNAHVFKPDMPPPVKTVGVLAWMRTNLFSSWLNTLLTLFALYLIWLIVPPLLQWALIDAN 60

Query: 70  WIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSIL 129
           W+G+ R  CT            + ACW F+  R+ QF++G YP+  RWR  L      + 
Sbjct: 61  WVGTTRADCTK-----------DGACWVFVQQRFGQFMYGYYPVELRWRVDLTVWLAVLG 109

Query: 130 LTPMLIPSFPRKFLNSILLFGLFPIFSF-FVLYGGLGLSIVETSLWGGLLVTLVISFFGI 188
             P+ I  FPRK L  +    L+P+ ++  +  G LGLS V TS WGGL++TLVI+  GI
Sbjct: 110 AAPLFIKRFPRKALYGLGFLVLYPLLAYTLLHGGLLGLSNVSTSQWGGLMLTLVIATVGI 169

Query: 189 IISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDK 248
           + ++PLGILLALGR S +P ++  C+TFIE +RGVPL+TVLFM+S+MLPLFLP+    DK
Sbjct: 170 VGALPLGILLALGRRSRMPAVKVVCVTFIEFWRGVPLITVLFMSSVMLPLFLPEGMSFDK 229

Query: 249 LLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIP 308
           LLRA++GV  F SAY+AEV+RGGLQ+I KGQ+EAA ++GL Y + M L+I+PQ +K VIP
Sbjct: 230 LLRAMIGVILFQSAYVAEVVRGGLQAIPKGQYEAAAAMGLGYWRAMGLVILPQALKLVIP 289

Query: 309 GIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFS 368
           GIVNTFI LFKD+SL+ II +FDLL  V+   ++  W+     T G +F   VFWIFCF 
Sbjct: 290 GIVNTFIALFKDTSLVIIIGLFDLLNSVKQAAADPAWLG--MATEGYVFAALVFWIFCFG 347

Query: 369 ISLYSVFIEKTLHKGSKK 386
           +S YS+ +E+ L  G K+
Sbjct: 348 MSRYSMHLERKLDTGHKR 365


>gi|326797353|ref|YP_004315173.1| polar amino acid ABC transporter inner membrane subunit
           [Marinomonas mediterranea MMB-1]
 gi|326548117|gb|ADZ93337.1| polar amino acid ABC transporter, inner membrane subunit
           [Marinomonas mediterranea MMB-1]
          Length = 366

 Score =  332 bits (851), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 172/361 (47%), Positives = 245/361 (67%), Gaps = 15/361 (4%)

Query: 27  GIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGI 86
           G +AW+  NFF +P +I LT   + +L   IP ++ W FLDA W GS++  CT    GG 
Sbjct: 19  GPVAWVRANFFSSPLNIALTLFSVYVLYLMIPPVLQWGFLDATWEGSSKAACTA---GG- 74

Query: 87  QPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSI 146
                  ACWAFI   +EQF++G YP  + WR  L  +   +L+    I +  + FL SI
Sbjct: 75  -------ACWAFIGAYFEQFMYGLYPETEYWRINLALILLIVLVGMFAIKAVNKLFL-SI 126

Query: 147 LLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSN 205
            +  ++PI +F +  GG+ GL  VETS WGGL +T ++   GI+ S PLG+LLALGR SN
Sbjct: 127 AIIVVYPIVAFILFSGGMFGLETVETSNWGGLFLTTLLGVVGIVASFPLGVLLALGRRSN 186

Query: 206 IPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIA 265
           +P+++  C+ FIE  R VPL+T+LFMAS+M+PLFLP+  + +KLLR L+G++ F++AY+A
Sbjct: 187 MPIVKSVCVVFIETIRAVPLITILFMASVMIPLFLPEGLNFNKLLRVLIGITLFSAAYMA 246

Query: 266 EVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLIS 325
           EV+RGGLQ+I KGQ+EAA+++GL+Y Q M L+I+PQ +K VIPGIVNTFIGLFKD++L+ 
Sbjct: 247 EVIRGGLQAIPKGQYEAADAMGLTYWQSMCLVILPQALKLVIPGIVNTFIGLFKDTTLVY 306

Query: 326 IINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSK 385
           I+ MFDLLG ++    ++ W+   T   G  F GFV+WI CF +S YS+ +E+ L  G K
Sbjct: 307 IVGMFDLLGRIQAANHDANWLG--TTIEGYAFAGFVYWIICFGMSRYSMAVERKLDTGHK 364

Query: 386 K 386
           +
Sbjct: 365 R 365


>gi|330504738|ref|YP_004381607.1| polar amino acid ABC transporter inner membrane subunit
           [Pseudomonas mendocina NK-01]
 gi|328919024|gb|AEB59855.1| polar amino acid ABC transporter, inner membrane subunit
           [Pseudomonas mendocina NK-01]
          Length = 365

 Score =  331 bits (848), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 172/378 (45%), Positives = 245/378 (64%), Gaps = 15/378 (3%)

Query: 11  VRKRLLQPSLPP-VYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAV 69
           ++  + +P LPP     G + W+  N F    + LLT L + L+   +P ++ W   DA 
Sbjct: 1   MQTHIFKPDLPPPTMSVGALGWLKANLFSNWFNTLLTLLALYLIWLMVPPLLQWAIFDAN 60

Query: 70  WIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSIL 129
           W+GS R  CT              ACW FI  R+ QF++G YP   RWR         + 
Sbjct: 61  WVGSTRADCTK-----------EGACWVFIQQRFGQFMYGFYPGELRWRVDATIWLAIVG 109

Query: 130 LTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGI 188
             P+ +P  PRK +  +    ++PI ++ +L+GG+ GLS+V TS WGGL++TLVI++ GI
Sbjct: 110 AAPLFVPQMPRKAVYGVAFLVIYPIIAWCLLHGGVFGLSVVPTSRWGGLMLTLVIAYVGI 169

Query: 189 IISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDK 248
             ++PLGILLALGR SN+P ++  C+TFIE +RGVPL+ VLFM+S+MLPLFLP+   +DK
Sbjct: 170 TGALPLGILLALGRRSNLPAIKVICVTFIEFWRGVPLIIVLFMSSVMLPLFLPEGMSLDK 229

Query: 249 LLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIP 308
           LLRAL+ V  F +AYIAEV+RGG+Q+I KGQ+EAA ++GL Y + M L+I+PQ +K VIP
Sbjct: 230 LLRALVMVIFFEAAYIAEVVRGGMQAIPKGQYEAAAAMGLGYWRTMGLVILPQALKLVIP 289

Query: 309 GIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFS 368
           GIVNTFI LFKD+SL+ II +FDLL  ++   ++ +W+     T G +F   +FWIFCF 
Sbjct: 290 GIVNTFIALFKDTSLVIIIGLFDLLNSIKQATTDPSWLGMA--TEGYVFAALIFWIFCFG 347

Query: 369 ISLYSVFIEKTLHKGSKK 386
           +S YS+ +E+ L  G K+
Sbjct: 348 MSRYSMHLERKLDTGHKR 365


>gi|87121082|ref|ZP_01076973.1| amino acid ABC transporter, permease protein [Marinomonas sp.
           MED121]
 gi|86163574|gb|EAQ64848.1| amino acid ABC transporter, permease protein [Marinomonas sp.
           MED121]
          Length = 366

 Score =  329 bits (843), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 172/372 (46%), Positives = 248/372 (66%), Gaps = 16/372 (4%)

Query: 17  QPSLPP-VYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNR 75
            PSLPP V   G +AW+  N   +P +I LT     +L   IP ++ W  ++A + G ++
Sbjct: 8   SPSLPPPVNSVGAVAWVRHNLLSSPLNIFLTLFSFYVLYLLIPPVVEWGLINATFEGESK 67

Query: 76  TVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLI 135
             CT    GG        ACWAFI   +EQF++G YP  + WR  L  +   +L+    I
Sbjct: 68  AACTA---GG--------ACWAFIGVYFEQFMYGLYPADETWRIDLALILLVVLIAMFAI 116

Query: 136 PSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPL 194
            +  + FL SI +  ++P+ ++F+  GG+ GL IVETSLWGGL +T ++   GI+ S PL
Sbjct: 117 KAVNKLFL-SIGIIAVYPVIAYFLFAGGVFGLEIVETSLWGGLFLTTLLGVVGIVASFPL 175

Query: 195 GILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALL 254
           G+LLALGR S++P+ +  CI FIE  R VPL+T+LFMAS+M+PLFLPD  + +KL+R L+
Sbjct: 176 GVLLALGRQSSMPIAKSVCIVFIETIRAVPLITILFMASVMIPLFLPDGMNFNKLMRVLI 235

Query: 255 GVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTF 314
           G++ F++AY+AEV+RGGLQ+I KGQ+EAA+++GL+Y Q M L+I+PQ +K VIPGIVNTF
Sbjct: 236 GITLFSAAYMAEVIRGGLQAIPKGQYEAADAMGLTYWQSMVLVILPQALKLVIPGIVNTF 295

Query: 315 IGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSV 374
           IGLFKD++L+ I+ MFDLLG ++    +S+W+   T   G  F GF++W  CF +S YS+
Sbjct: 296 IGLFKDTTLVYIVGMFDLLGRIQAATHDSSWLG--TTIEGYAFAGFIYWAACFGMSRYSM 353

Query: 375 FIEKTLHKGSKK 386
            IE+ L  G K+
Sbjct: 354 RIERKLETGHKR 365


>gi|308094386|ref|ZP_05888982.2| general L-amino acid transport system permease protein AapM [Vibrio
           parahaemolyticus AN-5034]
 gi|308094323|gb|EFO44018.1| general L-amino acid transport system permease protein AapM [Vibrio
           parahaemolyticus AN-5034]
          Length = 349

 Score =  326 bits (836), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 164/344 (47%), Positives = 237/344 (68%), Gaps = 15/344 (4%)

Query: 45  LTALIICLLLF-SIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRY 103
           +  LI+  ++F ++  I+ W F++A WIGS R  C+              ACW FI  R+
Sbjct: 19  IVTLILAYIVFNALWHIVDWAFINADWIGSTRDDCSR-----------EGACWVFISVRW 67

Query: 104 EQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGG 163
           EQF++G YP A+ WRP L ++T +I    +     P++    +    ++P     +LYGG
Sbjct: 68  EQFMYGFYPEAELWRPRLFYITLAIFTVLLAYEKTPKRLWIWLFFVNIYPFIVAALLYGG 127

Query: 164 L-GLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRG 222
           + GL +VET  WGGLLVTL+I+  GI++S+P+G+ LALGR S++P++R  C  +IE++RG
Sbjct: 128 VFGLEVVETHKWGGLLVTLIIALVGIVVSLPIGVALALGRRSDMPIIRSICTIYIEVWRG 187

Query: 223 VPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEA 282
           VPL+TVLFMAS+MLPLFL +  + DKL+RAL+GV  F++AY+AEV+RGGLQ+I KGQ+EA
Sbjct: 188 VPLITVLFMASVMLPLFLAEGSETDKLIRALIGVVMFSAAYMAEVVRGGLQAIPKGQYEA 247

Query: 283 ANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSE 342
           A++LGLSY +K  LII+PQ +K  IP IVNTFIGLFKD+SL+ II MFD+LGI +   ++
Sbjct: 248 ADALGLSYWKKTGLIILPQALKITIPSIVNTFIGLFKDTSLVLIIGMFDVLGIGQAANTD 307

Query: 343 STWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
             W+   T +   +F+  VFW+FCF +S YS+++E  LH G K+
Sbjct: 308 PEWLGFATES--YVFVALVFWVFCFGMSRYSIWLENKLHTGHKR 349


>gi|319957436|ref|YP_004168699.1| amino acid ABC transporter membrane protein 2, paat family
           [Nitratifractor salsuginis DSM 16511]
 gi|319419840|gb|ADV46950.1| amino acid ABC transporter membrane protein 2, PAAT family
           [Nitratifractor salsuginis DSM 16511]
          Length = 362

 Score =  323 bits (828), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 171/365 (46%), Positives = 239/365 (65%), Gaps = 16/365 (4%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
           Q   PP+ +RG IAW+  N   +P +I  T L + +L ++IP  + W F+DA + G ++ 
Sbjct: 8   QAKEPPLVERGPIAWVRHNLLSSPFNIAFTLLGLAILYWTIPPFVKWAFIDAHFAGHSKA 67

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            C     GG        ACW FI  + + F+FG YP  Q WRP  V  +   L+      
Sbjct: 68  DCA----GG-------GACWVFIKVKLDMFLFGFYPHDQLWRPKTVLASAVALVAFAKFV 116

Query: 137 SFPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
               KF   +LL  LFPI+++ +L+GG  GL +VETS WGGLL+TLVI+  GI++S P+G
Sbjct: 117 KGLHKF--KLLLIVLFPIYAYILLHGGYFGLPVVETSKWGGLLLTLVIASVGIVLSFPIG 174

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           ILLALGR S +P+++   + +IE  RGVPL+TVLFMAS++LPLF P+  + +KL RAL+G
Sbjct: 175 ILLALGRQSKLPIIKSLSVFYIEFVRGVPLITVLFMASVVLPLFFPEGVNFNKLARALIG 234

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           ++ F +AY+AE +R G Q+I KGQ+EAA++LGL Y QKM L+I+PQ IK  IP +V TFI
Sbjct: 235 ITLFEAAYVAENIRSGFQAIPKGQYEAADALGLGYWQKMALVILPQAIKVTIPNLVGTFI 294

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD+SL+ II +FDLL +V V  ++  W+     T G +F+ FVFWIF FS+S+YS  
Sbjct: 295 SLFKDTSLVMIIGLFDLLAMVNVTANDRDWLG--MDTEGYVFVAFVFWIFTFSMSMYSKR 352

Query: 376 IEKTL 380
           +EK L
Sbjct: 353 LEKKL 357


>gi|83648450|ref|YP_436885.1| amino acid ABC transporter permease [Hahella chejuensis KCTC 2396]
 gi|83636493|gb|ABC32460.1| ABC-type amino acid transport system, permease component [Hahella
           chejuensis KCTC 2396]
          Length = 365

 Score =  320 bits (819), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 170/370 (45%), Positives = 244/370 (65%), Gaps = 15/370 (4%)

Query: 18  PSLPPVYQR-GIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
           P LPP     G++ W+  N F +P + +LT +   L+   I   + W  ++A  IG++R 
Sbjct: 9   PDLPPPSNTVGVVGWLRTNLFSSPVNSVLTIIAFYLIYSGISWFVSWGVINADVIGTSRE 68

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            CT+   GG        ACW FI  R  QFI+G YP  + WR  L+F    I +  ++I 
Sbjct: 69  DCTS---GG--------ACWVFISVRLPQFIYGFYPPDEVWRINLMFAIAIIGIVALMID 117

Query: 137 SFPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
             P+K   ++ +  +FPI ++F+LYGG  GL +VET  WGGL +TLVI+  GI++S+P+G
Sbjct: 118 KTPKKGWIALFMLVIFPIIAYFLLYGGAFGLEVVETHKWGGLTLTLVIATVGIVVSLPIG 177

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           + LALGR S +P+++   + +IE +RGVPL+TVLFMAS+MLPLF+ +  + DKL+RA++G
Sbjct: 178 VALALGRRSEMPIVKSISVVYIEFWRGVPLITVLFMASVMLPLFMSEGTETDKLVRAMIG 237

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           V  F SAY+AEV+RGGLQ+I KGQ+EAA+SLGLSY + M  II+PQ +K +IPGIVNTFI
Sbjct: 238 VIMFQSAYMAEVVRGGLQAIPKGQYEAAHSLGLSYWKMMFFIILPQALKLMIPGIVNTFI 297

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD+SL+ II +FDLL IV+    +  W+       G IF+ F+FW+FCF +S YS  
Sbjct: 298 ALFKDTSLVLIIGLFDLLAIVQSALHDPKWLG--FSVEGYIFVAFLFWVFCFGMSRYSQA 355

Query: 376 IEKTLHKGSK 385
           +E+ L+   +
Sbjct: 356 LERKLNTSHR 365


>gi|311695085|gb|ADP97958.1| amino acid ABC transporter, permease protein [marine bacterium
           HP15]
          Length = 362

 Score =  320 bits (819), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 174/387 (44%), Positives = 255/387 (65%), Gaps = 29/387 (7%)

Query: 1   MIDSCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGI 60
           M +S  + P   K+ L+P          + W+ +N F    + +LT  +  LL+ S+  +
Sbjct: 2   MTESTMKAP---KKALRP----------VKWMRENLFSGWFNTVLTLGVAYLLVTSVGPL 48

Query: 61  IHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPI 120
           ++W FLDA ++GS+ + CT              ACW FI  R   FI+G YP   +WR  
Sbjct: 49  LNWFFLDANFVGSDPSACTGA-----------GACWLFISQRLNFFIYGFYPDELQWRVD 97

Query: 121 LVFLTGSILLTPMLIPSFP-RKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLL 178
           ++FL  ++   P  I  FP RK+L    +FGL PI  +F++ GG  GL  V++S WGGL+
Sbjct: 98  VMFLLLAVSFVPQFIERFPGRKWLGLFGIFGL-PIVGYFLIPGGSFGLEEVQSSKWGGLM 156

Query: 179 VTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPL 238
           +TL++++ GII S+P+GILLALGR S++P++R  C+ FIE++R VPL+TVLFMAS+MLPL
Sbjct: 157 LTLILAYIGIIASLPIGILLALGRRSDMPIIRGICVVFIEVWRAVPLITVLFMASVMLPL 216

Query: 239 FLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLII 298
           FLP+  + +KL RAL+G++ + SAY+AEV+RGGLQ+I +GQ+EAA++LGL Y +KM L+I
Sbjct: 217 FLPEGVNFEKLARALIGITLWQSAYMAEVIRGGLQAIPRGQYEAADALGLGYWRKMGLVI 276

Query: 299 MPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFI 358
           +PQ +K VIPGIVNTFI LFKD++L+ II +FD+LG V+   ++  W +      G +F+
Sbjct: 277 LPQALKMVIPGIVNTFISLFKDTTLVLIIGLFDILGTVQSTVTDPAWQN--VAIEGYVFV 334

Query: 359 GFVFWIFCFSISLYSVFIEKTLHKGSK 385
            F FW+FCF IS YS  +E+ L  G K
Sbjct: 335 AFCFWVFCFGISRYSQNLERKLDTGHK 361


>gi|157148850|ref|YP_001456169.1| hypothetical protein CKO_04683 [Citrobacter koseri ATCC BAA-895]
 gi|157086055|gb|ABV15733.1| hypothetical protein CKO_04683 [Citrobacter koseri ATCC BAA-895]
          Length = 368

 Score =  318 bits (814), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 170/374 (45%), Positives = 235/374 (62%), Gaps = 16/374 (4%)

Query: 13  KRLLQPSLPPVYQRG--IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVW 70
           K LL   + P       II W+ KN F +  + LLT   + L+   IP +++W FL A W
Sbjct: 4   KALLSHPMRPANNGAGRIILWVRKNLFSSWSNSLLTLFCLWLMWILIPPLLNWAFLQANW 63

Query: 71  IGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILL 130
           +GS R  CT              ACW FI++R+ QF++G YP  QRWR  L  L G   +
Sbjct: 64  VGSTRADCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLVGLASI 112

Query: 131 TPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGII 189
            PM   + PR+         ++PI  ++++YGG  GL  VET  WGGL +TL+I+  GI 
Sbjct: 113 VPMFWKAMPRRGRYIAAWAVIYPIVVWWLMYGGFFGLERVETRQWGGLTLTLIIASVGIA 172

Query: 190 ISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKL 249
            ++PLGILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL
Sbjct: 173 GALPLGILLALGRRSHMPIVRMLSVIFIEFWRGVPLITVLFMSSVMLPLFMSEGTSIDKL 232

Query: 250 LRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPG 309
           +RAL+GV  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG
Sbjct: 233 IRALVGVILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPG 292

Query: 310 IVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSI 369
           +VNT I LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+
Sbjct: 293 LVNTIIALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSM 350

Query: 370 SLYSVFIEKTLHKG 383
           S YS  +EK  + G
Sbjct: 351 SRYSQHLEKRFNTG 364


>gi|260596108|ref|YP_003208679.1| Inner membrane amino-acid ABC transporter permease yhdY
           [Cronobacter turicensis z3032]
 gi|260215285|emb|CBA27215.1| Inner membrane amino-acid ABC transporter permease protein yhdY
           [Cronobacter turicensis z3032]
          Length = 365

 Score =  318 bits (814), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 165/360 (45%), Positives = 229/360 (63%), Gaps = 14/360 (3%)

Query: 25  QRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQG 84
            RG + W+ KN F +  + LLT   + ++   IP +++W F  A W+GS R  CT     
Sbjct: 15  NRGALVWMRKNLFSSWGNSLLTLFCLWMMWELIPPLLNWAFFQANWVGSTRADCTK---- 70

Query: 85  GIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLN 144
                    ACW FI+ R+ QF++G YP  +RWR  L  + G + + PM   + PR+   
Sbjct: 71  -------EGACWVFIHARFGQFMYGLYPHDERWRINLALIIGLLSIAPMFWHALPRRGRY 123

Query: 145 SILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRN 203
                  +P+  +++LYGG LGL  VET  WGGL +TL+I+  GI  ++PLGILLALGR 
Sbjct: 124 IACWAVAYPVVVWWLLYGGFLGLERVETRQWGGLTLTLIIASVGIAGALPLGILLALGRR 183

Query: 204 SNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAY 263
           S +PV+R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV  F SAY
Sbjct: 184 SGMPVVRVLSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVGVILFQSAY 243

Query: 264 IAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSL 323
           +AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I LFKD+SL
Sbjct: 244 VAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTIIALFKDTSL 303

Query: 324 ISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKG 383
           + II +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  +EK  H G
Sbjct: 304 VIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQHLEKRFHTG 361


>gi|126668365|ref|ZP_01739323.1| Amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine [Marinobacter sp. ELB17]
 gi|126627181|gb|EAZ97820.1| Amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine [Marinobacter sp. ELB17]
          Length = 361

 Score =  317 bits (812), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 165/372 (44%), Positives = 245/372 (65%), Gaps = 14/372 (3%)

Query: 16  LQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNR 75
           L   LPP    G+I W+ KN F T  +I+LT +   L++ S   +++WV L+A + G + 
Sbjct: 3   LPSELPPRQDIGVIGWVRKNLFSTWYNIVLTLVAAYLVITSAGPLLNWVILEATFTGESA 62

Query: 76  TVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLI 135
           + C+              ACW FI  R   FI+G YP A +WR  ++F   ++   P  I
Sbjct: 63  SDCSG-----------EGACWLFIGQRLNFFIYGFYPDALQWRVDIMFGLLAVAFVPQFI 111

Query: 136 PSFPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISMPL 194
             FPR+    I      P+  + ++ GG  GL  V++S WGGL++TL++++ GI+ ++P+
Sbjct: 112 ERFPRRKWFGIFGLTGLPLIGYILIPGGWFGLEEVQSSRWGGLMLTLILAYVGILAALPI 171

Query: 195 GILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALL 254
           G +LALGR S++P++R  C+ FIE++R VPL+TVLFMAS+MLPLFLPD  + +KL+RAL+
Sbjct: 172 GTILALGRRSDMPIIRGMCVVFIEVWRAVPLITVLFMASVMLPLFLPDGVNFEKLMRALI 231

Query: 255 GVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTF 314
           G++ + SAY+AEV+RGGLQ+I KGQ+EAA++LGL Y +K  L+++PQ +  VIPGIVNTF
Sbjct: 232 GITLWQSAYMAEVVRGGLQAIPKGQYEAASALGLGYWRKTGLVVLPQALTLVIPGIVNTF 291

Query: 315 IGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSV 374
           I LFKD++L+ II +FD+LG V+   ++  W  +VT T G +F+ F FWIFCF +S YS 
Sbjct: 292 ISLFKDTTLVLIIGLFDILGAVQSTITDPAW-RNVT-TEGYVFVAFCFWIFCFGMSRYSQ 349

Query: 375 FIEKTLHKGSKK 386
            +E+ L  G K 
Sbjct: 350 NLERKLDTGHKS 361


>gi|209920743|ref|YP_002294827.1| amino acid ABC transporter permease [Escherichia coli SE11]
 gi|209914002|dbj|BAG79076.1| amino acid ABC transporter permease component [Escherichia coli
           SE11]
          Length = 368

 Score =  317 bits (812), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 168/371 (45%), Positives = 236/371 (63%), Gaps = 15/371 (4%)

Query: 15  LLQPSLPPVYQRG-IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGS 73
           L QPS P  +     + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS
Sbjct: 7   LSQPSRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGS 66

Query: 74  NRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPM 133
            R  CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM
Sbjct: 67  TRADCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPM 115

Query: 134 LIPSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISM 192
                P +     +   ++P+  ++++YGG  GL  VET  WGGL +TL+I+  GI  ++
Sbjct: 116 FWKILPHRGRYIAVWAVIYPLIVWWLMYGGFFGLERVETRQWGGLTLTLIIASVGIAGAL 175

Query: 193 PLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRA 252
           P GILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +  ++DKL+RA
Sbjct: 176 PWGILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTNIDKLIRA 235

Query: 253 LLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVN 312
           L+GV  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VN
Sbjct: 236 LVGVILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVN 295

Query: 313 TFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLY 372
           T I LFKD+SL+ II +FDL   V+    + TW+     T G +F   ++WIFCFS+S Y
Sbjct: 296 TIIALFKDTSLVIIIGLFDLFSSVQQATVDPTWLG--MSTEGYVFAALIYWIFCFSMSRY 353

Query: 373 SVFIEKTLHKG 383
           S  +EK  + G
Sbjct: 354 SQHLEKRFNTG 364


>gi|157158180|ref|YP_001464745.1| His/Glu/Gln/Arg/opine ABC transporter permease [Escherichia coli
           E24377A]
 gi|193066457|ref|ZP_03047502.1| amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine
           family [Escherichia coli E22]
 gi|194430236|ref|ZP_03062733.1| amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine
           family [Escherichia coli B171]
 gi|218555835|ref|YP_002388748.1| amino-acid ABC transporter membrane protein [Escherichia coli IAI1]
 gi|218696970|ref|YP_002404637.1| amino-acid transporter subunit ; membrane component of ABC
           superfamily [Escherichia coli 55989]
 gi|260846075|ref|YP_003223853.1| putative transport system permease protein [Escherichia coli
           O103:H2 str. 12009]
 gi|307314972|ref|ZP_07594560.1| polar amino acid ABC transporter, inner membrane subunit
           [Escherichia coli W]
 gi|331670096|ref|ZP_08370941.1| inner membrane amino-acid ABC transporter permease protein YhdY
           [Escherichia coli TA271]
 gi|331679344|ref|ZP_08380016.1| putative transport system permease protein [Escherichia coli H591]
 gi|157080210|gb|ABV19918.1| amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine
           family [Escherichia coli E24377A]
 gi|192925886|gb|EDV80535.1| amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine
           family [Escherichia coli E22]
 gi|194411707|gb|EDX28032.1| amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine
           family [Escherichia coli B171]
 gi|218353702|emb|CAU99966.1| amino-acid transporter subunit ; membrane component of ABC
           superfamily [Escherichia coli 55989]
 gi|218362603|emb|CAR00228.1| amino-acid transporter subunit ; membrane component of ABC
           superfamily [Escherichia coli IAI1]
 gi|257761222|dbj|BAI32719.1| putative transport system permease protein [Escherichia coli
           O103:H2 str. 12009]
 gi|306905555|gb|EFN36087.1| polar amino acid ABC transporter, inner membrane subunit
           [Escherichia coli W]
 gi|315062569|gb|ADT76896.1| predicted amino-acid transporter subunit [Escherichia coli W]
 gi|323376844|gb|ADX49112.1| polar amino acid ABC transporter, inner membrane subunit
           [Escherichia coli KO11]
 gi|331063009|gb|EGI34923.1| inner membrane amino-acid ABC transporter permease protein YhdY
           [Escherichia coli TA271]
 gi|331073409|gb|EGI44732.1| putative transport system permease protein [Escherichia coli H591]
          Length = 367

 Score =  317 bits (812), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 168/371 (45%), Positives = 236/371 (63%), Gaps = 15/371 (4%)

Query: 15  LLQPSLPPVYQRG-IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGS 73
           L QPS P  +     + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS
Sbjct: 6   LSQPSRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGS 65

Query: 74  NRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPM 133
            R  CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM
Sbjct: 66  TRADCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPM 114

Query: 134 LIPSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISM 192
                P +     +   ++P+  ++++YGG  GL  VET  WGGL +TL+I+  GI  ++
Sbjct: 115 FWKILPHRGRYIAVWAVIYPLIVWWLMYGGFFGLERVETRQWGGLTLTLIIASVGIAGAL 174

Query: 193 PLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRA 252
           P GILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +  ++DKL+RA
Sbjct: 175 PWGILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTNIDKLIRA 234

Query: 253 LLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVN 312
           L+GV  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VN
Sbjct: 235 LVGVILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVN 294

Query: 313 TFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLY 372
           T I LFKD+SL+ II +FDL   V+    + TW+     T G +F   ++WIFCFS+S Y
Sbjct: 295 TIIALFKDTSLVIIIGLFDLFSSVQQATVDPTWLG--MSTEGYVFAALIYWIFCFSMSRY 352

Query: 373 SVFIEKTLHKG 383
           S  +EK  + G
Sbjct: 353 SQHLEKRFNTG 363


>gi|332102248|gb|EGJ05594.1| his/Glu/Gln/Arg/opine ABC transporter permease [Shigella sp. D9]
          Length = 368

 Score =  317 bits (811), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 168/371 (45%), Positives = 235/371 (63%), Gaps = 15/371 (4%)

Query: 15  LLQPSLPPVYQRG-IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGS 73
           L QPS P  +     + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS
Sbjct: 7   LSQPSRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGS 66

Query: 74  NRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPM 133
            R  CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM
Sbjct: 67  TRADCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPM 115

Query: 134 LIPSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISM 192
                P +     +   ++P+  ++++YGG  GL  VET  WGGL +TL+I+  GI  ++
Sbjct: 116 FWKILPHRGRYIAVWAVIYPLIVWWLMYGGFFGLERVETRQWGGLTLTLIIASVGIAGAL 175

Query: 193 PLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRA 252
           P GILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RA
Sbjct: 176 PWGILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRA 235

Query: 253 LLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVN 312
           L+GV  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VN
Sbjct: 236 LVGVILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVN 295

Query: 313 TFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLY 372
           T I LFKD+SL+ II +FDL   V+    + TW+     T G +F   ++WIFCFS+S Y
Sbjct: 296 TIIALFKDTSLVIIIGLFDLFSSVQQATVDPTWLG--MSTEGYVFAALIYWIFCFSMSRY 353

Query: 373 SVFIEKTLHKG 383
           S  +EK  + G
Sbjct: 354 SQHLEKRFNTG 364


>gi|191169154|ref|ZP_03030912.1| amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine
           family [Escherichia coli B7A]
 gi|256018816|ref|ZP_05432681.1| amino acid ABC transporter permease component [Shigella sp. D9]
 gi|260857398|ref|YP_003231289.1| putative transport system permease protein [Escherichia coli
           O26:H11 str. 11368]
 gi|190900796|gb|EDV60587.1| amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine
           family [Escherichia coli B7A]
 gi|257756047|dbj|BAI27549.1| putative transport system permease protein [Escherichia coli
           O26:H11 str. 11368]
 gi|323154325|gb|EFZ40527.1| general L-amino acid transport system permease protein aapM
           [Escherichia coli EPECa14]
          Length = 367

 Score =  316 bits (810), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 168/371 (45%), Positives = 235/371 (63%), Gaps = 15/371 (4%)

Query: 15  LLQPSLPPVYQRG-IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGS 73
           L QPS P  +     + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS
Sbjct: 6   LSQPSRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGS 65

Query: 74  NRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPM 133
            R  CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM
Sbjct: 66  TRADCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPM 114

Query: 134 LIPSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISM 192
                P +     +   ++P+  ++++YGG  GL  VET  WGGL +TL+I+  GI  ++
Sbjct: 115 FWKILPHRGRYIAVWAVIYPLIVWWLMYGGFFGLERVETRQWGGLTLTLIIASVGIAGAL 174

Query: 193 PLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRA 252
           P GILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RA
Sbjct: 175 PWGILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRA 234

Query: 253 LLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVN 312
           L+GV  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VN
Sbjct: 235 LVGVILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVN 294

Query: 313 TFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLY 372
           T I LFKD+SL+ II +FDL   V+    + TW+     T G +F   ++WIFCFS+S Y
Sbjct: 295 TIIALFKDTSLVIIIGLFDLFSSVQQATVDPTWLG--MSTEGYVFAALIYWIFCFSMSRY 352

Query: 373 SVFIEKTLHKG 383
           S  +EK  + G
Sbjct: 353 SQHLEKRFNTG 363


>gi|320177113|gb|EFW52129.1| Glutamate Aspartate transport system permease protein GltK
           [Shigella dysenteriae CDC 74-1112]
          Length = 367

 Score =  316 bits (810), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 168/371 (45%), Positives = 235/371 (63%), Gaps = 15/371 (4%)

Query: 15  LLQPSLPPVYQRG-IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGS 73
           L QPS P  +     + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS
Sbjct: 6   LSQPSRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGS 65

Query: 74  NRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPM 133
            R  CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM
Sbjct: 66  TRADCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPM 114

Query: 134 LIPSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISM 192
                P +     +   ++P+  ++++YGG  GL  VET  WGGL +TL+I+  GI  ++
Sbjct: 115 FWKILPHRGRYIAVWAVIYPLIVWWLMYGGFFGLERVETRQWGGLTLTLIIASVGIAGAL 174

Query: 193 PLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRA 252
           P GILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RA
Sbjct: 175 PWGILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRA 234

Query: 253 LLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVN 312
           L+GV  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQV+K VIPG+VN
Sbjct: 235 LVGVILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQVLKLVIPGLVN 294

Query: 313 TFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLY 372
           T I LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S Y
Sbjct: 295 TIIALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRY 352

Query: 373 SVFIEKTLHKG 383
           S  +EK  + G
Sbjct: 353 SQHLEKRFNAG 363


>gi|82545640|ref|YP_409587.1| transport system permease protein [Shigella boydii Sb227]
 gi|81247051|gb|ABB67759.1| putative transport system permease protein [Shigella boydii Sb227]
          Length = 368

 Score =  316 bits (809), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 168/371 (45%), Positives = 235/371 (63%), Gaps = 15/371 (4%)

Query: 15  LLQPSLPPVYQRG-IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGS 73
           L QPS P  +     + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS
Sbjct: 7   LSQPSRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGS 66

Query: 74  NRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPM 133
            R  CT              ACW FI++R+ QF++G YP  QRWR  LV L G + + PM
Sbjct: 67  TRADCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLVLLIGLVSIAPM 115

Query: 134 LIPSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISM 192
                P +     +   ++P+  ++++YGG  GL  VET  WGGL +TL+I+  GI  ++
Sbjct: 116 FWKILPHRGRYIAVWAVIYPLIVWWLMYGGFFGLERVETRQWGGLTLTLIIASVGIAGAL 175

Query: 193 PLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRA 252
           P GILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RA
Sbjct: 176 PWGILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRA 235

Query: 253 LLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVN 312
           L+GV  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VN
Sbjct: 236 LVGVILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVN 295

Query: 313 TFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLY 372
           T I LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S Y
Sbjct: 296 TIIALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRY 353

Query: 373 SVFIEKTLHKG 383
           S  +EK  + G
Sbjct: 354 SQHLEKRFNTG 364


>gi|322834720|ref|YP_004214747.1| polar amino acid ABC transporter inner membrane subunit [Rahnella
           sp. Y9602]
 gi|321169921|gb|ADW75620.1| polar amino acid ABC transporter, inner membrane subunit [Rahnella
           sp. Y9602]
          Length = 357

 Score =  316 bits (809), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 167/356 (46%), Positives = 229/356 (64%), Gaps = 14/356 (3%)

Query: 29  IAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQP 88
           + W  KN F +  + LLT   + L+   IP +++WV   A W+G+ RT CT         
Sbjct: 11  VLWARKNLFSSWFNSLLTLFCLWLMWLLIPPLLNWVIFQANWVGTARTDCTKA------- 63

Query: 89  DGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILL 148
                ACW FI+ R+ QF++G YP  QRWR  +  + G + L P+   + PR+       
Sbjct: 64  ----GACWVFIHARFGQFMYGLYPFDQRWRINVTLIVGLLTLAPIFFKAMPRRGRYIACW 119

Query: 149 FGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIP 207
             LFPIF++ +LYGG LGLS VET  WGGL +TL+I+  GI  ++PLGI+LAL R S++P
Sbjct: 120 MVLFPIFTWIMLYGGFLGLSRVETRQWGGLTLTLIIAAVGIAGALPLGIMLALARRSSLP 179

Query: 208 VLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEV 267
           V+R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV  F SAY+AEV
Sbjct: 180 VVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMTEGTSIDKLVRALVGVVLFQSAYVAEV 239

Query: 268 LRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISII 327
           +RGGLQ++ KGQ EAA SL L Y +   L+I+PQ +K VIPG+VNT I LFKD+SL+ II
Sbjct: 240 VRGGLQALPKGQTEAAESLALGYWKTQGLVILPQALKMVIPGLVNTIIALFKDTSLVIII 299

Query: 328 NMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKG 383
            +FDL   V+    +  W+     T G +F   V+WIFCFS+S YS  +E+  H G
Sbjct: 300 GLFDLFSSVQQATVDPEWLG--MSTEGYVFAAAVYWIFCFSMSRYSQHLERRFHTG 353


>gi|170743938|ref|YP_001772593.1| polar amino acid ABC transporter inner membrane subunit
           [Methylobacterium sp. 4-46]
 gi|168198212|gb|ACA20159.1| polar amino acid ABC transporter, inner membrane subunit
           [Methylobacterium sp. 4-46]
          Length = 385

 Score =  316 bits (809), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 170/379 (44%), Positives = 252/379 (66%), Gaps = 7/379 (1%)

Query: 10  YVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAV 69
           Y+R+  + P+  P    G +AW   N F +P +  LT L + +++  +P ++ ++ LDAV
Sbjct: 12  YIRREPIPPAPAPALVSGPLAWARANLFSSPVNTALTLLALVIVVLVVPPLLRFLVLDAV 71

Query: 70  WIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSIL 129
           + G NR  C     G  +P G   ACWAF+  +   F++G+YP+  RWR  + F   ++ 
Sbjct: 72  FTGENRDACRPEVLG--RPVG---ACWAFVAQKINYFVYGSYPIEARWRVNVFFAMAALG 126

Query: 130 LTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGG--LGLSIVETSLWGGLLVTLVISFFG 187
           +  +L    PR+ L +   F +FP+ ++ +L G   +G+  V TSLWGG+LVT+V+S  G
Sbjct: 127 VGWLLWLDAPRRDLGAAYFFVVFPLAAYALLSGFPLVGIETVPTSLWGGMLVTIVVSLVG 186

Query: 188 IIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVD 247
           I+ S+PLGILLALGR S +P++R AC+ FIE +RGVPL+TVLFMA++MLPLFLP    VD
Sbjct: 187 IVASLPLGILLALGRRSRLPIVRLACVIFIEFWRGVPLITVLFMANVMLPLFLPGDITVD 246

Query: 248 KLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVI 307
           +LLR L+GV+ F++AY+AEV+RGGLQ+I KGQ E ANSLGLSY Q MRL+I+PQ ++ VI
Sbjct: 247 RLLRPLIGVALFSAAYMAEVVRGGLQAIPKGQTEGANSLGLSYWQGMRLVILPQALRIVI 306

Query: 308 PGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCF 367
           PGIVN+FI LFKD++L+SI+ +FD +  +     +  W +    TTG  F    +++FCF
Sbjct: 307 PGIVNSFIALFKDTTLVSIVGIFDFIRTIESARIDPNWAAPTVVTTGYAFAALFYFVFCF 366

Query: 368 SISLYSVFIEKTLHKGSKK 386
            +S Y++F+E+ L  G  +
Sbjct: 367 GMSRYALFVERRLAAGQTR 385


>gi|332098839|gb|EGJ03796.1| general L-amino acid transport system permease protein aapM
           [Shigella boydii 3594-74]
          Length = 367

 Score =  316 bits (809), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 168/371 (45%), Positives = 235/371 (63%), Gaps = 15/371 (4%)

Query: 15  LLQPSLPPVYQRG-IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGS 73
           L QPS P  +     + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS
Sbjct: 6   LSQPSRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGS 65

Query: 74  NRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPM 133
            R  CT              ACW FI++R+ QF++G YP  QRWR  LV L G + + PM
Sbjct: 66  TRADCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLVLLIGLVSIAPM 114

Query: 134 LIPSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISM 192
                P +     +   ++P+  ++++YGG  GL  VET  WGGL +TL+I+  GI  ++
Sbjct: 115 FWKILPHRGRYIAVWAVIYPLIVWWLMYGGFFGLERVETRQWGGLTLTLIIASVGIAGAL 174

Query: 193 PLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRA 252
           P GILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RA
Sbjct: 175 PWGILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRA 234

Query: 253 LLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVN 312
           L+GV  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VN
Sbjct: 235 LVGVILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVN 294

Query: 313 TFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLY 372
           T I LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S Y
Sbjct: 295 TIIALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRY 352

Query: 373 SVFIEKTLHKG 383
           S  +EK  + G
Sbjct: 353 SQHLEKRFNTG 363


>gi|193071516|ref|ZP_03052426.1| amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine
           family [Escherichia coli E110019]
 gi|192955153|gb|EDV85646.1| amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine
           family [Escherichia coli E110019]
          Length = 367

 Score =  316 bits (809), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 168/371 (45%), Positives = 235/371 (63%), Gaps = 15/371 (4%)

Query: 15  LLQPSLPPVYQRG-IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGS 73
           L QPS P  +     + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS
Sbjct: 6   LSQPSRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGS 65

Query: 74  NRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPM 133
            R  CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM
Sbjct: 66  TRADCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPM 114

Query: 134 LIPSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISM 192
                P +     +   ++P+  ++++YGG  GL  VET  WGGL +TL+I+  GI  ++
Sbjct: 115 FWKILPHRGRYIAVWAVIYPLIVWWLMYGGFFGLERVETRQWGGLTLTLIIASVGIAGAL 174

Query: 193 PLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRA 252
           P GILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RA
Sbjct: 175 PWGILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRA 234

Query: 253 LLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVN 312
           L+GV  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VN
Sbjct: 235 LVGVILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVN 294

Query: 313 TFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLY 372
           T I LFKD+SL+ II +FDL   V+    + TW+     T G +F   ++WIFCFS+S Y
Sbjct: 295 TIIALFKDTSLVIIIGLFDLFSSVQQATVDPTWLG--MSTEGYVFAALLYWIFCFSMSRY 352

Query: 373 SVFIEKTLHKG 383
           S  +EK  + G
Sbjct: 353 SQHLEKRFNTG 363


>gi|293449593|ref|ZP_06664014.1| general L-amino acid transport system permease [Escherichia coli
           B088]
 gi|291322683|gb|EFE62112.1| general L-amino acid transport system permease [Escherichia coli
           B088]
 gi|320202180|gb|EFW76755.1| Glutamate Aspartate transport system permease protein GltK
           [Escherichia coli EC4100B]
 gi|323946883|gb|EGB42899.1| inner membrane transport system [Escherichia coli H120]
          Length = 367

 Score =  315 bits (808), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 168/371 (45%), Positives = 234/371 (63%), Gaps = 15/371 (4%)

Query: 15  LLQPSLPPVYQRG-IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGS 73
           L QPS P  +     + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS
Sbjct: 6   LSQPSRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGS 65

Query: 74  NRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPM 133
            R  CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM
Sbjct: 66  TRADCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPM 114

Query: 134 LIPSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISM 192
                P +         ++P+  ++++YGG  GL  VET  WGGL +TL+I+  GI  ++
Sbjct: 115 FWKILPHRGRYIAAWAVIYPLIVWWLMYGGFFGLERVETRQWGGLTLTLIIASVGIAGAL 174

Query: 193 PLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRA 252
           P GILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RA
Sbjct: 175 PWGILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRA 234

Query: 253 LLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVN 312
           L+GV  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VN
Sbjct: 235 LVGVILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVN 294

Query: 313 TFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLY 372
           T I LFKD+SL+ II +FDL   V+    + TW+     T G +F   ++WIFCFS+S Y
Sbjct: 295 TIIALFKDTSLVIIIGLFDLFSSVQQATVDPTWLG--MSTEGYVFAALIYWIFCFSMSRY 352

Query: 373 SVFIEKTLHKG 383
           S  +EK  + G
Sbjct: 353 SQHLEKRFNTG 363


>gi|194435100|ref|ZP_03067337.1| amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine
           family [Shigella dysenteriae 1012]
 gi|194416662|gb|EDX32794.1| amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine
           family [Shigella dysenteriae 1012]
 gi|320181544|gb|EFW56462.1| Glutamate Aspartate transport system permease protein GltK
           [Shigella boydii ATCC 9905]
 gi|332087263|gb|EGI92396.1| general L-amino acid transport system permease protein aapM
           [Shigella boydii 5216-82]
          Length = 367

 Score =  315 bits (808), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 167/371 (45%), Positives = 235/371 (63%), Gaps = 15/371 (4%)

Query: 15  LLQPSLPPVYQRG-IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGS 73
           L QPS P  +     + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS
Sbjct: 6   LSQPSRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGS 65

Query: 74  NRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPM 133
            R  CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM
Sbjct: 66  TRADCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPM 114

Query: 134 LIPSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISM 192
                P +     +   ++P+  ++++YGG  GL  VET  WGGL +TL+I+  GI  ++
Sbjct: 115 FWKILPHRGRYIAVWAVIYPLIVWWLMYGGFFGLERVETRQWGGLTLTLIIASVGIAGAL 174

Query: 193 PLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRA 252
           P GILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +  ++DKL+RA
Sbjct: 175 PWGILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTNIDKLIRA 234

Query: 253 LLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVN 312
           L+GV  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VN
Sbjct: 235 LVGVILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVN 294

Query: 313 TFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLY 372
           T I LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S Y
Sbjct: 295 TIIALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRY 352

Query: 373 SVFIEKTLHKG 383
           S  +EK  + G
Sbjct: 353 SQHLEKRFNTG 363


>gi|74313797|ref|YP_312216.1| putative transport system permease [Shigella sonnei Ss046]
 gi|73857274|gb|AAZ89981.1| putative transport system permease protein [Shigella sonnei Ss046]
 gi|332086438|gb|EGI91585.1| general L-amino acid transport system permease protein aapM
           [Shigella dysenteriae 155-74]
          Length = 368

 Score =  315 bits (808), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 167/371 (45%), Positives = 235/371 (63%), Gaps = 15/371 (4%)

Query: 15  LLQPSLPPVYQRG-IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGS 73
           L QPS P  +     + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS
Sbjct: 7   LSQPSRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGS 66

Query: 74  NRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPM 133
            R  CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM
Sbjct: 67  TRADCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPM 115

Query: 134 LIPSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISM 192
                P +     +   ++P+  ++++YGG  GL  VET  WGGL +TL+I+  GI  ++
Sbjct: 116 FWKILPHRGRYIAVWAVIYPLIVWWLMYGGFFGLERVETRQWGGLTLTLIIASVGIAGAL 175

Query: 193 PLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRA 252
           P GILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +  ++DKL+RA
Sbjct: 176 PWGILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTNIDKLIRA 235

Query: 253 LLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVN 312
           L+GV  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VN
Sbjct: 236 LVGVILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVN 295

Query: 313 TFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLY 372
           T I LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S Y
Sbjct: 296 TIIALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRY 353

Query: 373 SVFIEKTLHKG 383
           S  +EK  + G
Sbjct: 354 SQHLEKRFNTG 364


>gi|320184056|gb|EFW58876.1| Glutamate Aspartate transport system permease protein GltK
           [Shigella flexneri CDC 796-83]
          Length = 367

 Score =  315 bits (807), Expect = 8e-84,   Method: Compositional matrix adjust.
 Identities = 168/371 (45%), Positives = 235/371 (63%), Gaps = 15/371 (4%)

Query: 15  LLQPSLPPVYQRG-IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGS 73
           L QPS P  +     + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS
Sbjct: 6   LSQPSRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGS 65

Query: 74  NRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPM 133
            R  CT              ACW FI++R+ QF++G YP  QRWR  LV L G + + PM
Sbjct: 66  TRADCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLVLLIGLVSIAPM 114

Query: 134 LIPSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISM 192
                P +     +   ++P+  ++++YGG  GL  VET  WGGL +TL+I+  GI  ++
Sbjct: 115 FWKILPHRGRYIAVWAVIYPLIVWWLMYGGFFGLERVETRQWGGLTLTLIIASVGIAGAL 174

Query: 193 PLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRA 252
           P GILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RA
Sbjct: 175 PWGILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRA 234

Query: 253 LLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVN 312
           L+GV  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VN
Sbjct: 235 LVGVILFQSAYVAEVVRGGLQALPKGQYEAAESLTLGYWKTQGLVILPQALKLVIPGLVN 294

Query: 313 TFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLY 372
           T I LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S Y
Sbjct: 295 TIIALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRY 352

Query: 373 SVFIEKTLHKG 383
           S  +EK  + G
Sbjct: 353 SQHLEKRFNTG 363


>gi|110807126|ref|YP_690646.1| putative transport system permease [Shigella flexneri 5 str. 8401]
 gi|110616674|gb|ABF05341.1| putative transport system permease protein [Shigella flexneri 5
           str. 8401]
          Length = 367

 Score =  314 bits (805), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 168/371 (45%), Positives = 233/371 (62%), Gaps = 15/371 (4%)

Query: 15  LLQPSLPPVYQRG-IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGS 73
           L QPS P  +     + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS
Sbjct: 6   LSQPSRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGS 65

Query: 74  NRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPM 133
            R  CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM
Sbjct: 66  TRADCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPM 114

Query: 134 LIPSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISM 192
                P +         ++P+  + ++YGG  GL  VET  WGGL +TL+I+  GI  ++
Sbjct: 115 FWKILPHRGRYIAAWAVIYPLIVWRLMYGGFFGLERVETRQWGGLTLTLIIASVGIAGAL 174

Query: 193 PLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRA 252
           P GILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RA
Sbjct: 175 PWGILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRA 234

Query: 253 LLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVN 312
           L+GV  F SAY+AEV+RGGLQ++ KGQ+EAA SL LSY +   L+I+PQ +K VIPG+VN
Sbjct: 235 LVGVILFQSAYVAEVVRGGLQALPKGQYEAAESLALSYRKTQGLVILPQALKLVIPGLVN 294

Query: 313 TFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLY 372
           T I LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S Y
Sbjct: 295 TIIALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRY 352

Query: 373 SVFIEKTLHKG 383
           S  +EK  + G
Sbjct: 353 SQHLEKRFNTG 363


>gi|91212701|ref|YP_542687.1| putative transport system permease [Escherichia coli UTI89]
 gi|237705971|ref|ZP_04536452.1| amino acid ABC transporter permease [Escherichia sp. 3_2_53FAA]
 gi|91074275|gb|ABE09156.1| putative transport system permease protein [Escherichia coli UTI89]
 gi|226899011|gb|EEH85270.1| amino acid ABC transporter permease [Escherichia sp. 3_2_53FAA]
          Length = 368

 Score =  314 bits (805), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 166/367 (45%), Positives = 233/367 (63%), Gaps = 14/367 (3%)

Query: 18  PSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTV 77
           P L        + W+ KN F +  + LLT   I L+   IP +++WVFL A W+GS R  
Sbjct: 11  PRLASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWVFLQANWVGSTRAD 70

Query: 78  CTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPS 137
           CT            + ACW FI++R+ QF++G YP  QRWR  L  L G + + PM    
Sbjct: 71  CTK-----------SGACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPMFWKI 119

Query: 138 FPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISMPLGI 196
            P +     +   ++P+  ++++YGG LGL  VET  WGGL +TL+I+  GI  ++P GI
Sbjct: 120 LPHRSRYIAVWAVIYPLVVWWLMYGGFLGLDRVETRQWGGLTLTLIIASVGIAGALPWGI 179

Query: 197 LLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGV 256
           LLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV
Sbjct: 180 LLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVGV 239

Query: 257 SAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIG 316
             F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I 
Sbjct: 240 ILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTIIA 299

Query: 317 LFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFI 376
           LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  +
Sbjct: 300 LFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQHL 357

Query: 377 EKTLHKG 383
           EK  + G
Sbjct: 358 EKRFNTG 364


>gi|294492998|gb|ADE91754.1| amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine
           family [Escherichia coli IHE3034]
 gi|307625129|gb|ADN69433.1| putative transport system permease protein [Escherichia coli UM146]
 gi|323957582|gb|EGB53296.1| inner membrane transport system [Escherichia coli H263]
          Length = 367

 Score =  314 bits (805), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 166/367 (45%), Positives = 233/367 (63%), Gaps = 14/367 (3%)

Query: 18  PSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTV 77
           P L        + W+ KN F +  + LLT   I L+   IP +++WVFL A W+GS R  
Sbjct: 10  PRLASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWVFLQANWVGSTRAD 69

Query: 78  CTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPS 137
           CT            + ACW FI++R+ QF++G YP  QRWR  L  L G + + PM    
Sbjct: 70  CTK-----------SGACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPMFWKI 118

Query: 138 FPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISMPLGI 196
            P +     +   ++P+  ++++YGG LGL  VET  WGGL +TL+I+  GI  ++P GI
Sbjct: 119 LPHRSRYIAVWAVIYPLVVWWLMYGGFLGLDRVETRQWGGLTLTLIIASVGIAGALPWGI 178

Query: 197 LLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGV 256
           LLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV
Sbjct: 179 LLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVGV 238

Query: 257 SAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIG 316
             F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I 
Sbjct: 239 ILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTIIA 298

Query: 317 LFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFI 376
           LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  +
Sbjct: 299 LFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQHL 356

Query: 377 EKTLHKG 383
           EK  + G
Sbjct: 357 EKRFNTG 363


>gi|293412639|ref|ZP_06655362.1| polar amino acid ABC transporter [Escherichia coli B354]
 gi|331674785|ref|ZP_08375544.1| inner membrane amino-acid ABC transporter permease protein YhdY
           [Escherichia coli TA280]
 gi|291469410|gb|EFF11901.1| polar amino acid ABC transporter [Escherichia coli B354]
 gi|331068224|gb|EGI39620.1| inner membrane amino-acid ABC transporter permease protein YhdY
           [Escherichia coli TA280]
          Length = 367

 Score =  314 bits (805), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 167/371 (45%), Positives = 234/371 (63%), Gaps = 15/371 (4%)

Query: 15  LLQPSLPPVYQRG-IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGS 73
           L  P  P  +     + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS
Sbjct: 6   LSHPPRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGS 65

Query: 74  NRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPM 133
            RT CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM
Sbjct: 66  TRTDCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPM 114

Query: 134 LIPSFPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISM 192
                P +     +   ++P+  ++++YGG LGL  VET  WGGL +TL+I+  GI  ++
Sbjct: 115 FWKILPHRGRYIAVWAVIYPLIVWWLMYGGFLGLERVETRQWGGLTLTLIIASVGIAGAL 174

Query: 193 PLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRA 252
           P GILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RA
Sbjct: 175 PWGILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRA 234

Query: 253 LLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVN 312
           L+GV  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VN
Sbjct: 235 LVGVILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVN 294

Query: 313 TFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLY 372
           T I LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S Y
Sbjct: 295 TIIALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRY 352

Query: 373 SVFIEKTLHKG 383
           S  +EK  + G
Sbjct: 353 SQHLEKRFNTG 363


>gi|218706885|ref|YP_002414404.1| amino-acid ABC transporter membrane protein [Escherichia coli
           UMN026]
 gi|293406872|ref|ZP_06650798.1| polar amino acid ABC transporter [Escherichia coli FVEC1412]
 gi|298382613|ref|ZP_06992210.1| general L-amino acid transport system permease [Escherichia coli
           FVEC1302]
 gi|218433982|emb|CAR14899.1| amino-acid transporter subunit ; membrane component of ABC
           superfamily [Escherichia coli UMN026]
 gi|291426878|gb|EFE99910.1| polar amino acid ABC transporter [Escherichia coli FVEC1412]
 gi|298277753|gb|EFI19269.1| general L-amino acid transport system permease [Escherichia coli
           FVEC1302]
          Length = 367

 Score =  314 bits (804), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 167/371 (45%), Positives = 234/371 (63%), Gaps = 15/371 (4%)

Query: 15  LLQPSLPPVYQRG-IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGS 73
           L  P  P  +     + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS
Sbjct: 6   LSHPPRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGS 65

Query: 74  NRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPM 133
            RT CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM
Sbjct: 66  TRTDCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPM 114

Query: 134 LIPSFPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISM 192
                P +     +   ++P+  ++++YGG LGL  VET  WGGL +TL+I+  GI  ++
Sbjct: 115 FWKILPNRGRYIAVWAVIYPLIVWWLMYGGFLGLERVETRQWGGLTLTLIIASVGIAGAL 174

Query: 193 PLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRA 252
           P GILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RA
Sbjct: 175 PWGILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRA 234

Query: 253 LLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVN 312
           L+GV  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VN
Sbjct: 235 LVGVILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVN 294

Query: 313 TFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLY 372
           T I LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S Y
Sbjct: 295 TIIALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRY 352

Query: 373 SVFIEKTLHKG 383
           S  +EK  + G
Sbjct: 353 SQHLEKRFNTG 363


>gi|281602646|gb|ADA75630.1| putative transport system permease protein [Shigella flexneri
           2002017]
          Length = 368

 Score =  314 bits (804), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 167/371 (45%), Positives = 233/371 (62%), Gaps = 15/371 (4%)

Query: 15  LLQPSLPPVYQRG-IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGS 73
           L QPS P  +     + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS
Sbjct: 7   LSQPSRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGS 66

Query: 74  NRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPM 133
            R  CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM
Sbjct: 67  TRADCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPM 115

Query: 134 LIPSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISM 192
                P +         ++P+  ++++YGG  GL  VET  WGGL +TL+I+  GI  ++
Sbjct: 116 FWKILPHRGRYIAAWAVIYPLIVWWLMYGGFFGLERVETRQWGGLTLTLIIASVGIAGAL 175

Query: 193 PLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRA 252
           P GILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RA
Sbjct: 176 PWGILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRA 235

Query: 253 LLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVN 312
           L+GV  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VN
Sbjct: 236 LVGVILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVN 295

Query: 313 TFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLY 372
           T I LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S Y
Sbjct: 296 TIIALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRY 353

Query: 373 SVFIEKTLHKG 383
           S  +EK  + G
Sbjct: 354 SQHLEKRFNTG 364


>gi|30064599|ref|NP_838770.1| putative transport system permease protein [Shigella flexneri 2a
           str. 2457T]
 gi|56480303|ref|NP_709065.2| putative transport system permease protein [Shigella flexneri 2a
           str. 301]
 gi|30042858|gb|AAP18581.1| putative transport system permease protein [Shigella flexneri 2a
           str. 2457T]
 gi|56383854|gb|AAN44772.2| putative transport system permease protein [Shigella flexneri 2a
           str. 301]
 gi|313648621|gb|EFS13062.1| general L-amino acid transport system permease protein aapM
           [Shigella flexneri 2a str. 2457T]
 gi|324119450|gb|EGC13333.1| inner membrane transport system [Escherichia coli E1167]
          Length = 367

 Score =  314 bits (804), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 167/371 (45%), Positives = 233/371 (62%), Gaps = 15/371 (4%)

Query: 15  LLQPSLPPVYQRG-IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGS 73
           L QPS P  +     + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS
Sbjct: 6   LSQPSRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGS 65

Query: 74  NRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPM 133
            R  CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM
Sbjct: 66  TRADCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPM 114

Query: 134 LIPSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISM 192
                P +         ++P+  ++++YGG  GL  VET  WGGL +TL+I+  GI  ++
Sbjct: 115 FWKILPHRGRYIAAWAVIYPLIVWWLMYGGFFGLERVETRQWGGLTLTLIIASVGIAGAL 174

Query: 193 PLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRA 252
           P GILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RA
Sbjct: 175 PWGILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRA 234

Query: 253 LLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVN 312
           L+GV  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VN
Sbjct: 235 LVGVILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVN 294

Query: 313 TFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLY 372
           T I LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S Y
Sbjct: 295 TIIALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRY 352

Query: 373 SVFIEKTLHKG 383
           S  +EK  + G
Sbjct: 353 SQHLEKRFNTG 363


>gi|304396997|ref|ZP_07378877.1| polar amino acid ABC transporter, inner membrane subunit [Pantoea
           sp. aB]
 gi|304355793|gb|EFM20160.1| polar amino acid ABC transporter, inner membrane subunit [Pantoea
           sp. aB]
          Length = 366

 Score =  313 bits (803), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 166/354 (46%), Positives = 226/354 (63%), Gaps = 14/354 (3%)

Query: 31  WIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDG 90
           W  KN F +  + LLT   I ++   IP  ++W+   A WIG+ R  CT           
Sbjct: 22  WARKNLFSSWFNTLLTLFCIWVIWHVIPPALNWLVFQANWIGTTRADCTK---------- 71

Query: 91  WNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFG 150
              ACW FI+ R+ QF++G YP   RWR  L  + G + + PM + S P +         
Sbjct: 72  -EGACWVFIHARFGQFMYGLYPHELRWRINLALVIGLVSIVPMFLKSLPYRGRYIAAWAV 130

Query: 151 LFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVL 209
           ++P+  +F+LYGG LGL  VET  WGGL +TL+I+  GI  ++PLGILLALGR S +PV+
Sbjct: 131 IYPVIVWFLLYGGYLGLERVETRQWGGLTLTLIIASVGIAGALPLGILLALGRRSRMPVV 190

Query: 210 RYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLR 269
           R   I FIE +RGVPL+TVLFM+S+MLPLF+ +  ++DKL+RAL+GV  F SAY+AEV+R
Sbjct: 191 RTLSIIFIEFWRGVPLITVLFMSSVMLPLFMSEGTNIDKLVRALVGVILFQSAYVAEVVR 250

Query: 270 GGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINM 329
           GGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K  IPG+VNT I LFKD+SL+ II +
Sbjct: 251 GGLQALPKGQYEAAESLALGYWKTQMLVILPQALKLTIPGLVNTIIALFKDTSLVIIIGL 310

Query: 330 FDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKG 383
           FDL   V+    + TW+     T G +F   V+WIFCFS+S YS ++EK  H G
Sbjct: 311 FDLFSSVQQATVDPTWLG--MSTEGYVFAALVYWIFCFSMSRYSQYLEKRFHTG 362


>gi|317049797|ref|YP_004117445.1| polar amino acid ABC transporter inner membrane subunit [Pantoea
           sp. At-9b]
 gi|316951414|gb|ADU70889.1| polar amino acid ABC transporter, inner membrane subunit [Pantoea
           sp. At-9b]
          Length = 366

 Score =  313 bits (803), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 168/358 (46%), Positives = 225/358 (62%), Gaps = 14/358 (3%)

Query: 30  AWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPD 89
            W  KN F +  + LLT L   ++   IP  ++W+   A WIGS R  CT          
Sbjct: 21  GWARKNLFSSWFNTLLTLLCFWIIWSVIPPALNWLVFQANWIGSTRADCTK--------- 71

Query: 90  GWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLF 149
               ACW FI+ R+ QF++G YP   RWR  L  + G + + PM I S P +        
Sbjct: 72  --EGACWVFIHARFGQFMYGLYPHELRWRINLALVIGLLSIIPMFIKSMPHRGRYIACWA 129

Query: 150 GLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPV 208
             +PI  +F++YGG LGL  VET  WGGL +TL+I+  GI  ++PLGILLALGR S +PV
Sbjct: 130 VAYPIIVWFLMYGGYLGLDRVETRQWGGLTLTLIIASVGIAGALPLGILLALGRRSKMPV 189

Query: 209 LRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVL 268
           +R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV  F SAY+AEV+
Sbjct: 190 VRTLSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTTIDKLVRALVGVILFQSAYVAEVV 249

Query: 269 RGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIIN 328
           RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K  IPG+VNT I LFKD+SL+ II 
Sbjct: 250 RGGLQALPKGQYEAAESLALGYWKTQILVILPQALKLTIPGLVNTIIALFKDTSLVIIIG 309

Query: 329 MFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
           +FDL   V+    + TW+     T G +F   V+WIFCFS+S YS ++EK  H G K 
Sbjct: 310 LFDLFSSVQQATVDPTWLG--MSTEGYVFAALVYWIFCFSMSRYSQYLEKRFHTGRKS 365


>gi|310766168|gb|ADP11118.1| transport system permease protein [Erwinia sp. Ejp617]
          Length = 366

 Score =  313 bits (803), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 161/356 (45%), Positives = 225/356 (63%), Gaps = 14/356 (3%)

Query: 29  IAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQP 88
           +AW  KN F    + LLT L + ++  +IP  ++W+   A W G  R  CT         
Sbjct: 20  VAWARKNLFSGVGNSLLTLLCLWIMWEAIPPALNWLIFQANWTGDTRADCTK-------- 71

Query: 89  DGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILL 148
                ACW FI+ R+ Q ++G YP   RWR  L  + G + + PM + + PR+    +  
Sbjct: 72  ---EGACWVFIHARFGQLMYGLYPHELRWRINLALVIGLLSIVPMFLKNLPRRSSYIVGW 128

Query: 149 FGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIP 207
             ++P+  + ++YGG LGL  VET  WGGL +TL+I+  GI  ++P GILLALGR S +P
Sbjct: 129 AVVYPLLVWLLMYGGWLGLEQVETRQWGGLTLTLIIAAVGIAGALPAGILLALGRRSQMP 188

Query: 208 VLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEV 267
           V+R  C+ FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV  F SAY+AEV
Sbjct: 189 VVRTLCVLFIEFWRGVPLITVLFMSSVMLPLFMAEGSSIDKLIRALVGVILFQSAYVAEV 248

Query: 268 LRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISII 327
           +RGGLQ++ KGQ+E A SL L Y +  RL+I+PQ +K VIPG+VNT I LFKD+SL+ II
Sbjct: 249 VRGGLQALPKGQYEGAESLALGYWKTQRLVILPQALKLVIPGLVNTIIALFKDTSLVIII 308

Query: 328 NMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKG 383
            +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  +EK  H G
Sbjct: 309 GLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQHLEKRFHTG 362


>gi|315289022|gb|EFU48420.1| ABC transporter, permease protein [Escherichia coli MS 110-3]
          Length = 347

 Score =  313 bits (803), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 164/356 (46%), Positives = 231/356 (64%), Gaps = 14/356 (3%)

Query: 29  IAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQP 88
           + W+ KN F +  + LLT   I L+   IP +++WVFL A W+GS R  CT         
Sbjct: 1   MVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWVFLQANWVGSTRADCTK-------- 52

Query: 89  DGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILL 148
              + ACW FI++R+ QF++G YP  QRWR  L  L G + + PM     P +     + 
Sbjct: 53  ---SGACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPMFWKILPHRSRYIAVW 109

Query: 149 FGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIP 207
             ++P+  ++++YGG LGL  VET  WGGL +TL+I+  GI  ++P GILLALGR S++P
Sbjct: 110 AVIYPLVVWWLMYGGFLGLDRVETRQWGGLTLTLIIASVGIAGALPWGILLALGRRSHMP 169

Query: 208 VLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEV 267
           ++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV  F SAY+AEV
Sbjct: 170 IVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVGVILFQSAYVAEV 229

Query: 268 LRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISII 327
           +RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I LFKD+SL+ II
Sbjct: 230 VRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTIIALFKDTSLVIII 289

Query: 328 NMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKG 383
            +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  +EK  + G
Sbjct: 290 GLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQHLEKRFNTG 343


>gi|301022229|ref|ZP_07186144.1| ABC transporter, permease protein [Escherichia coli MS 69-1]
 gi|300397642|gb|EFJ81180.1| ABC transporter, permease protein [Escherichia coli MS 69-1]
          Length = 347

 Score =  313 bits (803), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 164/356 (46%), Positives = 230/356 (64%), Gaps = 14/356 (3%)

Query: 29  IAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQP 88
           + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS RT CT         
Sbjct: 1   MVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRTDCTKA------- 53

Query: 89  DGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILL 148
                ACW FI++R+ QF++G YP  QRWR  L  L G + + PM     P +     + 
Sbjct: 54  ----GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPMFWKILPHRGRYIAVW 109

Query: 149 FGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIP 207
             ++P+  ++++YGG LGL  VET  WGGL +TL+I+  GI  ++P GILLALGR S++P
Sbjct: 110 AVIYPLIVWWLMYGGFLGLERVETRQWGGLTLTLIIASVGIAGALPWGILLALGRRSHMP 169

Query: 208 VLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEV 267
           ++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV  F SAY+AEV
Sbjct: 170 IVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVGVILFQSAYVAEV 229

Query: 268 LRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISII 327
           +RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I LFKD+SL+ II
Sbjct: 230 VRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTIIALFKDTSLVIII 289

Query: 328 NMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKG 383
            +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  +EK  + G
Sbjct: 290 GLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQHLEKRFNTG 343


>gi|283788087|ref|YP_003367952.1| ABC transporter, permease protein [Citrobacter rodentium ICC168]
 gi|282951541|emb|CBG91240.1| ABC transporter, permease protein [Citrobacter rodentium ICC168]
          Length = 368

 Score =  313 bits (802), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 171/368 (46%), Positives = 234/368 (63%), Gaps = 15/368 (4%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
           +PS   V  R ++ W  KN F +  + LLT L   L+   IP +++W FL A W+GS R 
Sbjct: 11  RPSGNGVAGRTLL-WARKNLFSSWFNSLLTILCGWLMWELIPPLLNWAFLQANWVGSTRA 69

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            CT              ACW FI  R+ QF++G YP  QRWR  L  + G + + PM   
Sbjct: 70  DCTKA-----------GACWVFIQQRFGQFMYGLYPHDQRWRINLALVIGLVSIIPMFWK 118

Query: 137 SFPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
           + PR+     +   ++PI ++ +LYGG  GL  VET  WGGL +TL+I+  GI  ++PLG
Sbjct: 119 AIPRRGRYIAVWAVIYPIIAWGLLYGGSAGLERVETRQWGGLTLTLIIAAVGIAGALPLG 178

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           ILLALGR S++P++R   +TFIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+G
Sbjct: 179 ILLALGRRSHMPIVRVLSVTFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLVRALVG 238

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           V  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I
Sbjct: 239 VILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTII 298

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD+SL+ II +FDL   V+    +  W+     T G +F   V+WIFCFS S YS  
Sbjct: 299 ALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALVYWIFCFSTSRYSQH 356

Query: 376 IEKTLHKG 383
           +EK  + G
Sbjct: 357 LEKRFNTG 364


>gi|218560339|ref|YP_002393252.1| amino-acid transporter subunit ; membrane component of ABC
           superfamily [Escherichia coli S88]
 gi|218367108|emb|CAR04882.1| amino-acid transporter subunit ; membrane component of ABC
           superfamily [Escherichia coli S88]
 gi|323951210|gb|EGB47085.1| inner membrane transport system [Escherichia coli H252]
          Length = 367

 Score =  313 bits (802), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 165/367 (44%), Positives = 232/367 (63%), Gaps = 14/367 (3%)

Query: 18  PSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTV 77
           P L        + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS R  
Sbjct: 10  PRLASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRAD 69

Query: 78  CTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPS 137
           CT            + ACW FI++R+ QF++G YP  QRWR  L  L G + + PM    
Sbjct: 70  CTK-----------SGACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPMFWKI 118

Query: 138 FPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISMPLGI 196
            P +     +   ++P+  ++++YGG LGL  VET  WGGL +TL+I+  GI  ++P GI
Sbjct: 119 LPHRSRYIAVWAVIYPLVVWWLMYGGFLGLDRVETRQWGGLTLTLIIASVGIAGALPWGI 178

Query: 197 LLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGV 256
           LLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV
Sbjct: 179 LLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVGV 238

Query: 257 SAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIG 316
             F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I 
Sbjct: 239 ILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTIIA 298

Query: 317 LFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFI 376
           LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  +
Sbjct: 299 LFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQHL 356

Query: 377 EKTLHKG 383
           EK  + G
Sbjct: 357 EKRFNTG 363


>gi|218691564|ref|YP_002399776.1| amino-acid ABC transporter membrane protein [Escherichia coli ED1a]
 gi|218429128|emb|CAR10071.2| amino-acid transporter subunit ; membrane component of ABC
           superfamily [Escherichia coli ED1a]
          Length = 367

 Score =  313 bits (802), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 167/371 (45%), Positives = 233/371 (62%), Gaps = 15/371 (4%)

Query: 15  LLQPSLPPVYQRG-IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGS 73
           L  P  P  +     + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS
Sbjct: 6   LSHPPRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGS 65

Query: 74  NRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPM 133
            R  CT              ACW FI++R+ QFI+G YP  QRWR  L  L G + + PM
Sbjct: 66  TRADCTKA-----------GACWVFIHERFGQFIYGLYPHDQRWRINLALLIGLVSIAPM 114

Query: 134 LIPSFPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISM 192
                P +     +   ++P+  ++++YGG LGL  VET  WGGL +TL+I+  GI  ++
Sbjct: 115 FWKILPHRGRYIAVWAVIYPLVVWWLMYGGFLGLDRVETRQWGGLTLTLIIASVGIAGAL 174

Query: 193 PLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRA 252
           P GILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RA
Sbjct: 175 PWGILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRA 234

Query: 253 LLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVN 312
           L+GV  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VN
Sbjct: 235 LVGVILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVN 294

Query: 313 TFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLY 372
           T I LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S Y
Sbjct: 295 TIIALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRY 352

Query: 373 SVFIEKTLHKG 383
           S  +EK  + G
Sbjct: 353 SQHLEKCFNTG 363


>gi|149376722|ref|ZP_01894480.1| Amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine [Marinobacter algicola DG893]
 gi|149358961|gb|EDM47427.1| Amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine [Marinobacter algicola DG893]
          Length = 361

 Score =  313 bits (802), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 167/359 (46%), Positives = 242/359 (67%), Gaps = 16/359 (4%)

Query: 29  IAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQP 88
           + W  +N F +  + +LT L+  L++ S+  +++WV LDA + GS+ + CT         
Sbjct: 16  VRWARENLFSSWHNTILTLLVGYLIVTSVGPLLNWVLLDANFQGSDPSDCTGA------- 68

Query: 89  DGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFP-RKFLNSIL 147
                ACW FI  R   FI+G YP   +WR  ++F   ++   P  I  FP RK+L    
Sbjct: 69  ----GACWLFINQRLNFFIYGFYPEEFQWRVDIMFGLLALSFAPQFIERFPGRKWLGLFG 124

Query: 148 LFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNI 206
           L GL PI  +F++ GGL GL  V++S WGGL++TL++++ GII S+P+G LLALGR S +
Sbjct: 125 LTGL-PIVGYFLIPGGLFGLEEVQSSKWGGLMLTLILAYIGIIASLPIGTLLALGRRSEM 183

Query: 207 PVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAE 266
           P++R  C+ FIE++R VPL+TVLFMAS+MLPLFLP+  + +KL RAL+G++ + SAY+AE
Sbjct: 184 PIIRGLCVVFIEVWRAVPLITVLFMASVMLPLFLPEGMNFEKLARALIGITLWQSAYMAE 243

Query: 267 VLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISI 326
           V+RGGLQ+I +GQ+EAA++LGL Y +KM LII+PQ +K VIPGIVNTFI LFKD++L+ I
Sbjct: 244 VIRGGLQAIPRGQYEAASALGLGYWKKMGLIILPQALKLVIPGIVNTFISLFKDTTLVLI 303

Query: 327 INMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSK 385
           I +FD+LG V+   ++  W +      G +F+ F FW+FCF IS YS  +E+ L  G +
Sbjct: 304 IGLFDILGTVQSTVTDPAWQN--VAVEGYVFVAFCFWVFCFGISRYSQNLERKLDTGHR 360


>gi|306816386|ref|ZP_07450518.1| amino-acid transporter subunit ; membrane component of ABC
           superfamily protein [Escherichia coli NC101]
 gi|222034986|emb|CAP77729.1| Inner membrane amino-acid ABC transporter permease [Escherichia
           coli LF82]
 gi|305849951|gb|EFM50410.1| amino-acid transporter subunit ; membrane component of ABC
           superfamily protein [Escherichia coli NC101]
 gi|312947828|gb|ADR28655.1| amino-acid transporter subunit; membrane component of ABC
           superfamily protein [Escherichia coli O83:H1 str. NRG
           857C]
          Length = 367

 Score =  313 bits (802), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 167/371 (45%), Positives = 233/371 (62%), Gaps = 15/371 (4%)

Query: 15  LLQPSLPPVYQRG-IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGS 73
           L  P  P  +     + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS
Sbjct: 6   LSHPPRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGS 65

Query: 74  NRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPM 133
            R  CT              ACW FI++R+ QFI+G YP  QRWR  L  L G + + PM
Sbjct: 66  TRADCTKA-----------GACWVFIHERFGQFIYGLYPHDQRWRINLALLIGLVSIAPM 114

Query: 134 LIPSFPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISM 192
                P +     +   ++P+  ++++YGG LGL  VET  WGGL +TL+I+  GI  ++
Sbjct: 115 FWKILPHRGRYIAVWAVIYPLVVWWLMYGGFLGLDRVETRQWGGLTLTLIIASVGIAGAL 174

Query: 193 PLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRA 252
           P GILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RA
Sbjct: 175 PWGILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRA 234

Query: 253 LLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVN 312
           L+GV  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VN
Sbjct: 235 LVGVILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVN 294

Query: 313 TFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLY 372
           T I LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S Y
Sbjct: 295 TIIALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRY 352

Query: 373 SVFIEKTLHKG 383
           S  +EK  + G
Sbjct: 353 SQHLEKRFNTG 363


>gi|117625559|ref|YP_858882.1| putative transport system permease protein [Escherichia coli APEC
           O1]
 gi|115514683|gb|ABJ02758.1| putative transport system permease protein [Escherichia coli APEC
           O1]
          Length = 368

 Score =  313 bits (802), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 165/367 (44%), Positives = 232/367 (63%), Gaps = 14/367 (3%)

Query: 18  PSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTV 77
           P L        + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS R  
Sbjct: 11  PRLASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRAD 70

Query: 78  CTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPS 137
           CT            + ACW FI++R+ QF++G YP  QRWR  L  L G + + PM    
Sbjct: 71  CTK-----------SGACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPMFWKI 119

Query: 138 FPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISMPLGI 196
            P +     +   ++P+  ++++YGG LGL  VET  WGGL +TL+I+  GI  ++P GI
Sbjct: 120 LPHRSRYIAVWAVIYPLVVWWLMYGGFLGLDRVETRQWGGLTLTLIIASVGIAGALPWGI 179

Query: 197 LLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGV 256
           LLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV
Sbjct: 180 LLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVGV 239

Query: 257 SAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIG 316
             F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I 
Sbjct: 240 ILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTIIA 299

Query: 317 LFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFI 376
           LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  +
Sbjct: 300 LFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQHL 357

Query: 377 EKTLHKG 383
           EK  + G
Sbjct: 358 EKRFNTG 364


>gi|300898042|ref|ZP_07116413.1| ABC transporter, permease protein [Escherichia coli MS 198-1]
 gi|300358261|gb|EFJ74131.1| ABC transporter, permease protein [Escherichia coli MS 198-1]
          Length = 347

 Score =  313 bits (801), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 164/356 (46%), Positives = 230/356 (64%), Gaps = 14/356 (3%)

Query: 29  IAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQP 88
           + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS RT CT         
Sbjct: 1   MVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRTDCTKA------- 53

Query: 89  DGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILL 148
                ACW FI++R+ QF++G YP  QRWR  L  L G + + PM     P +     + 
Sbjct: 54  ----GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPMFWKILPNRGRYIAVW 109

Query: 149 FGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIP 207
             ++P+  ++++YGG LGL  VET  WGGL +TL+I+  GI  ++P GILLALGR S++P
Sbjct: 110 AVIYPLIVWWLMYGGFLGLERVETRQWGGLTLTLIIASVGIAGALPWGILLALGRRSHMP 169

Query: 208 VLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEV 267
           ++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV  F SAY+AEV
Sbjct: 170 IVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVGVILFQSAYVAEV 229

Query: 268 LRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISII 327
           +RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I LFKD+SL+ II
Sbjct: 230 VRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTIIALFKDTSLVIII 289

Query: 328 NMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKG 383
            +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  +EK  + G
Sbjct: 290 GLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQHLEKRFNTG 343


>gi|187732545|ref|YP_001881961.1| amino acid ABC transporter permease, His/Glu/Gln/Arg/opine family
           [Shigella boydii CDC 3083-94]
 gi|187429537|gb|ACD08811.1| amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine
           family [Shigella boydii CDC 3083-94]
          Length = 367

 Score =  313 bits (801), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 166/371 (44%), Positives = 233/371 (62%), Gaps = 15/371 (4%)

Query: 15  LLQPSLPPVYQRG-IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGS 73
           L QPS P  +     + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS
Sbjct: 6   LSQPSRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGS 65

Query: 74  NRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPM 133
            R  CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM
Sbjct: 66  TRADCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPM 114

Query: 134 LIPSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISM 192
                P +     +   ++P+  ++++YGG  GL  VET  WGGL +TL+I+  GI  ++
Sbjct: 115 FWKILPHRGRYIAVWAVIYPLIVWWLMYGGFFGLERVETRQWGGLTLTLIIASVGIAGAL 174

Query: 193 PLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRA 252
           P GILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+R 
Sbjct: 175 PWGILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRV 234

Query: 253 LLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVN 312
           L+GV  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VN
Sbjct: 235 LVGVILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVN 294

Query: 313 TFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLY 372
           T I LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S Y
Sbjct: 295 TIIALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRY 352

Query: 373 SVFIEKTLHKG 383
           S  +EK  + G
Sbjct: 353 SQHLEKRFNAG 363


>gi|300817472|ref|ZP_07097688.1| ABC transporter, permease protein [Escherichia coli MS 107-1]
 gi|300824984|ref|ZP_07105083.1| ABC transporter, permease protein [Escherichia coli MS 119-7]
 gi|300925984|ref|ZP_07141807.1| ABC transporter, permease protein [Escherichia coli MS 182-1]
 gi|301326286|ref|ZP_07219659.1| ABC transporter, permease protein [Escherichia coli MS 78-1]
 gi|300417928|gb|EFK01239.1| ABC transporter, permease protein [Escherichia coli MS 182-1]
 gi|300522550|gb|EFK43619.1| ABC transporter, permease protein [Escherichia coli MS 119-7]
 gi|300529770|gb|EFK50832.1| ABC transporter, permease protein [Escherichia coli MS 107-1]
 gi|300846987|gb|EFK74747.1| ABC transporter, permease protein [Escherichia coli MS 78-1]
 gi|323183030|gb|EFZ68429.1| general L-amino acid transport system permease protein aapM
           [Escherichia coli 1357]
 gi|324020753|gb|EGB89972.1| ABC transporter, permease protein [Escherichia coli MS 117-3]
          Length = 347

 Score =  313 bits (801), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 163/356 (45%), Positives = 230/356 (64%), Gaps = 14/356 (3%)

Query: 29  IAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQP 88
           + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS R  CT         
Sbjct: 1   MVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRADCTKA------- 53

Query: 89  DGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILL 148
                ACW FI++R+ QF++G YP  QRWR  L  L G + + PM     P +     + 
Sbjct: 54  ----GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPMFWKILPHRGRYIAVW 109

Query: 149 FGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIP 207
             ++P+  ++++YGG  GL  VET  WGGL +TL+I+  GI  ++P GILLALGR S++P
Sbjct: 110 AVIYPLIVWWLMYGGFFGLERVETRQWGGLTLTLIIASVGIAGALPWGILLALGRRSHMP 169

Query: 208 VLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEV 267
           ++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +  ++DKL+RAL+GV  F SAY+AEV
Sbjct: 170 IVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTNIDKLIRALVGVILFQSAYVAEV 229

Query: 268 LRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISII 327
           +RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I LFKD+SL+ II
Sbjct: 230 VRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTIIALFKDTSLVIII 289

Query: 328 NMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKG 383
            +FDL   V+    + TW+     T G +F   ++WIFCFS+S YS  +EK  + G
Sbjct: 290 GLFDLFSSVQQATVDPTWLG--MSTEGYVFAALIYWIFCFSMSRYSQHLEKRFNTG 343


>gi|259906953|ref|YP_002647309.1| transport system permease protein [Erwinia pyrifoliae Ep1/96]
 gi|224962575|emb|CAX54030.1| transport system permease protein [Erwinia pyrifoliae Ep1/96]
 gi|283476747|emb|CAY72582.1| putative ABC transport system, inner membrane component [Erwinia
           pyrifoliae DSM 12163]
          Length = 366

 Score =  313 bits (801), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 162/356 (45%), Positives = 225/356 (63%), Gaps = 14/356 (3%)

Query: 29  IAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQP 88
           +AW  KN F    + LLT L + ++  +IP  ++W+   A W G  R  CT         
Sbjct: 20  VAWARKNLFSGVGNSLLTLLCLWIMWEAIPPALNWLIFQANWTGDTRADCTK-------- 71

Query: 89  DGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILL 148
                ACW FI+ R+ Q ++G YP   RWR  L  + G + + PML+ S PR+    +  
Sbjct: 72  ---EGACWVFIHARFGQLMYGLYPHELRWRINLALVIGLLSIVPMLVKSLPRRGSYLVGW 128

Query: 149 FGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIP 207
             ++P+  + ++YGG LGL  VET  WGGL +TL+I+  GI  ++P GILLALGR S +P
Sbjct: 129 AVVYPLLVWLLMYGGWLGLEQVETRQWGGLTLTLIIAAVGIAGALPAGILLALGRRSRMP 188

Query: 208 VLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEV 267
           V+R  C+ FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV  F SAY+AEV
Sbjct: 189 VVRTLCVLFIEFWRGVPLITVLFMSSVMLPLFMAEGSSIDKLIRALVGVILFQSAYVAEV 248

Query: 268 LRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISII 327
           +RGGLQ++ KGQ+E A SL L Y +   L+I+PQ +K VIPG+VNT I LFKD+SL+ II
Sbjct: 249 VRGGLQALPKGQYEGAESLALGYWKTQGLVILPQALKLVIPGLVNTIIALFKDTSLVIII 308

Query: 328 NMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKG 383
            +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  +EK  H G
Sbjct: 309 GLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQHLEKRFHTG 362


>gi|110643516|ref|YP_671246.1| amino acid ABC transporter permease [Escherichia coli 536]
 gi|191173841|ref|ZP_03035362.1| amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine
           family [Escherichia coli F11]
 gi|218702042|ref|YP_002409671.1| amino-acid ABC transporter membrane protein [Escherichia coli
           IAI39]
 gi|110345108|gb|ABG71345.1| hypothetical amino-acid ABC transporter permease protein YhdY
           [Escherichia coli 536]
 gi|190905891|gb|EDV65509.1| amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine
           family [Escherichia coli F11]
 gi|218372028|emb|CAR19886.1| amino-acid transporter subunit ; membrane component of ABC
           superfamily [Escherichia coli IAI39]
 gi|323966448|gb|EGB61882.1| inner membrane transport system [Escherichia coli M863]
 gi|327251364|gb|EGE63053.1| general L-amino acid transport system permease protein aapM
           [Escherichia coli STEC_7v]
          Length = 367

 Score =  312 bits (800), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 166/371 (44%), Positives = 233/371 (62%), Gaps = 15/371 (4%)

Query: 15  LLQPSLPPVYQRG-IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGS 73
           L  P  P  +     + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS
Sbjct: 6   LSHPPRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGS 65

Query: 74  NRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPM 133
            R  CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM
Sbjct: 66  TRADCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPM 114

Query: 134 LIPSFPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISM 192
                P +     +   ++P+  ++++YGG LGL  VET  WGGL +TL+I+  GI  ++
Sbjct: 115 FWKILPHRGRYIAVWAVIYPLIVWWLMYGGFLGLERVETRQWGGLTLTLIIASVGIAGAL 174

Query: 193 PLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRA 252
           P GILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RA
Sbjct: 175 PWGILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRA 234

Query: 253 LLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVN 312
           L+GV  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VN
Sbjct: 235 LVGVILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVN 294

Query: 313 TFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLY 372
           T I LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S Y
Sbjct: 295 TIIALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRY 352

Query: 373 SVFIEKTLHKG 383
           S  +EK  + G
Sbjct: 353 SQHLEKRFNTG 363


>gi|323979010|gb|EGB74088.1| inner membrane transport system [Escherichia coli TW10509]
          Length = 367

 Score =  312 bits (800), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 166/371 (44%), Positives = 233/371 (62%), Gaps = 15/371 (4%)

Query: 15  LLQPSLPPVYQRG-IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGS 73
           L  P  P  +     + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS
Sbjct: 6   LSHPPRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGS 65

Query: 74  NRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPM 133
            R  CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM
Sbjct: 66  TRADCTNA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIVPM 114

Query: 134 LIPSFPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISM 192
                P +     +   ++P+  ++++YGG LGL  VET  WGGL +TL+I+  GI  ++
Sbjct: 115 FWKILPHRGRYIAVWAVIYPLIVWWLMYGGFLGLERVETRQWGGLTLTLIIASVGIAGAL 174

Query: 193 PLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRA 252
           P GILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RA
Sbjct: 175 PWGILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRA 234

Query: 253 LLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVN 312
           L+GV  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VN
Sbjct: 235 LVGVILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVN 294

Query: 313 TFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLY 372
           T I LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S Y
Sbjct: 295 TIIALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRY 352

Query: 373 SVFIEKTLHKG 383
           S  +EK  + G
Sbjct: 353 SQHLEKRFNTG 363


>gi|320656323|gb|EFX24235.1| putative transport system permease protein [Escherichia coli O55:H7
           str. 3256-97 TW 07815]
          Length = 367

 Score =  312 bits (800), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 166/371 (44%), Positives = 232/371 (62%), Gaps = 15/371 (4%)

Query: 15  LLQPSLPPVYQRG-IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGS 73
           L  PS P  +     + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS
Sbjct: 6   LSHPSRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGS 65

Query: 74  NRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPM 133
            R  CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM
Sbjct: 66  TRADCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPM 114

Query: 134 LIPSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISM 192
                P +     +   ++P+  ++++YGG   L  VET  WGGL +TL+I+  GI  ++
Sbjct: 115 FWKILPHRGRYIAVWAVIYPLIVWWLMYGGFFALERVETRQWGGLTLTLIIASVGIAGAL 174

Query: 193 PLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRA 252
           P GILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RA
Sbjct: 175 PWGILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRA 234

Query: 253 LLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVN 312
           L+GV  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VN
Sbjct: 235 LVGVILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVN 294

Query: 313 TFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLY 372
           T I LFKD+SL+ II +FDL   V+    E  W+     T G +F   ++WIFCFS+S Y
Sbjct: 295 TIIALFKDTSLVIIIGLFDLFSSVQQATVEPAWLG--MSTEGYVFAALIYWIFCFSMSRY 352

Query: 373 SVFIEKTLHKG 383
           S  +EK  + G
Sbjct: 353 SQHLEKRFNTG 363


>gi|324009100|gb|EGB78319.1| ABC transporter, permease protein [Escherichia coli MS 57-2]
          Length = 347

 Score =  312 bits (800), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 164/356 (46%), Positives = 229/356 (64%), Gaps = 14/356 (3%)

Query: 29  IAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQP 88
           + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS R  CT         
Sbjct: 1   MVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRADCTKA------- 53

Query: 89  DGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILL 148
                ACW FI++R+ QFI+G YP  QRWR  L  L G + + PM     P +     + 
Sbjct: 54  ----GACWVFIHERFGQFIYGLYPHDQRWRINLALLIGLVSIAPMFWKILPHRGRYIAVW 109

Query: 149 FGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIP 207
             ++P+  ++++YGG LGL  VET  WGGL +TL+I+  GI  ++P GILLALGR S++P
Sbjct: 110 AVIYPLVVWWLMYGGFLGLDRVETRQWGGLTLTLIIASVGIAGALPWGILLALGRRSHMP 169

Query: 208 VLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEV 267
           ++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV  F SAY+AEV
Sbjct: 170 IVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVGVILFQSAYVAEV 229

Query: 268 LRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISII 327
           +RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I LFKD+SL+ II
Sbjct: 230 VRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTIIALFKDTSLVIII 289

Query: 328 NMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKG 383
            +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  +EK  + G
Sbjct: 290 GLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQHLEKRFNTG 343


>gi|237730188|ref|ZP_04560669.1| conserved hypothetical protein [Citrobacter sp. 30_2]
 gi|226908794|gb|EEH94712.1| conserved hypothetical protein [Citrobacter sp. 30_2]
          Length = 368

 Score =  312 bits (800), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 162/354 (45%), Positives = 228/354 (64%), Gaps = 14/354 (3%)

Query: 31  WIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDG 90
           W+ KN F +  + LLT L + L+   +P +++WVF  A W+GS R  CT           
Sbjct: 24  WVRKNLFSSWSNSLLTLLCVWLIWSFLPPLLNWVFFQANWVGSTRADCTKA--------- 74

Query: 91  WNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFG 150
              ACW FI++R+ QF++G YP  QRWR  L  + G   + PM   + P +     +   
Sbjct: 75  --GACWVFIHERFGQFMYGLYPHDQRWRVNLALIIGLASIVPMFWKTIPHRGRYIAIWAV 132

Query: 151 LFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVL 209
           ++PI  ++++YGG  GL  VET  WGGL +TL+I+  GI  ++P GILLALGR S++PV+
Sbjct: 133 IYPIVVWWLMYGGFFGLERVETRQWGGLTLTLIIASVGIAGALPWGILLALGRRSHMPVV 192

Query: 210 RYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLR 269
           R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV  F SAY+AEV+R
Sbjct: 193 RVLSVIFIEFWRGVPLITVLFMSSVMLPLFMSEGTSIDKLIRALVGVILFQSAYVAEVVR 252

Query: 270 GGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINM 329
           GGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I LFKD+SL+ II +
Sbjct: 253 GGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTIIALFKDTSLVIIIGL 312

Query: 330 FDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKG 383
           FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  +EK  + G
Sbjct: 313 FDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQHLEKRFNTG 364


>gi|308188313|ref|YP_003932444.1| Inner membrane amino-acid ABC transporter permease protein yhdY
           [Pantoea vagans C9-1]
 gi|308058823|gb|ADO10995.1| Inner membrane amino-acid ABC transporter permease protein yhdY
           [Pantoea vagans C9-1]
          Length = 366

 Score =  312 bits (800), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 166/354 (46%), Positives = 225/354 (63%), Gaps = 14/354 (3%)

Query: 31  WIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDG 90
           W  KN F +  + LLT   I ++   IP  ++W+   A WIG+ R  CT           
Sbjct: 22  WARKNLFSSWFNTLLTLFCIWVIWHVIPPALNWLVFQANWIGTTRADCTK---------- 71

Query: 91  WNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFG 150
              ACW FI+ R+ QF++G YP   RWR  L  + G + + PM + S P +         
Sbjct: 72  -EGACWVFIHARFGQFMYGLYPHELRWRINLALVIGLLSIVPMFLKSLPYRGRYIAAWAV 130

Query: 151 LFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVL 209
           ++P+  +F+LYGG LGL  VET  WGGL +TL+I+  GI  ++PLGILLALGR S +PV+
Sbjct: 131 IYPVIVWFLLYGGYLGLERVETRQWGGLTLTLIIASVGIAGALPLGILLALGRRSRMPVV 190

Query: 210 RYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLR 269
           R   I FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV  F SAY+AEV+R
Sbjct: 191 RTLSIIFIEFWRGVPLITVLFMSSVMLPLFMSEGTTIDKLVRALVGVILFQSAYVAEVVR 250

Query: 270 GGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINM 329
           GGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K  IPG+VNT I LFKD+SL+ II +
Sbjct: 251 GGLQALPKGQYEAAESLALGYWKTQMLVILPQALKLTIPGLVNTIIALFKDTSLVIIIGL 310

Query: 330 FDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKG 383
           FDL   V+    + TW+     T G +F   V+WIFCFS+S YS ++EK  H G
Sbjct: 311 FDLFSSVQQATVDPTWLG--MSTEGYVFAALVYWIFCFSMSRYSQYLEKRFHTG 362


>gi|331649071|ref|ZP_08350159.1| inner membrane amino-acid ABC transporter permease protein YhdY
           [Escherichia coli M605]
 gi|330909321|gb|EGH37835.1| glutamate Aspartate transport system permease protein GltK
           [Escherichia coli AA86]
 gi|331042818|gb|EGI14960.1| inner membrane amino-acid ABC transporter permease protein YhdY
           [Escherichia coli M605]
          Length = 367

 Score =  312 bits (800), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 166/371 (44%), Positives = 233/371 (62%), Gaps = 15/371 (4%)

Query: 15  LLQPSLPPVYQRG-IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGS 73
           L  P  P  +     + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS
Sbjct: 6   LSHPPRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGS 65

Query: 74  NRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPM 133
            R  CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM
Sbjct: 66  TRADCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPM 114

Query: 134 LIPSFPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISM 192
                P +     +   ++P+  ++++YGG LGL  VET  WGGL +TL+I+  GI  ++
Sbjct: 115 FWKILPHRGRYIAVWAVIYPLVVWWLMYGGFLGLDRVETRQWGGLTLTLIIASVGIAGAL 174

Query: 193 PLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRA 252
           P GILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RA
Sbjct: 175 PWGILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRA 234

Query: 253 LLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVN 312
           L+GV  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VN
Sbjct: 235 LVGVILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVN 294

Query: 313 TFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLY 372
           T I LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S Y
Sbjct: 295 TIIALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRY 352

Query: 373 SVFIEKTLHKG 383
           S  +EK  + G
Sbjct: 353 SQHLEKRFNTG 363


>gi|281180312|dbj|BAI56642.1| amino acid ABC transporter permease component [Escherichia coli
           SE15]
          Length = 368

 Score =  312 bits (799), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 166/371 (44%), Positives = 233/371 (62%), Gaps = 15/371 (4%)

Query: 15  LLQPSLPPVYQRG-IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGS 73
           L  P  P  +     + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS
Sbjct: 7   LSHPPRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGS 66

Query: 74  NRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPM 133
            R  CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM
Sbjct: 67  TRADCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPM 115

Query: 134 LIPSFPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISM 192
                P +     +   ++P+  ++++YGG LGL  VET  WGGL +TL+I+  GI  ++
Sbjct: 116 FWKILPHRGRYIAVWAVIYPLVVWWLMYGGFLGLDRVETRQWGGLTLTLIIASVGIAGAL 175

Query: 193 PLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRA 252
           P GILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RA
Sbjct: 176 PWGILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRA 235

Query: 253 LLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVN 312
           L+GV  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VN
Sbjct: 236 LVGVILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVN 295

Query: 313 TFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLY 372
           T I LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S Y
Sbjct: 296 TIIALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRY 353

Query: 373 SVFIEKTLHKG 383
           S  +EK  + G
Sbjct: 354 SQHLEKRFNTG 364


>gi|238798510|ref|ZP_04641989.1| Inner membrane amino-acid ABC transporter permease protein yhdY
           [Yersinia mollaretii ATCC 43969]
 gi|238717672|gb|EEQ09509.1| Inner membrane amino-acid ABC transporter permease protein yhdY
           [Yersinia mollaretii ATCC 43969]
          Length = 367

 Score =  312 bits (799), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 165/357 (46%), Positives = 229/357 (64%), Gaps = 14/357 (3%)

Query: 28  IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQ 87
           ++ W  KN F +  + LLT   + L+   IP +++W   +A W+G++RT CT        
Sbjct: 20  MVFWARKNLFSSWSNSLLTLFCLWLMWQLIPPLLNWTIFNANWLGTSRTDCTR------- 72

Query: 88  PDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSIL 147
                 ACW FI+ R+ QF++G YP+ QRWR     + G + L P+     PR+     +
Sbjct: 73  ----EGACWVFIHARFGQFMYGLYPIEQRWRINTTLIIGLLTLIPLFWRGMPRRGRYLAV 128

Query: 148 LFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNI 206
               +P+  + +LYGG LGLS VET  WGGL +TL+I+  GI  ++PLGILLAL R S++
Sbjct: 129 WMVAYPLLVWVMLYGGFLGLSRVETHQWGGLTLTLIIAAVGIAGALPLGILLALARRSSM 188

Query: 207 PVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAE 266
           PV+R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV  F SAY+AE
Sbjct: 189 PVVRILSVAFIEFWRGVPLITVLFMSSVMLPLFMTEGTSIDKLIRALVGVVLFQSAYVAE 248

Query: 267 VLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISI 326
           V+RGGLQ++ KGQ EAA SLGL Y +   L+I+PQ +K VIPG+VNT I LFKD+SL+ I
Sbjct: 249 VVRGGLQALPKGQTEAAESLGLGYWKTQGLVILPQALKMVIPGLVNTIIALFKDTSLVII 308

Query: 327 INMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKG 383
           I +FDL   V+    +  W+     T G +F   V+WIFCFS+S YS  +EK  H G
Sbjct: 309 IGLFDLFSSVQQATVDPAWLG--MSTEGYVFAAAVYWIFCFSMSRYSQHLEKRFHTG 363


>gi|300904466|ref|ZP_07122312.1| ABC transporter, permease protein [Escherichia coli MS 84-1]
 gi|301304261|ref|ZP_07210375.1| ABC transporter, permease protein [Escherichia coli MS 124-1]
 gi|309793851|ref|ZP_07688277.1| ABC transporter, permease protein [Escherichia coli MS 145-7]
 gi|300403628|gb|EFJ87166.1| ABC transporter, permease protein [Escherichia coli MS 84-1]
 gi|300840387|gb|EFK68147.1| ABC transporter, permease protein [Escherichia coli MS 124-1]
 gi|308122808|gb|EFO60070.1| ABC transporter, permease protein [Escherichia coli MS 145-7]
 gi|315257198|gb|EFU37166.1| ABC transporter, permease protein [Escherichia coli MS 85-1]
          Length = 347

 Score =  312 bits (799), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 163/356 (45%), Positives = 229/356 (64%), Gaps = 14/356 (3%)

Query: 29  IAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQP 88
           + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS R  CT         
Sbjct: 1   MVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRADCTKA------- 53

Query: 89  DGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILL 148
                ACW FI++R+ QF++G YP  QRWR  L  L G + + PM     P +     + 
Sbjct: 54  ----GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPMFWKILPHRGRYIAVW 109

Query: 149 FGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIP 207
             ++P+  ++++YGG  GL  VET  WGGL +TL+I+  GI  ++P GILLALGR S++P
Sbjct: 110 AVIYPLIVWWLMYGGFFGLERVETRQWGGLTLTLIIASVGIAGALPWGILLALGRRSHMP 169

Query: 208 VLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEV 267
           ++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV  F SAY+AEV
Sbjct: 170 IVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVGVILFQSAYVAEV 229

Query: 268 LRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISII 327
           +RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I LFKD+SL+ II
Sbjct: 230 VRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTIIALFKDTSLVIII 289

Query: 328 NMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKG 383
            +FDL   V+    + TW+     T G +F   ++WIFCFS+S YS  +EK  + G
Sbjct: 290 GLFDLFSSVQQATVDPTWLG--MSTEGYVFAALIYWIFCFSMSRYSQHLEKRFNTG 343


>gi|82778576|ref|YP_404925.1| putative transport system permease protein [Shigella dysenteriae
           Sd197]
 gi|309785601|ref|ZP_07680232.1| general L-amino acid transport system permease protein aapM
           [Shigella dysenteriae 1617]
 gi|81242724|gb|ABB63434.1| putative transport system permease protein [Shigella dysenteriae
           Sd197]
 gi|308926721|gb|EFP72197.1| general L-amino acid transport system permease protein aapM
           [Shigella dysenteriae 1617]
          Length = 368

 Score =  312 bits (799), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 166/371 (44%), Positives = 232/371 (62%), Gaps = 15/371 (4%)

Query: 15  LLQPSLPPVYQRG-IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGS 73
           L  PS P  +     + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS
Sbjct: 7   LSHPSRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGS 66

Query: 74  NRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPM 133
            R  CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM
Sbjct: 67  TRADCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPM 115

Query: 134 LIPSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISM 192
                P +     L   ++P+  ++++YGG   L  VET  WGGL +TL+I+  GI  ++
Sbjct: 116 FWKILPHRGRYIALWAVIYPLIVWWLMYGGFFALDRVETRQWGGLTLTLIIASVGIAGAL 175

Query: 193 PLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRA 252
           P GILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RA
Sbjct: 176 PWGILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRA 235

Query: 253 LLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVN 312
           L+GV  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VN
Sbjct: 236 LVGVILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVN 295

Query: 313 TFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLY 372
           T I LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S Y
Sbjct: 296 TIIALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRY 353

Query: 373 SVFIEKTLHKG 383
           S  +EK  + G
Sbjct: 354 SQHLEKRFNTG 364


>gi|300937397|ref|ZP_07152232.1| ABC transporter, permease protein [Escherichia coli MS 21-1]
 gi|300979703|ref|ZP_07174653.1| ABC transporter, permease protein [Escherichia coli MS 200-1]
 gi|300307921|gb|EFJ62441.1| ABC transporter, permease protein [Escherichia coli MS 200-1]
 gi|300457571|gb|EFK21064.1| ABC transporter, permease protein [Escherichia coli MS 21-1]
 gi|324015880|gb|EGB85099.1| ABC transporter, permease protein [Escherichia coli MS 60-1]
          Length = 347

 Score =  311 bits (798), Expect = 9e-83,   Method: Compositional matrix adjust.
 Identities = 163/356 (45%), Positives = 229/356 (64%), Gaps = 14/356 (3%)

Query: 29  IAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQP 88
           + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS R  CT         
Sbjct: 1   MVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRADCTKA------- 53

Query: 89  DGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILL 148
                ACW FI++R+ QF++G YP  QRWR  L  L G + + PM     P +     + 
Sbjct: 54  ----GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPMFWKILPHRGRYIAVW 109

Query: 149 FGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIP 207
             ++P+  ++++YGG LGL  VET  WGGL +TL+I+  GI  ++P GILLALGR S++P
Sbjct: 110 AVIYPLIVWWLMYGGFLGLERVETRQWGGLTLTLIIASVGIAGALPWGILLALGRRSHMP 169

Query: 208 VLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEV 267
           ++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV  F SAY+AEV
Sbjct: 170 IVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVGVILFQSAYVAEV 229

Query: 268 LRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISII 327
           +RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I LFKD+SL+ II
Sbjct: 230 VRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTIIALFKDTSLVIII 289

Query: 328 NMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKG 383
            +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  +EK  + G
Sbjct: 290 GLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQHLEKRFNTG 343


>gi|331664879|ref|ZP_08365784.1| inner membrane amino-acid ABC transporter permease protein YhdY
           [Escherichia coli TA143]
 gi|331058127|gb|EGI30109.1| inner membrane amino-acid ABC transporter permease protein YhdY
           [Escherichia coli TA143]
          Length = 367

 Score =  311 bits (797), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 165/371 (44%), Positives = 232/371 (62%), Gaps = 15/371 (4%)

Query: 15  LLQPSLPPVYQRG-IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGS 73
           L  P  P  +     + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS
Sbjct: 6   LSHPPRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGS 65

Query: 74  NRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPM 133
            R  CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM
Sbjct: 66  TRADCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPM 114

Query: 134 LIPSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISM 192
                P +     +   ++P+  ++++YGG  GL  VET  WGGL +TL+I+  GI  ++
Sbjct: 115 FWKILPHRGRYIAVWAVMYPLIVWWLMYGGFFGLERVETRQWGGLTLTLIIASVGIAGAL 174

Query: 193 PLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRA 252
           P GILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RA
Sbjct: 175 PWGILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRA 234

Query: 253 LLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVN 312
           L+GV  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VN
Sbjct: 235 LVGVILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVN 294

Query: 313 TFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLY 372
           T I LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S Y
Sbjct: 295 TIIALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRY 352

Query: 373 SVFIEKTLHKG 383
           S  +EK  + G
Sbjct: 353 SQHLEKRFNTG 363


>gi|284923284|emb|CBG36378.1| ABC transporter, permease protein [Escherichia coli 042]
          Length = 368

 Score =  311 bits (797), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 165/371 (44%), Positives = 232/371 (62%), Gaps = 15/371 (4%)

Query: 15  LLQPSLPPVYQRG-IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGS 73
           L  P  P  +     + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS
Sbjct: 7   LSHPPRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGS 66

Query: 74  NRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPM 133
            R  CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM
Sbjct: 67  TRADCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPM 115

Query: 134 LIPSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISM 192
                P +     +   ++P+  ++++YGG  GL  VET  WGGL +TL+I+  GI  ++
Sbjct: 116 FWKILPHRGRYIAVWAVMYPLIVWWLMYGGFFGLERVETRQWGGLTLTLIIASVGIAGAL 175

Query: 193 PLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRA 252
           P GILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RA
Sbjct: 176 PWGILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRA 235

Query: 253 LLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVN 312
           L+GV  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VN
Sbjct: 236 LVGVILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVN 295

Query: 313 TFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLY 372
           T I LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S Y
Sbjct: 296 TIIALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRY 353

Query: 373 SVFIEKTLHKG 383
           S  +EK  + G
Sbjct: 354 SQHLEKRFNTG 364


>gi|15803805|ref|NP_289839.1| putative transport system permease protein [Escherichia coli
           O157:H7 EDL933]
 gi|15833397|ref|NP_312170.1| transport system permease protein [Escherichia coli O157:H7 str.
           Sakai]
 gi|12517901|gb|AAG58399.1|AE005554_10 putative transport system permease protein [Escherichia coli
           O157:H7 str. EDL933]
 gi|13363616|dbj|BAB37566.1| putative transport system permease protein [Escherichia coli
           O157:H7 str. Sakai]
          Length = 368

 Score =  311 bits (797), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 165/371 (44%), Positives = 232/371 (62%), Gaps = 15/371 (4%)

Query: 15  LLQPSLPPVYQRG-IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGS 73
           L  PS P  +     + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS
Sbjct: 7   LSHPSRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGS 66

Query: 74  NRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPM 133
            R  CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM
Sbjct: 67  TRADCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPM 115

Query: 134 LIPSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISM 192
                P +     +   ++P+  ++++YGG   L  VET  WGGL +TL+I+  GI  ++
Sbjct: 116 FWKILPHRGRYIAVWVVIYPLIVWWLMYGGFFALERVETRQWGGLTLTLIIASVGIAGAL 175

Query: 193 PLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRA 252
           P GILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RA
Sbjct: 176 PWGILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRA 235

Query: 253 LLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVN 312
           L+GV  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VN
Sbjct: 236 LVGVILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVN 295

Query: 313 TFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLY 372
           T I LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S Y
Sbjct: 296 TIIALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRY 353

Query: 373 SVFIEKTLHKG 383
           S  +EK  + G
Sbjct: 354 SQHLEKRFNTG 364


>gi|260870021|ref|YP_003236423.1| putative transport system permease protein [Escherichia coli
           O111:H- str. 11128]
 gi|257766377|dbj|BAI37872.1| putative transport system permease protein [Escherichia coli
           O111:H- str. 11128]
          Length = 367

 Score =  311 bits (797), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 167/371 (45%), Positives = 234/371 (63%), Gaps = 15/371 (4%)

Query: 15  LLQPSLPPVYQRG-IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGS 73
           L QPS P  +     + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS
Sbjct: 6   LSQPSRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGS 65

Query: 74  NRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPM 133
            R  CT              ACW FI++R+ QF++G YP  QR R  L  L G + + PM
Sbjct: 66  TRADCTKA-----------GACWVFIHERFGQFMYGLYPHDQRRRINLALLIGLVSIAPM 114

Query: 134 LIPSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISM 192
                P +     +   ++P+  ++++YGG  GL  VET  WGGL +TL+I+  GI  ++
Sbjct: 115 FWKILPHRGRYIAVWAVIYPLIVWWLMYGGFFGLERVETRQWGGLTLTLIIASVGIAGAL 174

Query: 193 PLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRA 252
           P GILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RA
Sbjct: 175 PWGILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRA 234

Query: 253 LLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVN 312
           L+GV  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VN
Sbjct: 235 LVGVILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVN 294

Query: 313 TFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLY 372
           T I LFKD+SL+ II +FDL   V+    + TW+     T G +F   ++WIFCFS+S Y
Sbjct: 295 TIIALFKDTSLVIIIGLFDLFSSVQQATVDPTWLG--MSTEGYVFAALIYWIFCFSMSRY 352

Query: 373 SVFIEKTLHKG 383
           S  +EK  + G
Sbjct: 353 SQHLEKRFNTG 363


>gi|168764867|ref|ZP_02789874.1| amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine
           family [Escherichia coli O157:H7 str. EC4501]
 gi|217327153|ref|ZP_03443236.1| amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine
           family [Escherichia coli O157:H7 str. TW14588]
 gi|189365197|gb|EDU83613.1| amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine
           family [Escherichia coli O157:H7 str. EC4501]
 gi|217319520|gb|EEC27945.1| amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine
           family [Escherichia coli O157:H7 str. TW14588]
 gi|326347536|gb|EGD71261.1| Glutamate Aspartate transport system permease protein GltK
           [Escherichia coli O157:H7 str. 1044]
          Length = 367

 Score =  311 bits (797), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 165/371 (44%), Positives = 232/371 (62%), Gaps = 15/371 (4%)

Query: 15  LLQPSLPPVYQRG-IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGS 73
           L  PS P  +     + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS
Sbjct: 6   LSHPSRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGS 65

Query: 74  NRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPM 133
            R  CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM
Sbjct: 66  TRADCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPM 114

Query: 134 LIPSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISM 192
                P +     +   ++P+  ++++YGG   L  VET  WGGL +TL+I+  GI  ++
Sbjct: 115 FWKILPHRGRYIAVWVVIYPLIVWWLMYGGFFALERVETRQWGGLTLTLIIASVGIAGAL 174

Query: 193 PLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRA 252
           P GILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RA
Sbjct: 175 PWGILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRA 234

Query: 253 LLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVN 312
           L+GV  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VN
Sbjct: 235 LVGVILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVN 294

Query: 313 TFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLY 372
           T I LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S Y
Sbjct: 295 TIIALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRY 352

Query: 373 SVFIEKTLHKG 383
           S  +EK  + G
Sbjct: 353 SQHLEKRFNTG 363


>gi|218550554|ref|YP_002384345.1| amino-acid ABC transporter membrane protein [Escherichia fergusonii
           ATCC 35469]
 gi|218358095|emb|CAQ90741.1| amino-acid transporter subunit ; membrane component of ABC
           superfamily [Escherichia fergusonii ATCC 35469]
          Length = 367

 Score =  311 bits (796), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 165/371 (44%), Positives = 233/371 (62%), Gaps = 15/371 (4%)

Query: 15  LLQPSLPPVYQRG-IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGS 73
           L  P  P  +     + W+ KN F +  + LLT   + L+   IP +++W FL A W+GS
Sbjct: 6   LSHPPRPTSHNSSRAMVWVRKNLFSSWSNSLLTIGCLWLMWELIPPLLNWAFLQANWVGS 65

Query: 74  NRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPM 133
            R  CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM
Sbjct: 66  TRADCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPM 114

Query: 134 LIPSFPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISM 192
                P +     +   ++P+  ++++YGG LGL  VET  WGGL +TL+I+  GI  ++
Sbjct: 115 FWKILPHRGRYIAVWAVIYPLIVWWLMYGGFLGLERVETRQWGGLTLTLIIASVGIAGAL 174

Query: 193 PLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRA 252
           P GILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RA
Sbjct: 175 PWGILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRA 234

Query: 253 LLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVN 312
           L+GV  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VN
Sbjct: 235 LVGVILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVN 294

Query: 313 TFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLY 372
           T I LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S Y
Sbjct: 295 TIIALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRY 352

Query: 373 SVFIEKTLHKG 383
           S  +EK  + G
Sbjct: 353 SQHLEKRFNTG 363


>gi|237807993|ref|YP_002892433.1| polar amino acid ABC transporter, inner membrane subunit [Tolumonas
           auensis DSM 9187]
 gi|237500254|gb|ACQ92847.1| polar amino acid ABC transporter, inner membrane subunit [Tolumonas
           auensis DSM 9187]
          Length = 365

 Score =  311 bits (796), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 169/372 (45%), Positives = 244/372 (65%), Gaps = 15/372 (4%)

Query: 17  QPSLP-PVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNR 75
           QP+LP P  Q   + W+HKN F    + ++T  ++  L+  +  +I W FL + W+G NR
Sbjct: 7   QPTLPAPASQTSFVGWMHKNLFSNWVNSIITLALLYFLVPQLWSLIQWAFLKSDWVGDNR 66

Query: 76  TVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLI 135
           + C +   GG        ACW FI +R   FI+G YP ++ WR   ++   ++ +  +L 
Sbjct: 67  SQCVS---GG--------ACWVFITNRLNLFIYGFYPESEHWRVNWIYALTALQVAALLY 115

Query: 136 PSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPL 194
           P  P K + + + F ++P   FF+LYGG+ GL +VET  WGGL++TL++   G + ++P+
Sbjct: 116 PKTPHKSILTGIFFVVYPFVVFFLLYGGVFGLDVVETHKWGGLMLTLLLGIIGTVAALPI 175

Query: 195 GILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALL 254
           GILLALGR S +P++R   I FIE +R VPL+TVLFMAS+MLPLFL     +DKLLRA++
Sbjct: 176 GILLALGRRSEMPIIRSLSIVFIEFWRAVPLITVLFMASVMLPLFLSGEVSMDKLLRAMI 235

Query: 255 GVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTF 314
           G+  F SAY+AEV+RGGLQ+I KGQ+EAA +LGL+Y + M LIIMPQ +K  IP +VNTF
Sbjct: 236 GIILFESAYVAEVIRGGLQAIPKGQYEAAKALGLNYWKSMGLIIMPQALKLTIPSLVNTF 295

Query: 315 IGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSV 374
           I LFKD+SL++II +FDLL + +   S+  W+     T    F+  VFW+FCF +S YS+
Sbjct: 296 IELFKDTSLVTIIGLFDLLAVAKAGLSDPAWLG--FSTEAYTFVALVFWVFCFGMSRYSM 353

Query: 375 FIEKTLHKGSKK 386
           ++E  LH G K+
Sbjct: 354 YLENLLHTGHKR 365


>gi|291086480|ref|ZP_06355922.2| general amino acid ABC transporter, permease protein [Citrobacter
           youngae ATCC 29220]
 gi|291067532|gb|EFE05641.1| general amino acid ABC transporter, permease protein [Citrobacter
           youngae ATCC 29220]
          Length = 368

 Score =  311 bits (796), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 160/354 (45%), Positives = 229/354 (64%), Gaps = 14/354 (3%)

Query: 31  WIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDG 90
           W+ KN F +  + LLT L + L+   +P +++WVF  A W+GS R  CT           
Sbjct: 24  WVRKNLFSSWSNSLLTLLCVWLIWSFLPPLLNWVFFQANWVGSTRADCTKA--------- 74

Query: 91  WNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFG 150
              ACW FI++R+ QF++G YP  QRWR  +  + G + + PM   + P +     +   
Sbjct: 75  --GACWVFIHERFGQFMYGLYPHDQRWRINMALIIGLLSIVPMFCKTLPHRGRYIAVWAV 132

Query: 151 LFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVL 209
           ++P+  ++++YGG  GL  VET  WGGL +TL+I+  GI  ++P GILLALGR S++PV+
Sbjct: 133 VYPLVVWWLMYGGFFGLERVETRQWGGLTLTLIIASVGIAGALPWGILLALGRRSHMPVV 192

Query: 210 RYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLR 269
           R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV  F SAY+AEV+R
Sbjct: 193 RILSVIFIEFWRGVPLITVLFMSSVMLPLFMSEGTSIDKLIRALVGVILFQSAYVAEVVR 252

Query: 270 GGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINM 329
           GGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I LFKD+SL+ II +
Sbjct: 253 GGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTIIALFKDTSLVIIIGL 312

Query: 330 FDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKG 383
           FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  +EK  + G
Sbjct: 313 FDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQHLEKRFNTG 364


>gi|323173470|gb|EFZ59099.1| general L-amino acid transport system permease protein aapM
           [Escherichia coli LT-68]
          Length = 347

 Score =  311 bits (796), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 162/356 (45%), Positives = 229/356 (64%), Gaps = 14/356 (3%)

Query: 29  IAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQP 88
           + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS R  CT         
Sbjct: 1   MVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRADCTKA------- 53

Query: 89  DGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILL 148
                ACW FI++R+ QF++G YP  QRWR  L  L G + + PM     P +     + 
Sbjct: 54  ----GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPMFWKILPHRGRYIAVW 109

Query: 149 FGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIP 207
             ++P+  ++++YGG  GL  VET  WGGL +TL+I+  GI  ++P GILLALGR S++P
Sbjct: 110 AVIYPLIVWWLMYGGFFGLERVETRQWGGLTLTLIIASVGIAGALPWGILLALGRRSHMP 169

Query: 208 VLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEV 267
           ++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +  ++DKL+RAL+GV  F SAY+AEV
Sbjct: 170 IVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTNIDKLIRALVGVILFQSAYVAEV 229

Query: 268 LRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISII 327
           +RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I LFKD+SL+ II
Sbjct: 230 VRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTIIALFKDTSLVIII 289

Query: 328 NMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKG 383
            +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  +EK  + G
Sbjct: 290 GLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQHLEKRFNTG 343


>gi|168802618|ref|ZP_02827625.1| amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine
           family [Escherichia coli O157:H7 str. EC508]
 gi|189375435|gb|EDU93851.1| amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine
           family [Escherichia coli O157:H7 str. EC508]
 gi|320189619|gb|EFW64278.1| Glutamate Aspartate transport system permease protein GltK
           [Escherichia coli O157:H7 str. EC1212]
 gi|320639916|gb|EFX09507.1| putative transport system permease protein [Escherichia coli
           O157:H7 str. G5101]
 gi|320645632|gb|EFX14641.1| putative transport system permease protein [Escherichia coli
           O157:H- str. 493-89]
 gi|320650942|gb|EFX19399.1| putative transport system permease protein [Escherichia coli
           O157:H- str. H 2687]
 gi|320662013|gb|EFX29421.1| putative transport system permease protein [Escherichia coli O55:H7
           str. USDA 5905]
 gi|320666849|gb|EFX33828.1| putative transport system permease protein [Escherichia coli
           O157:H7 str. LSU-61]
 gi|326337967|gb|EGD61801.1| Glutamate Aspartate transport system permease protein GltK
           [Escherichia coli O157:H7 str. 1125]
          Length = 367

 Score =  311 bits (796), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 165/371 (44%), Positives = 232/371 (62%), Gaps = 15/371 (4%)

Query: 15  LLQPSLPPVYQRG-IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGS 73
           L  PS P  +     + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS
Sbjct: 6   LSHPSRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGS 65

Query: 74  NRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPM 133
            R  CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM
Sbjct: 66  TRADCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPM 114

Query: 134 LIPSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISM 192
                P +     +   ++P+  ++++YGG   L  VET  WGGL +TL+I+  GI  ++
Sbjct: 115 FWKILPHRGRYIAVWAVIYPLIVWWLMYGGFFALERVETRQWGGLTLTLIIASVGIAGAL 174

Query: 193 PLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRA 252
           P GILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RA
Sbjct: 175 PWGILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRA 234

Query: 253 LLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVN 312
           L+GV  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VN
Sbjct: 235 LVGVILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVN 294

Query: 313 TFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLY 372
           T I LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S Y
Sbjct: 295 TIIALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRY 352

Query: 373 SVFIEKTLHKG 383
           S  +EK  + G
Sbjct: 353 SQHLEKRFNTG 363


>gi|90409068|ref|ZP_01217193.1| amino acid ABC transporter, permease protein [Psychromonas sp.
           CNPT3]
 gi|90309825|gb|EAS37985.1| amino acid ABC transporter, permease protein [Psychromonas sp.
           CNPT3]
          Length = 359

 Score =  311 bits (796), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 169/371 (45%), Positives = 244/371 (65%), Gaps = 20/371 (5%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
            +++     P   RGII W+ +N F   K+ +LT + + LL  ++P +++W+  DA W G
Sbjct: 4   HKIINARHAPSTSRGIIFWLRENLFPNLKNSILTLVGLYLLSITLPPLLNWMIFDATWSG 63

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFL-TGSILLT 131
           +         Q  I  DG   A W FI ++++ FI+G YP +  WRP LV L T + L  
Sbjct: 64  T---------QAEISKDG---ARWIFIIEKFDLFIYGFYPESLHWRPDLVVLITIAFLAC 111

Query: 132 PMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIII 190
              +P F  K    + +  ++P   FF++ GG+ GL  V T  WGGL++TL+++  GII+
Sbjct: 112 VKWLPHFKIK----VFIILIYPFICFFLISGGVFGLEHVATEKWGGLMLTLIVAAVGIIV 167

Query: 191 SMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLL 250
           S P+GI+LALGR S++P+L++ CITFIE  RGVPL+T+LFMAS++LPLF  D  D DKLL
Sbjct: 168 SFPIGIVLALGRQSDLPILKFFCITFIEFIRGVPLITILFMASVILPLFFHDGIDFDKLL 227

Query: 251 RALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGI 310
           RAL+G++ F SAYIAEV+RGGLQ+I KGQ+EAA SLGLSY + M LII+PQ +K  IP +
Sbjct: 228 RALIGITLFQSAYIAEVIRGGLQAIPKGQYEAAKSLGLSYWKGMLLIILPQALKISIPNL 287

Query: 311 VNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSIS 370
           V +FI LFKD++L+ II +FD+L +V +  S+S W+       G +F+  ++WIFCFS+S
Sbjct: 288 VGSFISLFKDTTLVLIIGLFDVLAMVTLTNSDSDWLG--YEIEGYVFVTMIYWIFCFSMS 345

Query: 371 LYSVFIEKTLH 381
            YS  IE+  +
Sbjct: 346 QYSKHIEQKFN 356


>gi|325498848|gb|EGC96707.1| amino-acid transporter subunit ; membrane component of ABC
           superfamily [Escherichia fergusonii ECD227]
          Length = 347

 Score =  310 bits (795), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 162/356 (45%), Positives = 229/356 (64%), Gaps = 14/356 (3%)

Query: 29  IAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQP 88
           + W+ KN F +  + LLT   + L+   IP +++W FL A W+GS R  CT         
Sbjct: 1   MVWVRKNLFSSWSNSLLTIGCLWLMWELIPPLLNWAFLQANWVGSTRADCTKA------- 53

Query: 89  DGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILL 148
                ACW FI++R+ QF++G YP  QRWR  L  L G + + PM     P +     + 
Sbjct: 54  ----GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPMFWKILPHRGRYIAVW 109

Query: 149 FGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIP 207
             ++P+  ++++YGG LGL  VET  WGGL +TL+I+  GI  ++P GILLALGR S++P
Sbjct: 110 AVIYPLIVWWLMYGGFLGLERVETRQWGGLTLTLIIASVGIAGALPWGILLALGRRSHMP 169

Query: 208 VLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEV 267
           ++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV  F SAY+AEV
Sbjct: 170 IVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVGVILFQSAYVAEV 229

Query: 268 LRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISII 327
           +RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I LFKD+SL+ II
Sbjct: 230 VRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTIIALFKDTSLVIII 289

Query: 328 NMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKG 383
            +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  +EK  + G
Sbjct: 290 GLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQHLEKRFNTG 343


>gi|300718664|ref|YP_003743467.1| L-amino acid ABC transporter, permease protein [Erwinia billingiae
           Eb661]
 gi|299064500|emb|CAX61620.1| L-amino acid ABC transporter, permease protein [Erwinia billingiae
           Eb661]
          Length = 366

 Score =  310 bits (795), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 167/367 (45%), Positives = 231/367 (62%), Gaps = 14/367 (3%)

Query: 18  PSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTV 77
           P +P       ++W  KN F +  + LLT   I ++   IP  ++W+   A WIG+ R  
Sbjct: 9   PPVPTNAFSRTVSWARKNLFSSWGNSLLTLFCIWVIWTVIPPALNWLVFQANWIGTTRAD 68

Query: 78  CTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPS 137
           CT            + ACW FI+ R+ QF++G YP   RWR  L  + G + + PM + S
Sbjct: 69  CTK-----------DGACWVFIHARFGQFMYGLYPHELRWRINLALVIGLLSILPMFLKS 117

Query: 138 FPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPLGI 196
            PR+ L   +   ++PI  + +LYGG  GL  VET  WGGL +TL+I+  GI  ++PLGI
Sbjct: 118 MPRRGLYIAVWAVVYPIAVWVLLYGGFFGLERVETRQWGGLTLTLIIASIGIAGALPLGI 177

Query: 197 LLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGV 256
           LLAL R S++PV+R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV
Sbjct: 178 LLALARRSSMPVVRALSVIFIEFWRGVPLITVLFMSSVMLPLFMSEGNSIDKLIRALVGV 237

Query: 257 SAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIG 316
             F SAY+AEV+RGGLQ++ KGQ EAA SL L Y +   L+I+PQ +K VIPG+VNT I 
Sbjct: 238 ILFQSAYVAEVVRGGLQALPKGQTEAAESLALGYWKTQGLVILPQALKLVIPGLVNTIIA 297

Query: 317 LFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFI 376
           LFKD+SL+ II +FDL   V+    +  W+     T G +F   V+WIFCFS+S YS ++
Sbjct: 298 LFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALVYWIFCFSMSRYSQYL 355

Query: 377 EKTLHKG 383
           EK  H G
Sbjct: 356 EKRFHTG 362


>gi|324115126|gb|EGC09090.1| inner membrane transport system [Escherichia fergusonii B253]
          Length = 367

 Score =  310 bits (795), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 165/371 (44%), Positives = 232/371 (62%), Gaps = 15/371 (4%)

Query: 15  LLQPSLPPVYQRG-IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGS 73
           L  P  P  +     + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS
Sbjct: 6   LSHPPRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGS 65

Query: 74  NRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPM 133
            R  CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM
Sbjct: 66  TRADCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIVPM 114

Query: 134 LIPSFPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISM 192
                P +     +   ++P+  ++++YGG LGL  VET  WGGL +TL+I+  GI  ++
Sbjct: 115 FWKILPHRGRYIAVWAVIYPLIVWWLMYGGFLGLERVETRQWGGLTLTLIIASVGIAGAL 174

Query: 193 PLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRA 252
           P GILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RA
Sbjct: 175 PWGILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRA 234

Query: 253 LLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVN 312
           L+GV  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VN
Sbjct: 235 LVGVILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVN 294

Query: 313 TFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLY 372
           T I LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S Y
Sbjct: 295 TIIALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRY 352

Query: 373 SVFIEKTLHKG 383
           S  +E   + G
Sbjct: 353 SQHLENRFNTG 363


>gi|292486752|ref|YP_003529622.1| putative ABC transporter inner membrane protein [Erwinia amylovora
           CFBP1430]
 gi|292900846|ref|YP_003540215.1| ABC transporter permease [Erwinia amylovora ATCC 49946]
 gi|291200694|emb|CBJ47827.1| ABC transporter, permease protein [Erwinia amylovora ATCC 49946]
 gi|291552169|emb|CBA19206.1| putative ABC transport system, inner membrane component [Erwinia
           amylovora CFBP1430]
          Length = 368

 Score =  310 bits (794), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 161/356 (45%), Positives = 224/356 (62%), Gaps = 14/356 (3%)

Query: 29  IAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQP 88
           +AW  KN F +    LLT   + ++  +IP  ++W+   A W G  R  C+         
Sbjct: 22  VAWARKNLFSSVGSSLLTLFCLWIMWETIPPALNWLIFKANWTGDTRADCSK-------- 73

Query: 89  DGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILL 148
                ACW FI+ R+ Q ++G YP   RWR  L  + G + + PM + S PR+    +  
Sbjct: 74  ---EGACWVFIHARFGQLMYGLYPHELRWRINLALVIGLLSVIPMFVKSLPRRGSYIVGW 130

Query: 149 FGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIP 207
             ++P+  + ++YGG LGL  VET  WGGL +TL+I+  GI  ++P GILLALGR S +P
Sbjct: 131 AVVYPLLVWLLMYGGWLGLERVETRQWGGLTLTLIIAAVGIAGALPTGILLALGRRSQMP 190

Query: 208 VLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEV 267
           V+R  CI FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV  F SAY+AEV
Sbjct: 191 VVRTLCILFIEFWRGVPLITVLFMSSVMLPLFMAEGSSIDKLIRALVGVILFQSAYVAEV 250

Query: 268 LRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISII 327
           +RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I LFKD+SL+ II
Sbjct: 251 VRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTIIALFKDTSLVIII 310

Query: 328 NMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKG 383
            +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  +EK  H G
Sbjct: 311 GLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQHLEKRFHTG 364


>gi|293416695|ref|ZP_06659334.1| inner membrane amino-acid ABC transporter permease yhdY
           [Escherichia coli B185]
 gi|331654869|ref|ZP_08355869.1| inner membrane amino-acid ABC transporter permease protein YhdY
           [Escherichia coli M718]
 gi|291432051|gb|EFF05034.1| inner membrane amino-acid ABC transporter permease yhdY
           [Escherichia coli B185]
 gi|331048251|gb|EGI20328.1| inner membrane amino-acid ABC transporter permease protein YhdY
           [Escherichia coli M718]
          Length = 367

 Score =  310 bits (794), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 165/371 (44%), Positives = 231/371 (62%), Gaps = 15/371 (4%)

Query: 15  LLQPSLPPVYQRG-IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGS 73
           L  PS P  +     + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS
Sbjct: 6   LSHPSRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGS 65

Query: 74  NRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPM 133
            R  CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM
Sbjct: 66  TRADCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPM 114

Query: 134 LIPSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISM 192
                P +         ++P+  ++++YGG   L  VET  WGGL +TL+I+  GI  ++
Sbjct: 115 FWKILPHRGRYIAAWAVIYPLIVWWLMYGGFFALERVETRQWGGLTLTLIIASVGIAGAL 174

Query: 193 PLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRA 252
           P GILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RA
Sbjct: 175 PWGILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRA 234

Query: 253 LLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVN 312
           L+GV  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VN
Sbjct: 235 LVGVILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVN 294

Query: 313 TFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLY 372
           T I LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S Y
Sbjct: 295 TIIALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRY 352

Query: 373 SVFIEKTLHKG 383
           S  +EK  + G
Sbjct: 353 SQHLEKRFNTG 363


>gi|327395463|dbj|BAK12885.1| inner membrane amino-acid ABC transporter permease protein YhdY
           [Pantoea ananatis AJ13355]
          Length = 366

 Score =  310 bits (794), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 166/357 (46%), Positives = 221/357 (61%), Gaps = 14/357 (3%)

Query: 31  WIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDG 90
           W  KN F    +  LT L I L+   IP  ++W+  DA W G+ R  CT           
Sbjct: 22  WARKNLFSGWFNTFLTLLCIWLIWHVIPPALNWLIFDANWFGTTRADCTK---------- 71

Query: 91  WNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFG 150
              ACW FI+ R+ QF++G YP   RWR  L  + G   + PM I   P +         
Sbjct: 72  -EGACWVFIHARFGQFMYGLYPHELRWRINLALVIGLASIVPMFIKRLPYRGRYIAAWAV 130

Query: 151 LFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVL 209
            +P+  +F+LYGG LGL  VET  WGGL +TL+I+  GI  ++PLGILLALGR S +PV+
Sbjct: 131 CYPLVVWFLLYGGFLGLDRVETRQWGGLTLTLIIASVGIAGALPLGILLALGRRSRMPVV 190

Query: 210 RYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLR 269
           R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV  F SAY+AEV+R
Sbjct: 191 RTLSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTTIDKLVRALVGVILFQSAYVAEVVR 250

Query: 270 GGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINM 329
           GGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K  IPG+VNT I LFKD+SL+ II +
Sbjct: 251 GGLQALPKGQYEAAESLALGYWKTQMLVILPQALKLTIPGLVNTIIALFKDTSLVIIIGL 310

Query: 330 FDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
           FDL   V+    +  W+     T G +F   V+WIFCFS+S YS ++EK  H G K 
Sbjct: 311 FDLFSSVQQATVDPAWLG--MSTEGYVFAALVYWIFCFSMSRYSQYLEKRFHTGRKS 365


>gi|291619133|ref|YP_003521875.1| YhdY [Pantoea ananatis LMG 20103]
 gi|291154163|gb|ADD78747.1| YhdY [Pantoea ananatis LMG 20103]
          Length = 366

 Score =  310 bits (793), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 166/357 (46%), Positives = 221/357 (61%), Gaps = 14/357 (3%)

Query: 31  WIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDG 90
           W  KN F    +  LT L I L+   IP  ++W+  DA W G+ R  CT           
Sbjct: 22  WARKNLFSGWFNTCLTLLCIWLIWHVIPPALNWLIFDANWFGTTRADCTK---------- 71

Query: 91  WNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFG 150
              ACW FI+ R+ QF++G YP   RWR  L  + G   + PM I   P +         
Sbjct: 72  -EGACWVFIHARFGQFMYGLYPHELRWRINLALVIGLASIVPMFIKRLPYRGRYIAAWAV 130

Query: 151 LFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVL 209
            +P+  +F+LYGG LGL  VET  WGGL +TL+I+  GI  ++PLGILLALGR S +PV+
Sbjct: 131 CYPLVVWFLLYGGFLGLDRVETRQWGGLTLTLIIASVGIAGALPLGILLALGRRSRMPVV 190

Query: 210 RYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLR 269
           R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV  F SAY+AEV+R
Sbjct: 191 RTLSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTTIDKLVRALVGVILFQSAYVAEVVR 250

Query: 270 GGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINM 329
           GGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K  IPG+VNT I LFKD+SL+ II +
Sbjct: 251 GGLQALPKGQYEAAESLALGYWKTQMLVILPQALKLTIPGLVNTIIALFKDTSLVIIIGL 310

Query: 330 FDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
           FDL   V+    +  W+     T G +F   V+WIFCFS+S YS ++EK  H G K 
Sbjct: 311 FDLFSSVQQATVDPAWLG--MSTEGYVFAALVYWIFCFSMSRYSQYLEKRFHTGRKS 365


>gi|312170820|emb|CBX79080.1| putative ABC transport system, inner membrane component [Erwinia
           amylovora ATCC BAA-2158]
          Length = 368

 Score =  310 bits (793), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 160/356 (44%), Positives = 224/356 (62%), Gaps = 14/356 (3%)

Query: 29  IAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQP 88
           +AW  KN F +    LLT   + ++  +IP  ++W+   A W G  R  C+         
Sbjct: 22  VAWARKNLFSSVGSSLLTLFCLWIMWETIPPALNWLIFKANWTGDTRADCSK-------- 73

Query: 89  DGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILL 148
                ACW FI+ R+ Q ++G YP   RWR  L  + G + + PM + S PR+    +  
Sbjct: 74  ---EGACWVFIHARFGQLMYGLYPHELRWRINLALVIGLLSVIPMFVKSLPRRGSYIVGW 130

Query: 149 FGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIP 207
             ++P+  + ++YGG LGL  VET  WGGL +TL+I+  GI  ++P GILLALGR S +P
Sbjct: 131 AVVYPLLVWLLMYGGWLGLERVETRQWGGLTLTLIIAAVGIAGALPTGILLALGRRSQMP 190

Query: 208 VLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEV 267
           V+R  C+ FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV  F SAY+AEV
Sbjct: 191 VVRTLCVLFIEFWRGVPLITVLFMSSVMLPLFMAEGSSIDKLIRALVGVILFQSAYVAEV 250

Query: 268 LRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISII 327
           +RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I LFKD+SL+ II
Sbjct: 251 VRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTIIALFKDTSLVIII 310

Query: 328 NMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKG 383
            +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  +EK  H G
Sbjct: 311 GLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQHLEKRFHTG 364


>gi|606211|gb|AAA58074.1| ORF_o368b [Escherichia coli str. K-12 substr. MG1655]
 gi|315617080|gb|EFU97690.1| general L-amino acid transport system permease protein aapM
           [Escherichia coli 3431]
          Length = 368

 Score =  309 bits (792), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 164/371 (44%), Positives = 231/371 (62%), Gaps = 15/371 (4%)

Query: 15  LLQPSLPPVYQRG-IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGS 73
           L  P  P  +     + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS
Sbjct: 7   LSHPPRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGS 66

Query: 74  NRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPM 133
            R  CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM
Sbjct: 67  TRADCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPM 115

Query: 134 LIPSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISM 192
                P +         ++P+  ++++YGG   L  VET  WGGL +TL+I+  GI  ++
Sbjct: 116 FWKILPHRGRYIAAWAVIYPLIVWWLMYGGFFALERVETRQWGGLTLTLIIASVGIAGAL 175

Query: 193 PLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRA 252
           P GILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RA
Sbjct: 176 PWGILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRA 235

Query: 253 LLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVN 312
           L+GV  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VN
Sbjct: 236 LVGVILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVN 295

Query: 313 TFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLY 372
           T I LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S Y
Sbjct: 296 TIIALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRY 353

Query: 373 SVFIEKTLHKG 383
           S ++EK  + G
Sbjct: 354 SQYLEKRFNTG 364


>gi|89110030|ref|AP_003810.1| predicted amino-acid transporter subunit [Escherichia coli str.
           K-12 substr. W3110]
 gi|90111567|ref|NP_417736.2| predicted amino-acid transporter subunit [Escherichia coli str.
           K-12 substr. MG1655]
 gi|170082798|ref|YP_001732118.1| amino-acid ABC transporter membrane protein [Escherichia coli str.
           K-12 substr. DH10B]
 gi|188494363|ref|ZP_03001633.1| amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine
           family [Escherichia coli 53638]
 gi|238902368|ref|YP_002928164.1| putative amino-acid transporter subunit [Escherichia coli BW2952]
 gi|254038436|ref|ZP_04872494.1| inner membrane amino-acid ABC transporter permease yhdY
           [Escherichia sp. 1_1_43]
 gi|256024156|ref|ZP_05438021.1| putative amino-acid transporter subunit [Escherichia sp. 4_1_40B]
 gi|307139958|ref|ZP_07499314.1| putative amino-acid transporter subunit [Escherichia coli H736]
 gi|331643970|ref|ZP_08345101.1| inner membrane amino-acid ABC transporter permease protein YhdY
           [Escherichia coli H736]
 gi|3916018|sp|P45768|YHDY_ECOLI RecName: Full=Inner membrane amino-acid ABC transporter permease
           protein yhdY
 gi|85676061|dbj|BAE77311.1| predicted amino-acid transporter subunit [Escherichia coli str. K12
           substr. W3110]
 gi|87082239|gb|AAC76302.2| predicted amino-acid transporter subunit [Escherichia coli str.
           K-12 substr. MG1655]
 gi|169890633|gb|ACB04340.1| predicted amino-acid transporter subunit; membrane component of ABC
           superfamily [Escherichia coli str. K-12 substr. DH10B]
 gi|188489562|gb|EDU64665.1| amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine
           family [Escherichia coli 53638]
 gi|226840060|gb|EEH72081.1| inner membrane amino-acid ABC transporter permease yhdY
           [Escherichia sp. 1_1_43]
 gi|238862153|gb|ACR64151.1| predicted amino-acid transporter subunit [Escherichia coli BW2952]
 gi|260447704|gb|ACX38126.1| polar amino acid ABC transporter, inner membrane subunit
           [Escherichia coli DH1]
 gi|309703689|emb|CBJ03030.1| ABC transporter, permease protein [Escherichia coli ETEC H10407]
 gi|315137853|dbj|BAJ45012.1| putative amino-acid transporter subunit [Escherichia coli DH1]
 gi|323936246|gb|EGB32538.1| inner membrane transport system [Escherichia coli E1520]
 gi|331037441|gb|EGI09665.1| inner membrane amino-acid ABC transporter permease protein YhdY
           [Escherichia coli H736]
          Length = 367

 Score =  309 bits (792), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 164/371 (44%), Positives = 231/371 (62%), Gaps = 15/371 (4%)

Query: 15  LLQPSLPPVYQRG-IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGS 73
           L  P  P  +     + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS
Sbjct: 6   LSHPPRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGS 65

Query: 74  NRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPM 133
            R  CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM
Sbjct: 66  TRADCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPM 114

Query: 134 LIPSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISM 192
                P +         ++P+  ++++YGG   L  VET  WGGL +TL+I+  GI  ++
Sbjct: 115 FWKILPHRGRYIAAWAVIYPLIVWWLMYGGFFALERVETRQWGGLTLTLIIASVGIAGAL 174

Query: 193 PLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRA 252
           P GILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RA
Sbjct: 175 PWGILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRA 234

Query: 253 LLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVN 312
           L+GV  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VN
Sbjct: 235 LVGVILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVN 294

Query: 313 TFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLY 372
           T I LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S Y
Sbjct: 295 TIIALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRY 352

Query: 373 SVFIEKTLHKG 383
           S ++EK  + G
Sbjct: 353 SQYLEKRFNTG 363


>gi|296104985|ref|YP_003615131.1| general L-amino acid transport system permease protein
           [Enterobacter cloacae subsp. cloacae ATCC 13047]
 gi|295059444|gb|ADF64182.1| general L-amino acid transport system permease protein
           [Enterobacter cloacae subsp. cloacae ATCC 13047]
          Length = 367

 Score =  309 bits (791), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 170/374 (45%), Positives = 232/374 (62%), Gaps = 16/374 (4%)

Query: 13  KRLLQPSLPPVYQRG--IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVW 70
           K +L  S  P    G   I W  KN F +  + LLT + + L+   IP +I+W FL A W
Sbjct: 3   KAILSHSSRPANPTGGRFILWARKNLFSSWGNSLLTIICLWLMWELIPPLINWAFLQANW 62

Query: 71  IGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILL 130
           +GS R  CT              ACW FI++R+ QF++G YP  QRWR  L  + G + +
Sbjct: 63  VGSTRADCTKA-----------GACWVFIHERFGQFMYGLYPHEQRWRINLALVIGLLSI 111

Query: 131 TPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGII 189
             M     P++         ++PI  + +LYGG LGL  VET  WGGL +TL+I+  GI 
Sbjct: 112 AVMFWKRLPQRGQYIACWAVVYPIVVWVLLYGGFLGLERVETRQWGGLTLTLIIASVGIA 171

Query: 190 ISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKL 249
            ++P GILLALGR S +PV+R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL
Sbjct: 172 GALPWGILLALGRRSKMPVVRVLSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTTIDKL 231

Query: 250 LRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPG 309
           +RAL+GV  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG
Sbjct: 232 IRALVGVILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPG 291

Query: 310 IVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSI 369
           +VNT I LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+
Sbjct: 292 LVNTIIALFKDTSLVIIIGLFDLFSSVQQATVDPVWLG--MSTEGYVFAALIYWIFCFSM 349

Query: 370 SLYSVFIEKTLHKG 383
           S YS  +EK  + G
Sbjct: 350 SRYSQHLEKRFNTG 363


>gi|300946950|ref|ZP_07161181.1| ABC transporter, permease protein [Escherichia coli MS 116-1]
 gi|300958248|ref|ZP_07170395.1| ABC transporter, permease protein [Escherichia coli MS 175-1]
 gi|300315066|gb|EFJ64850.1| ABC transporter, permease protein [Escherichia coli MS 175-1]
 gi|300453410|gb|EFK17030.1| ABC transporter, permease protein [Escherichia coli MS 116-1]
          Length = 347

 Score =  309 bits (791), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 161/356 (45%), Positives = 227/356 (63%), Gaps = 14/356 (3%)

Query: 29  IAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQP 88
           + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS R  CT         
Sbjct: 1   MVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRADCTKA------- 53

Query: 89  DGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILL 148
                ACW FI++R+ QF++G YP  QRWR  L  L G + + PM     P +       
Sbjct: 54  ----GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPMFWKILPHRGRYIAAW 109

Query: 149 FGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIP 207
             ++P+  ++++YGG   L  VET  WGGL +TL+I+  GI  ++P GILLALGR S++P
Sbjct: 110 AVIYPLIVWWLMYGGFFALERVETRQWGGLTLTLIIASVGIAGALPWGILLALGRRSHMP 169

Query: 208 VLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEV 267
           ++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV  F SAY+AEV
Sbjct: 170 IVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVGVILFQSAYVAEV 229

Query: 268 LRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISII 327
           +RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I LFKD+SL+ II
Sbjct: 230 VRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTIIALFKDTSLVIII 289

Query: 328 NMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKG 383
            +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS ++EK  + G
Sbjct: 290 GLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQYLEKRFNTG 343


>gi|327479740|gb|AEA83050.1| polar amino acid ABC transporter, inner membrane subunit
           [Pseudomonas stutzeri DSM 4166]
          Length = 365

 Score =  308 bits (789), Expect = 9e-82,   Method: Compositional matrix adjust.
 Identities = 165/372 (44%), Positives = 234/372 (62%), Gaps = 15/372 (4%)

Query: 17  QPSLPP-VYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNR 75
           +P LPP     G + W+  N F +  + LLT + + LL   +P ++ W    A W G  R
Sbjct: 7   KPDLPPPTISIGALGWLRANLFSSWINTLLTLVGLYLLWLIVPPVLEWAIFKADWTGDTR 66

Query: 76  TVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLI 135
             C+              ACW F+  R+ QF++G YP   RWR         I   P+ +
Sbjct: 67  ADCSR-----------EGACWVFVQVRFGQFMYGFYPTELRWRVDAAAWLAIIGAAPLFL 115

Query: 136 PSFPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISMPL 194
              P K    I    ++P+ ++++L+GG LGL  V TS WGGL++T+VI+  GI  ++PL
Sbjct: 116 RQMPHKLRYGIGYLLVYPLLAYWLLHGGFLGLQTVPTSQWGGLMLTVVIAAVGIAGALPL 175

Query: 195 GILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALL 254
           GILLALGR S++P +R  C+TFIE +RGVPL+TVLFM+S+MLPLFLP+  ++DKLLRA+L
Sbjct: 176 GILLALGRRSDMPAIRVLCVTFIEFWRGVPLITVLFMSSVMLPLFLPEGMNLDKLLRAML 235

Query: 255 GVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTF 314
            V  F +AYIAEV+RGGLQ+I KGQ+EAA ++GL Y +   L+I+PQ +K VIPGIVNTF
Sbjct: 236 MVVFFEAAYIAEVVRGGLQAIPKGQYEAAAAMGLGYWRSTLLVILPQALKLVIPGIVNTF 295

Query: 315 IGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSV 374
           I LFKD+SL+ II +FD L  ++   ++  W+     T G +F   V+W+FCF +S YS+
Sbjct: 296 IALFKDTSLVIIIGLFDFLNSIKRATADPAWLG--MSTEGYVFAALVYWMFCFGMSRYSM 353

Query: 375 FIEKTLHKGSKK 386
            +E+ L  G K+
Sbjct: 354 RLERKLDTGHKR 365


>gi|170018487|ref|YP_001723441.1| polar amino acid ABC transporter, inner membrane subunit
           [Escherichia coli ATCC 8739]
 gi|194440026|ref|ZP_03072083.1| amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine
           family [Escherichia coli 101-1]
 gi|253771899|ref|YP_003034730.1| polar amino acid ABC transporter inner membrane subunit
           [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|254163205|ref|YP_003046313.1| putative amino-acid transporter subunit [Escherichia coli B str.
           REL606]
 gi|169753415|gb|ACA76114.1| polar amino acid ABC transporter, inner membrane subunit
           [Escherichia coli ATCC 8739]
 gi|194421030|gb|EDX37060.1| amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine
           family [Escherichia coli 101-1]
 gi|242378804|emb|CAQ33596.1| yhdY, subunit of YhdW/YhdX/YhdY/YhdZ ABC transporter [Escherichia
           coli BL21(DE3)]
 gi|253322943|gb|ACT27545.1| polar amino acid ABC transporter, inner membrane subunit
           [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|253975106|gb|ACT40777.1| predicted amino-acid transporter subunit [Escherichia coli B str.
           REL606]
 gi|253979262|gb|ACT44932.1| predicted amino-acid transporter subunit [Escherichia coli
           BL21(DE3)]
 gi|323941637|gb|EGB37816.1| inner membrane transport system [Escherichia coli E482]
 gi|323970315|gb|EGB65585.1| inner membrane transport system [Escherichia coli TA007]
          Length = 367

 Score =  308 bits (789), Expect = 9e-82,   Method: Compositional matrix adjust.
 Identities = 164/371 (44%), Positives = 230/371 (61%), Gaps = 15/371 (4%)

Query: 15  LLQPSLPPVYQRG-IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGS 73
           L  P  P  +     + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS
Sbjct: 6   LSHPPRPASHNSNRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGS 65

Query: 74  NRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPM 133
            R  CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM
Sbjct: 66  TRADCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPM 114

Query: 134 LIPSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISM 192
                P +         ++P+  ++++YGG   L  VET  WGGL +TL+I+  GI  ++
Sbjct: 115 FWKILPHRGRYIAAWAVIYPLIVWWLMYGGFFALERVETRQWGGLTLTLIIASVGIAGAL 174

Query: 193 PLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRA 252
           P GILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RA
Sbjct: 175 PWGILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRA 234

Query: 253 LLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVN 312
           L+GV  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VN
Sbjct: 235 LVGVILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVN 294

Query: 313 TFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLY 372
           T I LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S Y
Sbjct: 295 TIIALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRY 352

Query: 373 SVFIEKTLHKG 383
           S  +EK  + G
Sbjct: 353 SQHLEKRFNTG 363


>gi|33596742|ref|NP_884385.1| ABC transporter transmembrane protein [Bordetella parapertussis
           12822]
 gi|33600510|ref|NP_888070.1| ABC transporter transmembrane protein [Bordetella bronchiseptica
           RB50]
 gi|33568109|emb|CAE32022.1| Putative ABC transport system, integral membrane protein
           [Bordetella bronchiseptica RB50]
 gi|33573443|emb|CAE37428.1| Putative ABC transport system, integral membrane protein
           [Bordetella parapertussis]
          Length = 384

 Score =  308 bits (789), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 166/388 (42%), Positives = 243/388 (62%), Gaps = 11/388 (2%)

Query: 3   DSCKEFPYVRKRLLQPSLPPVYQRGII-AWIHKNFFGTPKDILLTALIICLLLFSIPGII 61
            + K+  +V+ + +Q   PP +Q G   AW+ +  F +P+   LT     +L + + G++
Sbjct: 4   STTKQPAFVQAQAVQ-ERPPPHQAGTAWAWVRQYVFESPRTFALTLACAAILYWVLRGLL 62

Query: 62  HWVFLDAVWIGSNRTVC-TTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPI 120
            ++ LDA W G     C  +++QG         ACW FI  +   F+FG YP  QRWR +
Sbjct: 63  DFLVLDATWSGGAVQACQASIAQGRY------GACWPFIDAKLGYFVFGGYPPPQRWRVV 116

Query: 121 LVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGG--LGLSIVETSLWGGLL 178
           L F+  +  +  +L      K + +   F + P  S+ +L G   LGL  V T LWGG+L
Sbjct: 117 LFFVLAAAGIVWLLARRIRAKRVGAAYFFVVLPPLSYALLVGADALGLPHVSTDLWGGIL 176

Query: 179 VTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPL 238
           VTLV+S  GI+ S+P+GI+LALGR S +P +R A    IEL RGVPL+TVLFM + MLPL
Sbjct: 177 VTLVVSLVGIVFSLPIGIVLALGRRSELPFVRLASTVAIELGRGVPLITVLFMFNTMLPL 236

Query: 239 FLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLII 298
           FLP+    D+LLR L+GV+ FASAY+AEV+RGGLQ++ KGQ+E A SLGL Y Q   LI+
Sbjct: 237 FLPEGLRPDRLLRPLVGVTLFASAYMAEVVRGGLQALPKGQYEGAQSLGLGYWQTTFLIV 296

Query: 299 MPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFI 358
           +PQ ++ V+PGIVNTFIGLFKD++L++++ + DLL +V V  ++  W + VT  TG  F+
Sbjct: 297 LPQALRIVVPGIVNTFIGLFKDTTLVAMVGILDLLKVVEVAINDPAWATPVTRYTGYAFL 356

Query: 359 GFVFWIFCFSISLYSVFIEKTLHKGSKK 386
            F +   C+++S YS  +E+TL +  K+
Sbjct: 357 AFFYCACCYAMSRYSRSVERTLARSEKR 384


>gi|300916767|ref|ZP_07133477.1| ABC transporter, permease protein [Escherichia coli MS 115-1]
 gi|300415953|gb|EFJ99263.1| ABC transporter, permease protein [Escherichia coli MS 115-1]
          Length = 347

 Score =  308 bits (788), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 161/356 (45%), Positives = 226/356 (63%), Gaps = 14/356 (3%)

Query: 29  IAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQP 88
           + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS R  CT         
Sbjct: 1   MVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRADCTKA------- 53

Query: 89  DGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILL 148
                ACW FI+ R+ QF++G YP  QRWR  L  L G + + PM     P +       
Sbjct: 54  ----GACWVFIHKRFGQFMYGLYPHDQRWRINLALLIGLVSIAPMFWKILPHRGRYIAAW 109

Query: 149 FGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIP 207
             ++P+  ++++YGG   L  VET  WGGL +TL+I+  GI  ++P GILLALGR S++P
Sbjct: 110 AVIYPLIVWWLMYGGFFALERVETRQWGGLTLTLIIASVGIAGALPWGILLALGRRSHMP 169

Query: 208 VLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEV 267
           ++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV  F SAY+AEV
Sbjct: 170 IVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVGVILFQSAYVAEV 229

Query: 268 LRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISII 327
           +RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I LFKD+SL+ II
Sbjct: 230 VRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTIIALFKDTSLVIII 289

Query: 328 NMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKG 383
            +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS ++EK  + G
Sbjct: 290 GLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQYLEKRFNTG 343


>gi|300928694|ref|ZP_07144212.1| ABC transporter, permease protein [Escherichia coli MS 187-1]
 gi|300463283|gb|EFK26776.1| ABC transporter, permease protein [Escherichia coli MS 187-1]
          Length = 347

 Score =  308 bits (788), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 161/356 (45%), Positives = 226/356 (63%), Gaps = 14/356 (3%)

Query: 29  IAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQP 88
           + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS R  CT         
Sbjct: 1   MVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRADCTKA------- 53

Query: 89  DGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILL 148
                ACW FI++R+ QF++G YP  QRWR  L  L G + + PM     P +       
Sbjct: 54  ----GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPMFWKILPHRGRYIAAW 109

Query: 149 FGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIP 207
             ++P+  ++++YGG   L  VET  WGGL +TL+I+  GI  ++P GILLALGR S++P
Sbjct: 110 AVIYPLIVWWLMYGGFFALERVETRQWGGLTLTLIIASVGIAGALPWGILLALGRRSHMP 169

Query: 208 VLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEV 267
           ++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV  F SAY+AEV
Sbjct: 170 IVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVGVILFQSAYVAEV 229

Query: 268 LRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISII 327
           +RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I LFKD+SL+ II
Sbjct: 230 VRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTIIALFKDTSLVIII 289

Query: 328 NMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKG 383
            +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  +EK  + G
Sbjct: 290 GLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQHLEKRFNTG 343


>gi|156935790|ref|YP_001439706.1| hypothetical protein ESA_03661 [Cronobacter sakazakii ATCC BAA-894]
 gi|156534044|gb|ABU78870.1| hypothetical protein ESA_03661 [Cronobacter sakazakii ATCC BAA-894]
          Length = 344

 Score =  308 bits (788), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 161/353 (45%), Positives = 225/353 (63%), Gaps = 14/353 (3%)

Query: 32  IHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGW 91
           + KN F +  + LLT   + ++   IP +++W FL A W+GS R  CT            
Sbjct: 1   MRKNLFSSWINSLLTLFCLWMMWELIPPLLNWAFLQANWVGSTRADCTK----------- 49

Query: 92  NAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFGL 151
             ACW FI+ R+ QF++G YP  +RWR  L  + G + + PM     P++          
Sbjct: 50  EGACWVFIHARFGQFMYGLYPHDERWRINLALIVGLVSIVPMFWKGLPQRGRYITCWAIA 109

Query: 152 FPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLR 210
           +P+  ++++YGG LGL  VET  WGGL +TL+I+  GI  ++PLGILLALGR S +PV+R
Sbjct: 110 YPLVVWWLMYGGFLGLERVETRQWGGLTLTLIIASVGIAGALPLGILLALGRRSRMPVVR 169

Query: 211 YACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRG 270
              + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV  F SAY+AEV+RG
Sbjct: 170 VLSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVGVILFQSAYVAEVVRG 229

Query: 271 GLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMF 330
           GLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I LFKD+SL+ II +F
Sbjct: 230 GLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTIIALFKDTSLVIIIGLF 289

Query: 331 DLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKG 383
           DL   V+    +  W+     T G +F   ++WIFCFS+S YS  +EK  H G
Sbjct: 290 DLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQHLEKRFHTG 340


>gi|83595861|gb|ABC25223.1| general amino acid ABC transporter, permease protein [uncultured
           marine bacterium Ant4D3]
          Length = 369

 Score =  307 bits (787), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 169/372 (45%), Positives = 238/372 (63%), Gaps = 17/372 (4%)

Query: 17  QPSLPPVYQR-GIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNR 75
            PSLPP     G+I W+ +N F +  + ++T + I LL  ++P  I+W+F+DA ++G+ R
Sbjct: 13  HPSLPPPKNTVGVIYWLRENLFSSATNSIVTLVSIYLLYLALPSAINWLFIDATYVGTTR 72

Query: 76  TVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLI 135
             C         PDG   AC AFI +R+  F++G YP   RWR  L  L   +    +L 
Sbjct: 73  KDCA--------PDG---ACLAFIGERFNLFVYGFYPAELRWRVNLATLLLVVAGAAVLW 121

Query: 136 PSFPRKFLNSILLFGL-FPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPL 194
              P +    +L F + +P    ++L GG GL  V T L+GGL++TL I   GI+ S+PL
Sbjct: 122 DKIPAR--KHMLKFAMVYPFIGAWLLTGGFGLESVGTHLFGGLMLTLTIGVTGIVFSLPL 179

Query: 195 GILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALL 254
           GILLALGR SN+P+++Y CI FIE  RGVPL+T+LF+AS ML  FLP     D L+R L+
Sbjct: 180 GILLALGRQSNLPIIKYFCIGFIEFIRGVPLITLLFVASTMLSYFLPPGTTFDLLMRVLI 239

Query: 255 GVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTF 314
            V+ FASAY+AEV+RGGLQ++ KGQ EAA SLGL+Y Q MR II+PQ +K  IPGIVNTF
Sbjct: 240 MVTLFASAYMAEVIRGGLQALPKGQLEAAESLGLNYGQAMRFIILPQALKISIPGIVNTF 299

Query: 315 IGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSV 374
           IGL+KDS+L+ +I + D LGI R + ++S W+   T     +F+   F+I CF ++ YS+
Sbjct: 300 IGLYKDSTLVIVIGLLDPLGIGRASVADSDWLGLSTEV--YLFVAVFFFISCFGMARYSL 357

Query: 375 FIEKTLHKGSKK 386
           ++E  L+ G K+
Sbjct: 358 YLENKLNTGHKR 369


>gi|323178549|gb|EFZ64125.1| general L-amino acid transport system permease protein aapM
           [Escherichia coli 1180]
          Length = 347

 Score =  307 bits (786), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 162/356 (45%), Positives = 228/356 (64%), Gaps = 14/356 (3%)

Query: 29  IAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQP 88
           + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS R  CT         
Sbjct: 1   MVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRADCTKA------- 53

Query: 89  DGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILL 148
                ACW FI++R+ QF++G YP  QR R  L  L G + + PM     P +     + 
Sbjct: 54  ----GACWVFIHERFGQFMYGLYPHDQRRRINLALLIGLVSIAPMFWKILPHRGRYIAVW 109

Query: 149 FGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIP 207
             ++P+  ++++YGG  GL  VET  WGGL +TL+I+  GI  ++P GILLALGR S++P
Sbjct: 110 AVIYPLIVWWLMYGGFFGLERVETRQWGGLTLTLIIASVGIAGALPWGILLALGRRSHMP 169

Query: 208 VLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEV 267
           ++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV  F SAY+AEV
Sbjct: 170 IVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVGVILFQSAYVAEV 229

Query: 268 LRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISII 327
           +RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I LFKD+SL+ II
Sbjct: 230 VRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTIIALFKDTSLVIII 289

Query: 328 NMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKG 383
            +FDL   V+    + TW+     T G +F   ++WIFCFS+S YS  +EK  + G
Sbjct: 290 GLFDLFSSVQQATVDPTWLG--MSTEGYVFAALIYWIFCFSMSRYSQHLEKRFNTG 343


>gi|307129009|ref|YP_003881025.1| membrane protein of an ABC superfamily putative amino-acid
           transporter [Dickeya dadantii 3937]
 gi|306526538|gb|ADM96468.1| membrane component of an ABC superfamily predicted amino-acid
           transporter [Dickeya dadantii 3937]
          Length = 364

 Score =  307 bits (786), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 168/370 (45%), Positives = 236/370 (63%), Gaps = 15/370 (4%)

Query: 18  PSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTV 77
           PS P    R I+ W  +N F +  + +LT   + LL   IP +++W  L A WIGS R  
Sbjct: 8   PSNPTPINRAIV-WARRNLFSSITNSVLTLACLWLLWTLIPPLLNWAILKANWIGSTRAD 66

Query: 78  CTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPS 137
           CT+           + ACW FI+ R+EQF++G YP  + WR     +   I + PM   +
Sbjct: 67  CTS-----------DGACWVFIHARFEQFMYGLYPREELWRINFALVLALISILPMFWRN 115

Query: 138 FPRKFLNSILLFGLFPIFSFFVLYGGLG-LSIVETSLWGGLLVTLVISFFGIIISMPLGI 196
            P +     +   ++P+ ++++L+GG G L+ VET  WGGL +T++I+  GI  ++PLGI
Sbjct: 116 LPHRGRYIAVWCVIYPLIAWWLLFGGFGGLTRVETRQWGGLTLTIIIAAIGIAGALPLGI 175

Query: 197 LLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGV 256
           LLALGR SN+PVLR  C+ FIE +RGVPL+TVLFM+S+MLPLFL +  ++DKLLRAL+GV
Sbjct: 176 LLALGRRSNMPVLRALCVIFIEFWRGVPLITVLFMSSVMLPLFLTEGTNIDKLLRALVGV 235

Query: 257 SAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIG 316
             F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I 
Sbjct: 236 ILFQSAYVAEVVRGGLQALPKGQYEAAQSLALGYWRMQGLVILPQALKMVIPGLVNTIIA 295

Query: 317 LFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFI 376
           LFKD+SL+ II +FDL   ++    +  W+     T G +F   ++WIFCFS+S YS  +
Sbjct: 296 LFKDTSLVIIIGLFDLFSSIQQATVDPAWLG--MSTEGYVFAAILYWIFCFSMSRYSQHL 353

Query: 377 EKTLHKGSKK 386
           EK    G K 
Sbjct: 354 EKRFDTGRKS 363


>gi|251791417|ref|YP_003006138.1| polar amino acid ABC transporter inner membrane subunit [Dickeya
           zeae Ech1591]
 gi|247540038|gb|ACT08659.1| polar amino acid ABC transporter, inner membrane subunit [Dickeya
           zeae Ech1591]
          Length = 364

 Score =  307 bits (786), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 163/359 (45%), Positives = 234/359 (65%), Gaps = 14/359 (3%)

Query: 29  IAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQP 88
           I W  +N F +  + +LT + + LL   IP +++W  + A WIGS R+ CT+        
Sbjct: 18  ITWARRNLFSSISNSILTLVCLWLLWTLIPPLLNWAIIKASWIGSTRSDCTS-------- 69

Query: 89  DGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILL 148
              + ACW F++ R+EQF++G YP  + WR     +   I + PM   + PR+     + 
Sbjct: 70  ---DGACWVFVHARFEQFMYGLYPREELWRINFALVLALISILPMFWRNLPRRGRYIAIW 126

Query: 149 FGLFPIFSFFVLYGGLG-LSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIP 207
             ++P+ ++++L+GG G L+ VET  WGGL +T++I+  GI  ++PLGILLALGR SN+P
Sbjct: 127 CIVYPLIAWWLLFGGFGGLTRVETRQWGGLTLTIIIAAIGIAGALPLGILLALGRRSNMP 186

Query: 208 VLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEV 267
           VLR  C+ FIE +RGVPL+TVLFM+S+MLPLFL +  ++DKLLRAL+GV  F SAY+AEV
Sbjct: 187 VLRALCVIFIEFWRGVPLITVLFMSSVMLPLFLTEGTNIDKLLRALVGVILFQSAYVAEV 246

Query: 268 LRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISII 327
           +RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I LFKD+SL+ II
Sbjct: 247 VRGGLQALPKGQYEAAQSLALGYWRMQGLVILPQALKMVIPGLVNTIIALFKDTSLVIII 306

Query: 328 NMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
            +FDL   ++    +  W+     T G +F   ++WIFCFS+S YS  +EK    G K 
Sbjct: 307 GLFDLFSSIQQATVDPAWLG--MSTEGYVFAAIIYWIFCFSMSRYSQHLEKRFDTGHKS 363


>gi|301028302|ref|ZP_07191562.1| ABC transporter, permease protein [Escherichia coli MS 196-1]
 gi|299878645|gb|EFI86856.1| ABC transporter, permease protein [Escherichia coli MS 196-1]
          Length = 367

 Score =  306 bits (785), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 163/371 (43%), Positives = 230/371 (61%), Gaps = 15/371 (4%)

Query: 15  LLQPSLPPVYQRG-IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGS 73
           L  P  P  +     + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS
Sbjct: 6   LSHPPRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGS 65

Query: 74  NRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPM 133
            R  CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM
Sbjct: 66  TRADCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPM 114

Query: 134 LIPSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISM 192
                P +         ++P+  ++++YGG   L  VET  WGGL +TL+I+  GI  ++
Sbjct: 115 FWKILPHRGRYIAAWAVIYPLIVWWLMYGGFFALERVETRQWGGLTLTLIIASVGIAGAL 174

Query: 193 PLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRA 252
           P GILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RA
Sbjct: 175 PWGILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRA 234

Query: 253 LLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVN 312
           L+GV  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VN
Sbjct: 235 LVGVILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVN 294

Query: 313 TFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLY 372
           T I LFKD+SL+ II +FDL   V+    +  W+     T   +F   ++WIFCFS+S Y
Sbjct: 295 TIIALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEEYVFAALIYWIFCFSMSRY 352

Query: 373 SVFIEKTLHKG 383
           S ++EK  + G
Sbjct: 353 SQYLEKRFNTG 363


>gi|271498818|ref|YP_003331843.1| polar amino acid ABC transporter inner membrane subunit [Dickeya
           dadantii Ech586]
 gi|270342373|gb|ACZ75138.1| polar amino acid ABC transporter, inner membrane subunit [Dickeya
           dadantii Ech586]
          Length = 362

 Score =  306 bits (785), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 166/370 (44%), Positives = 235/370 (63%), Gaps = 15/370 (4%)

Query: 18  PSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTV 77
           PS P      I+ W  +N F    + +LT + + LL   IP +++W    A W+GS R  
Sbjct: 6   PSNPTPISNAIV-WARRNLFSNVTNSVLTLVCLWLLWTLIPPLLNWAIFKANWVGSTRAD 64

Query: 78  CTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPS 137
           CT+           + ACW F++ R+EQF++G YP  + WR     +   I + PM   +
Sbjct: 65  CTS-----------DGACWVFVHARFEQFMYGLYPREELWRINFALVLALISILPMFWRN 113

Query: 138 FPRKFLNSILLFGLFPIFSFFVLYGGLG-LSIVETSLWGGLLVTLVISFFGIIISMPLGI 196
            PR+     +   ++P+ ++++L+GG G LS VET  WGGL +T++I+  GI  ++PLGI
Sbjct: 114 LPRRGRYIAIWCVVYPLLAWWLLFGGFGGLSRVETRQWGGLTLTIIIAAIGIAGALPLGI 173

Query: 197 LLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGV 256
           LLALGR SN+PVLR  C+ FIE +RGVPL+TVLFM+S+MLPLFL +  ++DKLLRAL+GV
Sbjct: 174 LLALGRRSNMPVLRALCVIFIEFWRGVPLITVLFMSSVMLPLFLTEGTNIDKLLRALVGV 233

Query: 257 SAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIG 316
             F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I 
Sbjct: 234 ILFQSAYVAEVVRGGLQALPKGQYEAAQSLALGYWRMQGLVILPQALKMVIPGLVNTIIA 293

Query: 317 LFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFI 376
           LFKD+SL+ II +FDL   ++    +  W+     T G +F   ++WIFCFS+S YS  +
Sbjct: 294 LFKDTSLVIIIGLFDLFSSIQQATVDPAWLG--MSTEGYVFAAIIYWIFCFSMSRYSQHL 351

Query: 377 EKTLHKGSKK 386
           EK    G K 
Sbjct: 352 EKRFDTGHKS 361


>gi|301647046|ref|ZP_07246878.1| ABC transporter, permease protein [Escherichia coli MS 146-1]
 gi|301074796|gb|EFK89602.1| ABC transporter, permease protein [Escherichia coli MS 146-1]
          Length = 347

 Score =  306 bits (783), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 160/356 (44%), Positives = 226/356 (63%), Gaps = 14/356 (3%)

Query: 29  IAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQP 88
           + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS R  CT         
Sbjct: 1   MVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRADCTKA------- 53

Query: 89  DGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILL 148
                ACW FI++R+ QF++  YP  QRWR  L  L G + + PM     P +       
Sbjct: 54  ----GACWVFIHERFGQFMYRLYPHDQRWRINLALLIGLVSIAPMFWKILPHRGRYIAAW 109

Query: 149 FGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIP 207
             ++P+  ++++YGG   L  VET  WGGL +TL+I+  GI  ++P GILLALGR S++P
Sbjct: 110 AVIYPLIVWWLMYGGFFALERVETRQWGGLTLTLIIASVGIAGALPWGILLALGRRSHMP 169

Query: 208 VLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEV 267
           ++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV  F SAY+AEV
Sbjct: 170 IVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVGVILFQSAYVAEV 229

Query: 268 LRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISII 327
           +RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I LFKD+SL+ II
Sbjct: 230 VRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTIIALFKDTSLVIII 289

Query: 328 NMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKG 383
            +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS ++EK  + G
Sbjct: 290 GLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQYLEKRFNTG 343


>gi|311277768|ref|YP_003939999.1| polar amino acid ABC transporter, inner membrane subunit
           [Enterobacter cloacae SCF1]
 gi|308746963|gb|ADO46715.1| polar amino acid ABC transporter, inner membrane subunit
           [Enterobacter cloacae SCF1]
          Length = 367

 Score =  305 bits (782), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 172/374 (45%), Positives = 235/374 (62%), Gaps = 16/374 (4%)

Query: 13  KRLLQPSLPPVY--QRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVW 70
           K LL PS  PV   +   + W  KN F +  + LLT   + LL   +P +I WVFL A W
Sbjct: 3   KALLSPSSRPVGAGKNPAVVWARKNLFSSWSNTLLTLFCLWLLWKLLPPLIDWVFLQANW 62

Query: 71  IGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILL 130
           +GS R  CT            + ACW FI +R+ QF++G YP  QRWR  L  + G + +
Sbjct: 63  VGSTRADCTK-----------SGACWVFIRERFGQFMYGLYPHDQRWRIHLALVIGVLTI 111

Query: 131 TPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGII 189
            PM +   P++         L+P+  +++LYGG  GL  VET  WGGL +TL+I+  GI 
Sbjct: 112 IPMFLKRLPQRGRYIACWAVLYPLIVWWLLYGGFFGLDRVETRQWGGLTLTLIIASVGIA 171

Query: 190 ISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKL 249
            ++P GILLALGR S +PV+R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL
Sbjct: 172 GALPWGILLALGRRSTMPVVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMSEGTSIDKL 231

Query: 250 LRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPG 309
           +RAL+GV  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG
Sbjct: 232 IRALVGVILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPG 291

Query: 310 IVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSI 369
           +VNT I LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+
Sbjct: 292 LVNTIIALFKDTSLVIIIGLFDLFSSVQQATVDPVWLG--MSTEGYVFAALIYWIFCFSM 349

Query: 370 SLYSVFIEKTLHKG 383
           S YS  +EK  + G
Sbjct: 350 SRYSQHLEKRFNTG 363


>gi|168752392|ref|ZP_02777414.1| general L-amino acid transport system permease protein AapM
           [Escherichia coli O157:H7 str. EC4113]
 gi|168758502|ref|ZP_02783509.1| general L-amino acid transport system permease protein AapM
           [Escherichia coli O157:H7 str. EC4401]
 gi|168769136|ref|ZP_02794143.1| general L-amino acid transport system permease protein AapM
           [Escherichia coli O157:H7 str. EC4486]
 gi|168783841|ref|ZP_02808848.1| general L-amino acid transport system permease protein AapM
           [Escherichia coli O157:H7 str. EC4076]
 gi|187776437|ref|ZP_02802695.2| general L-amino acid transport system permease protein AapM
           [Escherichia coli O157:H7 str. EC4196]
 gi|195940014|ref|ZP_03085396.1| putative transport system permease protein [Escherichia coli
           O157:H7 str. EC4024]
 gi|208807701|ref|ZP_03250038.1| general L-amino acid transport system permease protein AapM
           [Escherichia coli O157:H7 str. EC4206]
 gi|208814609|ref|ZP_03255938.1| general L-amino acid transport system permease protein AapM
           [Escherichia coli O157:H7 str. EC4045]
 gi|208819421|ref|ZP_03259741.1| general L-amino acid transport system permease protein AapM
           [Escherichia coli O157:H7 str. EC4042]
 gi|209398401|ref|YP_002272732.1| general L-amino acid transport system permease protein AapM
           [Escherichia coli O157:H7 str. EC4115]
 gi|254795212|ref|YP_003080049.1| putative amino-acid ABC transporter membrane protein [Escherichia
           coli O157:H7 str. TW14359]
 gi|187767132|gb|EDU30976.1| general L-amino acid transport system permease protein AapM
           [Escherichia coli O157:H7 str. EC4196]
 gi|188013749|gb|EDU51871.1| general L-amino acid transport system permease protein AapM
           [Escherichia coli O157:H7 str. EC4113]
 gi|188998879|gb|EDU67865.1| general L-amino acid transport system permease protein AapM
           [Escherichia coli O157:H7 str. EC4076]
 gi|189354675|gb|EDU73094.1| general L-amino acid transport system permease protein AapM
           [Escherichia coli O157:H7 str. EC4401]
 gi|189361796|gb|EDU80215.1| general L-amino acid transport system permease protein AapM
           [Escherichia coli O157:H7 str. EC4486]
 gi|208727502|gb|EDZ77103.1| general L-amino acid transport system permease protein AapM
           [Escherichia coli O157:H7 str. EC4206]
 gi|208735886|gb|EDZ84573.1| general L-amino acid transport system permease protein AapM
           [Escherichia coli O157:H7 str. EC4045]
 gi|208739544|gb|EDZ87226.1| general L-amino acid transport system permease protein AapM
           [Escherichia coli O157:H7 str. EC4042]
 gi|209159801|gb|ACI37234.1| general L-amino acid transport system permease protein AapM
           [Escherichia coli O157:H7 str. EC4115]
 gi|254594612|gb|ACT73973.1| predicted amino-acid transporter subunit, membrane component of ABC
           superfamily [Escherichia coli O157:H7 str. TW14359]
          Length = 362

 Score =  305 bits (781), Expect = 8e-81,   Method: Compositional matrix adjust.
 Identities = 163/362 (45%), Positives = 228/362 (62%), Gaps = 15/362 (4%)

Query: 15  LLQPSLPPVYQRG-IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGS 73
           L  PS P  +     + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS
Sbjct: 6   LSHPSRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGS 65

Query: 74  NRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPM 133
            R  CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM
Sbjct: 66  TRADCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPM 114

Query: 134 LIPSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISM 192
                P +     +   ++P+  ++++YGG   L  VET  WGGL +TL+I+  GI  ++
Sbjct: 115 FWKILPHRGRYIAVWAVIYPLIVWWLMYGGFFALERVETRQWGGLTLTLIIASVGIAGAL 174

Query: 193 PLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRA 252
           P GILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKLLRA
Sbjct: 175 PWGILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLLRA 234

Query: 253 LLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVN 312
           L+GV  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VN
Sbjct: 235 LVGVILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVN 294

Query: 313 TFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLY 372
           T I LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S Y
Sbjct: 295 TIIALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRY 352

Query: 373 SV 374
           S+
Sbjct: 353 SL 354


>gi|296272119|ref|YP_003654750.1| polar amino acid ABC transporter inner membrane subunit [Arcobacter
           nitrofigilis DSM 7299]
 gi|296096294|gb|ADG92244.1| polar amino acid ABC transporter, inner membrane subunit
           [Arcobacter nitrofigilis DSM 7299]
          Length = 359

 Score =  303 bits (776), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 156/371 (42%), Positives = 240/371 (64%), Gaps = 19/371 (5%)

Query: 16  LQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNR 75
           L+    P+   G + WI +N F +P   +LT L + LL + +P +++W+  DA W G+  
Sbjct: 7   LETRPAPLGVSGPVKWIKENLFPSPVSSILTILSLVLLYYIVPPLLNWMIFDATWTGTKE 66

Query: 76  TVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLI 135
            +              + A W FIY+++ QF++G YP    WRP L+   G  + + +L 
Sbjct: 67  EITK------------HGARWIFIYEKFNQFMYGFYPENLYWRPNLIL--GLFVASIVLF 112

Query: 136 PSFPR-KFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPL 194
                 K   SIL+  LFPI SF +++GGLGL +V T+ WGGL++T+V++  GI++S P+
Sbjct: 113 KKIKHIKVRASILI--LFPIVSFILIHGGLGLEVVPTTKWGGLMLTMVVASVGIVVSFPI 170

Query: 195 GILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALL 254
           GI+ ALGR SN+P+++   + +IE  RGVPL+T+LFM+S++LPLF P+    DKLLRAL+
Sbjct: 171 GIIFALGRQSNMPIIKTISVLYIEFIRGVPLITLLFMSSVILPLFFPEGVTFDKLLRALI 230

Query: 255 GVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTF 314
           GV+ F +AY+AEV+RGGLQ+I KGQ+EAA+S+GLSY Q M L+I+PQ +K  IP IV +F
Sbjct: 231 GVTLFQAAYLAEVVRGGLQAIPKGQYEAADSVGLSYWQAMGLVILPQALKISIPNIVGSF 290

Query: 315 IGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSV 374
           + LFKD++L+ II +FD+L +V +  S+  W+     T G +F+  ++WI CF++S Y+ 
Sbjct: 291 VALFKDTTLVLIIGLFDVLAMVTLTTSDPHWLG--FETEGYVFVTMIYWIICFTMSKYAQ 348

Query: 375 FIEKTLHKGSK 385
            +E   +   K
Sbjct: 349 SVENRFNTDHK 359


>gi|26249862|ref|NP_755902.1| amino-acid ABC transporter permease YhdY [Escherichia coli CFT073]
 gi|26110290|gb|AAN82476.1|AE016767_236 Hypothetical amino-acid ABC transporter permease protein yhdY
           [Escherichia coli CFT073]
          Length = 368

 Score =  302 bits (773), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 167/371 (45%), Positives = 233/371 (62%), Gaps = 15/371 (4%)

Query: 15  LLQPSLPPVYQRG-IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGS 73
           L  P  P  +     + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS
Sbjct: 7   LSHPPRPASHNSSRAMVWVRKNLFSSLSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGS 66

Query: 74  NRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPM 133
            R  CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM
Sbjct: 67  TRADCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPM 115

Query: 134 LIPSFPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISM 192
                P +     +   ++P+  ++++YGG LGL  VET  WGGL +TL+I+  GI  ++
Sbjct: 116 FWKILPYRGRYIAVWAVIYPLIVWWLMYGGFLGLERVETRQWGGLTLTLIIASVGIAGAL 175

Query: 193 PLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRA 252
           P GILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RA
Sbjct: 176 PWGILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEDTSIDKLIRA 235

Query: 253 LLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVN 312
           L+GV  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+IMPQ +K VIPG+VN
Sbjct: 236 LVGVILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVIMPQALKLVIPGLVN 295

Query: 313 TFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLY 372
           T I LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S Y
Sbjct: 296 TIIALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRY 353

Query: 373 SVFIEKTLHKG 383
           S  +EK  + G
Sbjct: 354 SQHLEKRFNTG 364


>gi|307555365|gb|ADN48140.1| hypothetical amino-acid ABC transporter permease protein YhdY
           [Escherichia coli ABU 83972]
          Length = 367

 Score =  302 bits (773), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 167/371 (45%), Positives = 233/371 (62%), Gaps = 15/371 (4%)

Query: 15  LLQPSLPPVYQRG-IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGS 73
           L  P  P  +     + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS
Sbjct: 6   LSHPPRPASHNSSRAMVWVRKNLFSSLSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGS 65

Query: 74  NRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPM 133
            R  CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM
Sbjct: 66  TRADCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPM 114

Query: 134 LIPSFPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISM 192
                P +     +   ++P+  ++++YGG LGL  VET  WGGL +TL+I+  GI  ++
Sbjct: 115 FWKILPYRGRYIAVWAVIYPLIVWWLMYGGFLGLERVETRQWGGLTLTLIIASVGIAGAL 174

Query: 193 PLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRA 252
           P GILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RA
Sbjct: 175 PWGILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEDTSIDKLIRA 234

Query: 253 LLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVN 312
           L+GV  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+IMPQ +K VIPG+VN
Sbjct: 235 LVGVILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVIMPQALKLVIPGLVN 294

Query: 313 TFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLY 372
           T I LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S Y
Sbjct: 295 TIIALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRY 352

Query: 373 SVFIEKTLHKG 383
           S  +EK  + G
Sbjct: 353 SQHLEKRFNTG 363


>gi|238789895|ref|ZP_04633675.1| Inner membrane amino-acid ABC transporter permease protein yhdY
           [Yersinia frederiksenii ATCC 33641]
 gi|238721968|gb|EEQ13628.1| Inner membrane amino-acid ABC transporter permease protein yhdY
           [Yersinia frederiksenii ATCC 33641]
          Length = 323

 Score =  301 bits (772), Expect = 8e-80,   Method: Compositional matrix adjust.
 Identities = 158/330 (47%), Positives = 215/330 (65%), Gaps = 14/330 (4%)

Query: 57  IPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQR 116
           IP +++W   +A W G+ RT CT              ACW FI+ R+ QF++G YP+ QR
Sbjct: 5   IPPLLNWAIFNANWRGTTRTDCTR-----------EGACWVFIHARFGQFMYGLYPIDQR 53

Query: 117 WRPILVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWG 175
           WR     + G + L P+L  + PR+          +P+F + +LYGG  GLS+VET  WG
Sbjct: 54  WRINTTLIIGLLTLIPLLWRAMPRRGRYLAGWMVTYPLFVWMMLYGGFFGLSLVETRQWG 113

Query: 176 GLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIM 235
           GL +TL+I+  GI  ++PLGILLAL R S++PV+R   + FIE +RGVPL+TVLFM+S+M
Sbjct: 114 GLTLTLIIAAVGIAGALPLGILLALARRSSMPVVRILSVVFIEFWRGVPLITVLFMSSVM 173

Query: 236 LPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMR 295
           LPLF+ +   +DKL+RAL+GV  F SAY+AEV+RGGLQ++ KGQ EAA SLGL Y +   
Sbjct: 174 LPLFMTEGTSIDKLIRALVGVVLFQSAYVAEVVRGGLQALPKGQTEAAESLGLGYWKTQG 233

Query: 296 LIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGL 355
           L+I+PQ +K VIPG+VNT I LFKD+SL+ II +FDL   V+    +  W+     T G 
Sbjct: 234 LVILPQALKMVIPGLVNTIIALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGY 291

Query: 356 IFIGFVFWIFCFSISLYSVFIEKTLHKGSK 385
           +F   V+WIFCFS+S YS  +EK  H G  
Sbjct: 292 VFAAAVYWIFCFSMSRYSQHLEKRFHTGRS 321


>gi|261819587|ref|YP_003257693.1| polar amino acid ABC transporter inner membrane protein
           [Pectobacterium wasabiae WPP163]
 gi|261603600|gb|ACX86086.1| polar amino acid ABC transporter, inner membrane subunit
           [Pectobacterium wasabiae WPP163]
          Length = 364

 Score =  301 bits (772), Expect = 8e-80,   Method: Compositional matrix adjust.
 Identities = 165/371 (44%), Positives = 232/371 (62%), Gaps = 16/371 (4%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
           Q   PP+ +   I W  +N F    + LLT   + LL  +IP +++W    A WIG+ R 
Sbjct: 8   QDRQPPLLRS--IQWARRNLFSNISNSLLTLFCLWLLWVAIPPLLNWAIFQANWIGTTRN 65

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            CT            + ACW FI+ R+  F++G YP  + WR       G + + PM + 
Sbjct: 66  DCTR-----------DGACWVFIHARFGHFMYGLYPATEVWRINFALAIGLLSILPMFLK 114

Query: 137 SFPRKFLNSILLFGLFPIFSFFVLYGGLG-LSIVETSLWGGLLVTLVISFFGIIISMPLG 195
           + P +     +    +P+ ++++LYGG G LS VET  WGGL++TL+I+  GI  ++PLG
Sbjct: 115 TIPYRGRYIAVWTVAYPLIAWWLLYGGFGGLSRVETYQWGGLMLTLIIAAVGIAGALPLG 174

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           ILLALGR S +P++R   + FIE +RGVPL+TVLFM+S+MLPLFL +   +DKLLRAL+G
Sbjct: 175 ILLALGRRSTLPIVRMLSVAFIEFWRGVPLITVLFMSSVMLPLFLTEGTTIDKLLRALVG 234

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           V  F SAY+AEV+RGGLQ++ KGQ+EAA SLGL Y +   L+I+PQ +K VIPG+VNT I
Sbjct: 235 VILFQSAYVAEVVRGGLQALPKGQYEAAESLGLGYWRMQGLVILPQALKMVIPGLVNTII 294

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD+SL+ II +FDL   ++    + TW+     T G +F   V+WIFCFS+S YS  
Sbjct: 295 SLFKDTSLVIIIGLFDLFSSIQQATVDPTWLG--MSTEGYVFAAMVYWIFCFSMSRYSQH 352

Query: 376 IEKTLHKGSKK 386
           +E   + G K 
Sbjct: 353 LENRFNTGHKS 363


>gi|238752138|ref|ZP_04613620.1| Inner membrane amino-acid ABC transporter permease protein yhdY
           [Yersinia rohdei ATCC 43380]
 gi|238709611|gb|EEQ01847.1| Inner membrane amino-acid ABC transporter permease protein yhdY
           [Yersinia rohdei ATCC 43380]
          Length = 346

 Score =  301 bits (772), Expect = 8e-80,   Method: Compositional matrix adjust.
 Identities = 163/354 (46%), Positives = 228/354 (64%), Gaps = 14/354 (3%)

Query: 31  WIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDG 90
           W  KN F +  + LLT L + L+   IP +++W   DA W+G++R+ CT           
Sbjct: 2   WARKNLFSSWTNSLLTLLCLWLMWQFIPPLLNWTIFDANWLGTSRSDCTR---------- 51

Query: 91  WNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFG 150
              ACW FI+ R+ QF++G YP+ QRWR     + G + + P+   + P +    ++   
Sbjct: 52  -EGACWVFIHARFGQFMYGLYPIEQRWRINTSLIIGLLTMIPLFWRAMPHRGRYLVVWML 110

Query: 151 LFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVL 209
            +P+  + +LYGG  GLS VET  WGGL +TL+I+  GI  ++PLGILLAL R S++PV+
Sbjct: 111 AYPLLVWVMLYGGFFGLSRVETHQWGGLTLTLIIAAVGIAGALPLGILLALARRSSMPVV 170

Query: 210 RYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLR 269
           R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV  F SAY+AEV+R
Sbjct: 171 RILSVIFIEFWRGVPLITVLFMSSVMLPLFMTEGTSIDKLIRALVGVVLFQSAYVAEVVR 230

Query: 270 GGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINM 329
           GGLQ++ KGQ EAA SLGL Y +   L+I+PQ +K VIPG+VNT I LFKD+SL+ II +
Sbjct: 231 GGLQALPKGQTEAAESLGLGYWKTQGLVILPQALKMVIPGLVNTIIALFKDTSLVIIIGL 290

Query: 330 FDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKG 383
           FDL   V+    +  W+     T G +F   V+WIFCFS+S YS  +EK  H G
Sbjct: 291 FDLFSSVQQATVDPAWLG--MSTEGYVFAAAVYWIFCFSMSRYSQHLEKRFHTG 342


>gi|227887998|ref|ZP_04005803.1| amino-acid ABC superfamily ATP binding cassette transporter
           permease protein YhdY [Escherichia coli 83972]
 gi|300991069|ref|ZP_07179490.1| ABC transporter, permease protein [Escherichia coli MS 45-1]
 gi|301047873|ref|ZP_07194920.1| ABC transporter, permease protein [Escherichia coli MS 185-1]
 gi|227835394|gb|EEJ45860.1| amino-acid ABC superfamily ATP binding cassette transporter
           permease protein YhdY [Escherichia coli 83972]
 gi|300300216|gb|EFJ56601.1| ABC transporter, permease protein [Escherichia coli MS 185-1]
 gi|300406990|gb|EFJ90528.1| ABC transporter, permease protein [Escherichia coli MS 45-1]
 gi|315294823|gb|EFU54166.1| ABC transporter, permease protein [Escherichia coli MS 153-1]
          Length = 347

 Score =  301 bits (772), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 164/356 (46%), Positives = 229/356 (64%), Gaps = 14/356 (3%)

Query: 29  IAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQP 88
           + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS R  CT         
Sbjct: 1   MVWVRKNLFSSLSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRADCTKA------- 53

Query: 89  DGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILL 148
                ACW FI++R+ QF++G YP  QRWR  L  L G + + PM     P +     + 
Sbjct: 54  ----GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPMFWKILPYRGRYIAVW 109

Query: 149 FGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIP 207
             ++P+  ++++YGG LGL  VET  WGGL +TL+I+  GI  ++P GILLALGR S++P
Sbjct: 110 AVIYPLIVWWLMYGGFLGLERVETRQWGGLTLTLIIASVGIAGALPWGILLALGRRSHMP 169

Query: 208 VLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEV 267
           ++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV  F SAY+AEV
Sbjct: 170 IVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEDTSIDKLIRALVGVILFQSAYVAEV 229

Query: 268 LRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISII 327
           +RGGLQ++ KGQ+EAA SL L Y +   L+IMPQ +K VIPG+VNT I LFKD+SL+ II
Sbjct: 230 VRGGLQALPKGQYEAAESLALGYWKTQGLVIMPQALKLVIPGLVNTIIALFKDTSLVIII 289

Query: 328 NMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKG 383
            +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  +EK  + G
Sbjct: 290 GLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQHLEKRFNTG 343


>gi|331659559|ref|ZP_08360501.1| inner membrane amino-acid ABC transporter permease protein YhdY
           [Escherichia coli TA206]
 gi|331054141|gb|EGI26170.1| inner membrane amino-acid ABC transporter permease protein YhdY
           [Escherichia coli TA206]
          Length = 367

 Score =  301 bits (771), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 167/371 (45%), Positives = 233/371 (62%), Gaps = 15/371 (4%)

Query: 15  LLQPSLPPVYQRG-IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGS 73
           L  P  P  +     + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS
Sbjct: 6   LSHPPRPASHNSSRAMVWVRKNLFSSLSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGS 65

Query: 74  NRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPM 133
            R  CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM
Sbjct: 66  TRADCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPM 114

Query: 134 LIPSFPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISM 192
                P +     +   ++P+  ++++YGG LGL  VET  WGGL +TL+I+  GI  ++
Sbjct: 115 FWKILPYRGRYIAVWAVIYPLIVWWLMYGGFLGLERVETRQWGGLTLTLIIASVGIAGAL 174

Query: 193 PLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRA 252
           P GILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RA
Sbjct: 175 PWGILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRA 234

Query: 253 LLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVN 312
           L+GV  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+IMPQ +K VIPG+VN
Sbjct: 235 LVGVILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVIMPQALKLVIPGLVN 294

Query: 313 TFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLY 372
           T I LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S Y
Sbjct: 295 TIIALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRY 352

Query: 373 SVFIEKTLHKG 383
           S  +EK  + G
Sbjct: 353 SQHLEKRFNTG 363


>gi|315300935|gb|EFU60155.1| ABC transporter, permease protein [Escherichia coli MS 16-3]
          Length = 347

 Score =  301 bits (771), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 164/356 (46%), Positives = 229/356 (64%), Gaps = 14/356 (3%)

Query: 29  IAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQP 88
           + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS R  CT         
Sbjct: 1   MVWVRKNLFSSLSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRADCTKA------- 53

Query: 89  DGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILL 148
                ACW FI++R+ QF++G YP  QRWR  L  L G + + PM     P +     + 
Sbjct: 54  ----GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPMFWKILPYRGRYIAVW 109

Query: 149 FGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIP 207
             ++P+  ++++YGG LGL  VET  WGGL +TL+I+  GI  ++P GILLALGR S++P
Sbjct: 110 AVIYPLIVWWLMYGGFLGLERVETRQWGGLTLTLIIASVGIAGALPWGILLALGRRSHMP 169

Query: 208 VLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEV 267
           ++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV  F SAY+AEV
Sbjct: 170 IVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVGVILFQSAYVAEV 229

Query: 268 LRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISII 327
           +RGGLQ++ KGQ+EAA SL L Y +   L+IMPQ +K VIPG+VNT I LFKD+SL+ II
Sbjct: 230 VRGGLQALPKGQYEAAESLALGYWKTQGLVIMPQALKLVIPGLVNTIIALFKDTSLVIII 289

Query: 328 NMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKG 383
            +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  +EK  + G
Sbjct: 290 GLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQHLEKRFNTG 343


>gi|332163170|ref|YP_004299747.1| ABC transporter permease [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|325667400|gb|ADZ44044.1| ABC transporter permease [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330862827|emb|CBX72968.1| inner membrane amino-acid ABC transporter permease protein yhdY
           [Yersinia enterocolitica W22703]
          Length = 367

 Score =  301 bits (770), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 163/357 (45%), Positives = 229/357 (64%), Gaps = 14/357 (3%)

Query: 28  IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQ 87
           ++ W  KN F +  + LLT L + L+   IP +++W   +A W+G+ RT CT        
Sbjct: 20  VVFWAKKNLFSSWTNSLLTLLCLWLMWQLIPPLLNWAVFNANWLGTTRTDCTR------- 72

Query: 88  PDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSIL 147
                 ACW FI+ R+ QF++G YP+ QRWR     + G + LTP+   + P +     +
Sbjct: 73  ----EGACWVFIHARFGQFMYGLYPIEQRWRINTTLIIGLVTLTPLFWRTMPGRRRYLAV 128

Query: 148 LFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNI 206
              ++P+  + +LYGG  GL+ VET  WGGL +TL+I+  GI  ++PLGILLAL R S++
Sbjct: 129 WAVVYPLLVWVMLYGGFFGLNRVETRQWGGLTLTLIIAAVGIAGALPLGILLALARRSSM 188

Query: 207 PVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAE 266
           PV+R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV  F SAY+AE
Sbjct: 189 PVVRILSVVFIEFWRGVPLITVLFMSSVMLPLFMTEGTSIDKLIRALVGVVLFQSAYVAE 248

Query: 267 VLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISI 326
           V+RGGLQ++ KGQ EA  SLGL Y +   L+I+PQ +K VIPG+VNT I LFKD+SL+ I
Sbjct: 249 VVRGGLQALPKGQTEATESLGLGYWKTQGLVILPQALKMVIPGLVNTIIALFKDTSLVII 308

Query: 327 INMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKG 383
           I +FDL   V+    +  W+     T G +F   V+WIFCFS+S YS  +EK  H G
Sbjct: 309 IGLFDLFSSVQQATVDPAWLG--MSTEGYVFAAAVYWIFCFSMSRYSQHLEKRFHTG 363


>gi|123444013|ref|YP_001007983.1| ABC transporter permease [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|122090974|emb|CAL13857.1| Putative ABC transporter permease protein [Yersinia enterocolitica
           subsp. enterocolitica 8081]
          Length = 369

 Score =  301 bits (770), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 163/357 (45%), Positives = 229/357 (64%), Gaps = 14/357 (3%)

Query: 28  IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQ 87
           ++ W  KN F +  + LLT L + L+   IP +++W   +A W+G+ RT CT        
Sbjct: 22  VVFWAKKNLFSSWTNSLLTLLCLWLMWQLIPPLLNWAVFNANWLGTTRTDCTQ------- 74

Query: 88  PDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSIL 147
                 ACW FI+ R+ QF++G YP+ QRWR     + G + L P+   + P +     +
Sbjct: 75  ----EGACWVFIHARFGQFMYGLYPIEQRWRINTTLIIGLVTLIPLFWRAMPGRGRYLAV 130

Query: 148 LFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNI 206
              ++P+  + +LYGG  GL+ VET  WGGL +TL+I+  GI  ++PLGILLAL R S++
Sbjct: 131 WAVVYPLLVWVMLYGGFFGLTRVETRQWGGLTLTLIIAAVGIAGALPLGILLALARRSSM 190

Query: 207 PVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAE 266
           PV+R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV  F SAY+AE
Sbjct: 191 PVVRILSVVFIEFWRGVPLITVLFMSSVMLPLFMTEGTSIDKLIRALVGVVLFQSAYVAE 250

Query: 267 VLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISI 326
           V+RGGLQ++ KGQ EAA SLGL Y +   L+I+PQ +K VIPG+VNT I LFKD+SL+ I
Sbjct: 251 VVRGGLQALPKGQTEAAESLGLGYWKTQGLVILPQALKMVIPGLVNTIIALFKDTSLVII 310

Query: 327 INMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKG 383
           I +FDL   V+    +  W+     T G +F   V+WIFCFS+S YS  +EK  H G
Sbjct: 311 IGLFDLFSSVQQATVDPAWLG--MSTEGYVFAAAVYWIFCFSMSRYSQHLEKRFHTG 365


>gi|318603944|emb|CBY25442.1| glutamate aspartate transport system permease protein GltK
           [Yersinia enterocolitica subsp. palearctica Y11]
          Length = 369

 Score =  300 bits (769), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 163/357 (45%), Positives = 229/357 (64%), Gaps = 14/357 (3%)

Query: 28  IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQ 87
           ++ W  KN F +  + LLT L + L+   IP +++W   +A W+G+ RT CT        
Sbjct: 22  VVFWAKKNLFSSWTNSLLTLLCLWLMWQLIPPLLNWAVFNANWLGTTRTDCTR------- 74

Query: 88  PDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSIL 147
                 ACW FI+ R+ QF++G YP+ QRWR     + G + LTP+   + P +     +
Sbjct: 75  ----EGACWVFIHARFGQFMYGLYPIEQRWRINTTLIIGLVTLTPLFWRTMPGRGRYLAV 130

Query: 148 LFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNI 206
              ++P+  + +LYGG  GL+ VET  WGGL +TL+I+  GI  ++PLGILLAL R S++
Sbjct: 131 WAVVYPLLVWVMLYGGFFGLNRVETRQWGGLTLTLIIAAVGIAGALPLGILLALARRSSM 190

Query: 207 PVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAE 266
           PV+R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV  F SAY+AE
Sbjct: 191 PVVRILSVVFIEFWRGVPLITVLFMSSVMLPLFMTEGTSIDKLIRALVGVVLFQSAYVAE 250

Query: 267 VLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISI 326
           V+RGGLQ++ KGQ EA  SLGL Y +   L+I+PQ +K VIPG+VNT I LFKD+SL+ I
Sbjct: 251 VVRGGLQALPKGQTEATESLGLGYWKTQGLVILPQALKMVIPGLVNTIIALFKDTSLVII 310

Query: 327 INMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKG 383
           I +FDL   V+    +  W+     T G +F   V+WIFCFS+S YS  +EK  H G
Sbjct: 311 IGLFDLFSSVQQATVDPAWLG--MSTEGYVFAAAVYWIFCFSMSRYSQHLEKRFHTG 365


>gi|227327914|ref|ZP_03831938.1| L-amino acid ABC transporter permease protein [Pectobacterium
           carotovorum subsp. carotovorum WPP14]
          Length = 364

 Score =  300 bits (769), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 163/359 (45%), Positives = 228/359 (63%), Gaps = 14/359 (3%)

Query: 29  IAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQP 88
           I W  +N F +  + LLT   + LL  +IP +++W    A WIG+ R  CT         
Sbjct: 18  IQWARRNLFSSISNSLLTLFCLWLLWVAIPPLLNWAIFQANWIGTTRNDCTR-------- 69

Query: 89  DGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILL 148
              + ACW FI+ R+  F++G YP  + WR       G + + PM + S P +     + 
Sbjct: 70  ---DGACWVFIHARFGHFMYGLYPAEEVWRINFALAIGLLSILPMFLKSIPYRGRYIAVW 126

Query: 149 FGLFPIFSFFVLYGGLG-LSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIP 207
             ++P+ ++++LYGG G LS VET  WGGL +TL+I+  GI  ++PLGILLALGR S +P
Sbjct: 127 TVVYPLVAWWLLYGGFGGLSRVETYQWGGLTLTLIIAAVGIAGALPLGILLALGRRSTLP 186

Query: 208 VLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEV 267
           ++R   + FIE +RGVPL+TVLFM+S+MLPLFL +   +DKLLRAL+GV  F SAY+AEV
Sbjct: 187 IVRMLSVVFIEFWRGVPLITVLFMSSVMLPLFLTEGTTIDKLLRALVGVILFQSAYVAEV 246

Query: 268 LRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISII 327
           +RGGLQ++ KGQ+EAA SLGL Y +   L+I+PQ +K VIPG+VNT I LFKD+SL+ II
Sbjct: 247 VRGGLQALPKGQYEAAESLGLGYWRMQGLVILPQALKMVIPGLVNTIISLFKDTSLVIII 306

Query: 328 NMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
            +FDL   ++    + TW+     T G +F   V+WIFCFS+S YS  +E   + G K 
Sbjct: 307 GLFDLFSSIQQATVDPTWLG--MSTEGYVFAAMVYWIFCFSMSRYSQHLENRFNTGHKS 363


>gi|119946445|ref|YP_944125.1| ABC polar amino acid transporter inner membrane protein
           [Psychromonas ingrahamii 37]
 gi|119865049|gb|ABM04526.1| ABC polar amino acid transporter inner membrane protein
           [Psychromonas ingrahamii 37]
          Length = 359

 Score =  300 bits (769), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 159/367 (43%), Positives = 235/367 (64%), Gaps = 20/367 (5%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
           +    P   RG++ W+ +N F   K+ +LT L I ++   IP ++ W+  DA W G+ + 
Sbjct: 8   EAKAAPSTSRGVLFWLRENLFSDIKNSVLTLLGIYIVYIMIPPLLDWMIFDATWSGTQKE 67

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTG-SILLTPMLI 135
           +  +             A W FI ++++QF++G YP+A+ WRP LV L   + LL+   I
Sbjct: 68  IVNS------------GARWIFIIEKFDQFMYGFYPVAEHWRPNLVGLISIAFLLSLKFI 115

Query: 136 PSFPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISMPL 194
           P+   K    + L  ++P   F ++ GG  GL  V T  WGGL++T++++  GII S P+
Sbjct: 116 PNIKVK----LGLMLIYPFVCFVLISGGWFGLEEVPTEKWGGLMLTILVAAVGIIASFPI 171

Query: 195 GILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALL 254
           GI+LALGR S +P+L+  C+ FIE  RGVPL+T+LFMAS++LPLF  D  D DKLLRAL+
Sbjct: 172 GIVLALGRQSEMPILKTLCVGFIEFIRGVPLITILFMASVVLPLFFSDGIDFDKLLRALI 231

Query: 255 GVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTF 314
           G++ F SAYIAEV+RGGLQ+I KGQ+EAA SLGL Y Q M LII+PQ +K  IP +V +F
Sbjct: 232 GITLFQSAYIAEVIRGGLQAIPKGQYEAAESLGLGYWQGMLLIILPQALKISIPNLVGSF 291

Query: 315 IGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSV 374
           I LFKD++L+ II +FD+L +V +  S++ W+       G +F+  ++W+ CFS+S YS 
Sbjct: 292 ISLFKDTTLVLIIGLFDVLAMVTLTTSDALWLG--YEIEGYVFVTMIYWVCCFSMSQYSK 349

Query: 375 FIEKTLH 381
            +E+  H
Sbjct: 350 SVERKYH 356


>gi|253686633|ref|YP_003015823.1| polar amino acid ABC transporter, inner membrane subunit
           [Pectobacterium carotovorum subsp. carotovorum PC1]
 gi|251753211|gb|ACT11287.1| polar amino acid ABC transporter, inner membrane subunit
           [Pectobacterium carotovorum subsp. carotovorum PC1]
          Length = 362

 Score =  300 bits (768), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 163/359 (45%), Positives = 228/359 (63%), Gaps = 14/359 (3%)

Query: 29  IAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQP 88
           + W  +N F +  + LLT   + LL  +IP +++W    A WIG+ R  CT         
Sbjct: 16  MQWARRNLFSSISNSLLTLFCLWLLWVAIPPLLNWAIFQANWIGTTRNDCTR-------- 67

Query: 89  DGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILL 148
              + ACW FI+ R+  F++G YP A+ WR       G + + PM + S P +     + 
Sbjct: 68  ---DGACWVFIHARFGHFMYGLYPAAEIWRINFALTIGLLSILPMFLKSIPYRGRYIAVW 124

Query: 149 FGLFPIFSFFVLYGGLG-LSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIP 207
              +P+ ++++LYGG G LS VET  WGGL +TL+I+  GI  ++PLGILLALGR S +P
Sbjct: 125 AVAYPLIAWWLLYGGFGGLSRVETYQWGGLTLTLIIAAVGIAGALPLGILLALGRRSTLP 184

Query: 208 VLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEV 267
           ++R   + FIE +RGVPL+TVLFM+S+MLPLFL +   +DKLLRAL+GV  F SAY+AEV
Sbjct: 185 IVRMLSVVFIEFWRGVPLITVLFMSSVMLPLFLTEGTTIDKLLRALVGVILFQSAYVAEV 244

Query: 268 LRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISII 327
           +RGGLQ++ KGQ+EAA SLGL Y +   L+I+PQ +K VIPG+VNT I LFKD+SL+ II
Sbjct: 245 VRGGLQALPKGQYEAAESLGLGYWRMQGLVILPQALKMVIPGLVNTIISLFKDTSLVIII 304

Query: 328 NMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
            +FDL   ++    + TW+     T G +F   V+WIFCFS+S YS  +E   + G K 
Sbjct: 305 GLFDLFSSIQQATVDPTWLG--MSTEGYVFAAMVYWIFCFSMSRYSQHLESRFNTGHKS 361


>gi|146313343|ref|YP_001178417.1| polar amino acid ABC transporter, inner membrane subunit
           [Enterobacter sp. 638]
 gi|145320219|gb|ABP62366.1| amino acid ABC transporter membrane protein 2, PAAT family
           [Enterobacter sp. 638]
          Length = 367

 Score =  300 bits (768), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 167/365 (45%), Positives = 229/365 (62%), Gaps = 16/365 (4%)

Query: 22  PVYQRG--IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCT 79
           P   RG   IAW  KN F +  + LLT +   L+   IP +I+W FL A W+GS R  CT
Sbjct: 12  PSSARGWRFIAWARKNLFSSWSNSLLTIICFWLMWELIPPLINWAFLQANWVGSTRADCT 71

Query: 80  TVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFP 139
                         ACW FI++R+ QF++G YP  QRWR  +  + G + + PM     P
Sbjct: 72  KA-----------GACWVFIHERFGQFMYGLYPHEQRWRINVALIVGLLSIAPMFWKHLP 120

Query: 140 RKFLNSILLFGLFPIFSFFVLYGGLGL-SIVETSLWGGLLVTLVISFFGIIISMPLGILL 198
           R+         ++P+  + +LYGG+     VET  WGGL +TL+I+  GI  ++PLGILL
Sbjct: 121 RRGRYIACWAVVYPLVVWLLLYGGVLGLERVETRQWGGLTLTLIIASVGIAGALPLGILL 180

Query: 199 ALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSA 258
           ALGR S +PV+R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV  
Sbjct: 181 ALGRRSTMPVVRVLSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTTIDKLIRALVGVIL 240

Query: 259 FASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLF 318
           F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I LF
Sbjct: 241 FQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTIIALF 300

Query: 319 KDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEK 378
           KD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  +EK
Sbjct: 301 KDTSLVIIIGLFDLFSSVQQATVDPVWLG--MSTEGYVFAALIYWIFCFSMSRYSQHLEK 358

Query: 379 TLHKG 383
             + G
Sbjct: 359 RFNTG 363


>gi|170684312|ref|YP_001745540.1| His/Glu/Gln/Arg/opine ABC transporter permease [Escherichia coli
           SMS-3-5]
 gi|170522030|gb|ACB20208.1| amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine
           family [Escherichia coli SMS-3-5]
          Length = 367

 Score =  300 bits (768), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 166/371 (44%), Positives = 233/371 (62%), Gaps = 15/371 (4%)

Query: 15  LLQPSLPPVYQRG-IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGS 73
           L  P  P  +     + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS
Sbjct: 6   LSHPPRPASHNSSRAMVWVRKNLFSSLSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGS 65

Query: 74  NRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPM 133
            R  CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM
Sbjct: 66  TRADCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPM 114

Query: 134 LIPSFPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISM 192
                P +     +   ++P+  ++++YGG LGL  VET  WGGL +TL+I+  GI  ++
Sbjct: 115 FWKILPYRGRYIAVWAVIYPLIVWWLMYGGFLGLERVETRQWGGLTLTLIIASVGIAGAL 174

Query: 193 PLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRA 252
           P GILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RA
Sbjct: 175 PWGILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRA 234

Query: 253 LLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVN 312
           L+GV  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VN
Sbjct: 235 LVGVILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVN 294

Query: 313 TFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLY 372
           T I LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S Y
Sbjct: 295 TIIALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRY 352

Query: 373 SVFIEKTLHKG 383
           S  +EK  + G
Sbjct: 353 SQHLEKRFNTG 363


>gi|119946449|ref|YP_944129.1| ABC polar amino acid transporter inner membrane protein
           [Psychromonas ingrahamii 37]
 gi|119865053|gb|ABM04530.1| ABC polar amino acid transporter inner membrane protein
           [Psychromonas ingrahamii 37]
          Length = 359

 Score =  300 bits (767), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 159/367 (43%), Positives = 235/367 (64%), Gaps = 20/367 (5%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
           +    P   RG++ W+ +N F   K+ +LT L I ++   IP ++ W+  DA W G+ + 
Sbjct: 8   EAKAAPSTSRGVLFWLRENLFSDIKNSVLTLLGIYIVYIMIPPLLDWMIFDATWSGTQKE 67

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTG-SILLTPMLI 135
           +  +             A W FI ++++QF++G YP+A+ WRP LV L   + LL+   I
Sbjct: 68  IVNS------------GARWIFIIEKFDQFMYGFYPVAEDWRPNLVGLISIAFLLSLKFI 115

Query: 136 PSFPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISMPL 194
           P+   K    + L  ++P   F ++ GG  GL  V T  WGGL++T++++  GII S P+
Sbjct: 116 PNIKVK----LGLMLIYPFVCFVLISGGWFGLEEVPTEKWGGLMLTILVAAVGIIASFPI 171

Query: 195 GILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALL 254
           GI+LALGR S +P+L+  C+ FIE  RGVPL+T+LFMAS++LPLF  D  D DKLLRAL+
Sbjct: 172 GIVLALGRQSEMPILKTLCVGFIEFIRGVPLITILFMASVVLPLFFSDGIDFDKLLRALI 231

Query: 255 GVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTF 314
           G++ F SAYIAEV+RGGLQ+I KGQ+EAA SLGL Y Q M LII+PQ +K  IP +V +F
Sbjct: 232 GITLFQSAYIAEVIRGGLQAIPKGQYEAAESLGLGYWQGMLLIILPQALKISIPNLVGSF 291

Query: 315 IGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSV 374
           I LFKD++L+ II +FD+L +V +  S++ W+       G +F+  ++W+ CFS+S YS 
Sbjct: 292 ISLFKDTTLVLIIGLFDVLAMVTLTTSDALWLG--YEIEGYVFVTMIYWVCCFSMSQYSK 349

Query: 375 FIEKTLH 381
            +E+  H
Sbjct: 350 SVERKYH 356


>gi|331684911|ref|ZP_08385503.1| inner membrane amino-acid ABC transporter permease protein YhdY
           [Escherichia coli H299]
 gi|331078526|gb|EGI49732.1| inner membrane amino-acid ABC transporter permease protein YhdY
           [Escherichia coli H299]
          Length = 367

 Score =  300 bits (767), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 165/371 (44%), Positives = 232/371 (62%), Gaps = 15/371 (4%)

Query: 15  LLQPSLPPVYQRG-IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGS 73
           L  P  P  +     + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS
Sbjct: 6   LSHPPRPASHNSSRAMVWVRKNLFSSLSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGS 65

Query: 74  NRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPM 133
            R  CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM
Sbjct: 66  TRADCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPM 114

Query: 134 LIPSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISM 192
                P +     +   ++P+  ++++YGG  GL  VET  WGGL +TL+I+  GI  ++
Sbjct: 115 FWKILPHRGRYIAVWAVIYPLIVWWLMYGGFFGLERVETRQWGGLTLTLIIASVGIAGAL 174

Query: 193 PLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRA 252
           P GILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RA
Sbjct: 175 PWGILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRA 234

Query: 253 LLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVN 312
           L+GV  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VN
Sbjct: 235 LVGVILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVN 294

Query: 313 TFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLY 372
           T I LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S Y
Sbjct: 295 TIIALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRY 352

Query: 373 SVFIEKTLHKG 383
           S  +EK  + G
Sbjct: 353 SQHLEKRFNTG 363


>gi|294084019|ref|YP_003550776.1| amino acid ABC transporter permease [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292663591|gb|ADE38692.1| ABC-type amino acid transport system, permease component
           [Candidatus Puniceispirillum marinum IMCC1322]
          Length = 379

 Score =  300 bits (767), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 166/366 (45%), Positives = 232/366 (63%), Gaps = 8/366 (2%)

Query: 20  LPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCT 79
           LPP  + GI+ W+ KN F TP D +LT + I +L   +PG++ W  +DAVW  S R  C 
Sbjct: 18  LPPRGETGIVLWLRKNLFATPADTVLTLVCIYILYLFVPGLVQWGIIDAVWSASGRVDCW 77

Query: 80  TVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFP 139
              +   +P+  +AACWAF+  R +   +G YP    WR  L F+   I L P+L  + P
Sbjct: 78  EQME---EPN--SAACWAFVSTRLQLLTYGFYPEEYIWRVNLSFVLFLIALVPILWDNTP 132

Query: 140 RKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLA 199
           R+ L ++L   LFP  + ++++GGLGL  VET   GG+ +TL+I   GI  S+P+GI+LA
Sbjct: 133 RRPL-ALLYSALFPFIATWLVFGGLGLDPVETKKIGGIALTLLIGVTGIAFSLPIGIMLA 191

Query: 200 LGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAF 259
           LGR S +PVL+   + FIE  RGVPL+ +LF+AS ML  FLP     D L+R L+ V+ F
Sbjct: 192 LGRTSKLPVLKMLSVIFIEFIRGVPLIALLFIASTMLNYFLPPGTTFDLLVRVLIMVTFF 251

Query: 260 ASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFK 319
           ASAY+AEV+RGGL  I KGQ EAA + GL+Y +   LI+MPQV+K  IPGIVNTFIGLFK
Sbjct: 252 ASAYMAEVIRGGLAGIPKGQIEAAQASGLTYWKTTYLIVMPQVLKISIPGIVNTFIGLFK 311

Query: 320 DSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKT 379
           D++L+ II MFD+LG+ R + ++  W          IF+   F+I C+ +S YS ++E+ 
Sbjct: 312 DTTLVLIIGMFDVLGMGRSSLADPNWNGLAREV--YIFVAIFFFICCYGMSYYSAYLERK 369

Query: 380 LHKGSK 385
           L   +K
Sbjct: 370 LDTENK 375


>gi|312968399|ref|ZP_07782608.1| general L-amino acid transport system permease protein aapM
           [Escherichia coli 2362-75]
 gi|312286617|gb|EFR14528.1| general L-amino acid transport system permease protein aapM
           [Escherichia coli 2362-75]
 gi|323189118|gb|EFZ74402.1| general L-amino acid transport system permease protein aapM
           [Escherichia coli RN587/1]
          Length = 368

 Score =  299 bits (766), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 165/371 (44%), Positives = 233/371 (62%), Gaps = 15/371 (4%)

Query: 15  LLQPSLPPVYQRG-IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGS 73
           L  P  P  +     + W+ KN F +  + LLT   I L+   +P +++W FL A W+GS
Sbjct: 7   LSHPPRPASHNSSRAMVWVRKNLFSSLSNSLLTIGCIWLMWELLPPLLNWAFLQANWVGS 66

Query: 74  NRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPM 133
            R  CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM
Sbjct: 67  TRADCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPM 115

Query: 134 LIPSFPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISM 192
                P +     +   ++P+  ++++YGG LGL  VET  WGGL +TL+I+  GI  ++
Sbjct: 116 FWKILPYRGRYIAVWAVIYPLIVWWLMYGGFLGLERVETRQWGGLTLTLIIASVGIAGAL 175

Query: 193 PLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRA 252
           P GILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RA
Sbjct: 176 PWGILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRA 235

Query: 253 LLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVN 312
           L+GV  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VN
Sbjct: 236 LVGVILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVN 295

Query: 313 TFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLY 372
           T I LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S Y
Sbjct: 296 TIIALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRY 353

Query: 373 SVFIEKTLHKG 383
           S  +EK  + G
Sbjct: 354 SQHLEKRFNTG 364


>gi|217977865|ref|YP_002362012.1| polar amino acid ABC transporter, inner membrane subunit
           [Methylocella silvestris BL2]
 gi|217503241|gb|ACK50650.1| polar amino acid ABC transporter, inner membrane subunit
           [Methylocella silvestris BL2]
          Length = 384

 Score =  299 bits (766), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 151/360 (41%), Positives = 226/360 (62%), Gaps = 11/360 (3%)

Query: 28  IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQ 87
           +I  I  N F   +  LLT     L+    P ++ ++  DAVW   +   C     G   
Sbjct: 33  LIDLIAGNLFDGWRASLLTVATFVLIALITPPLLRFLVFDAVWSAPDGAACRAPGAG--- 89

Query: 88  PDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSIL 147
                 ACWAFI+ +   F +G+YP+ QRWR  +    G++L+  +L     R+ L +IL
Sbjct: 90  ------ACWAFIWRKLPYFTYGSYPLDQRWRVDVTLAIGAVLIFWLLWLDAARRNLAAIL 143

Query: 148 LFGLFPIFSFFVLYGG--LGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSN 205
            FG++P+ +F +L+G   +GL  V + LWGG+ V+L+++  G+++S+P G+LLALGR S+
Sbjct: 144 FFGVYPVVAFLLLHGAPSIGLPRVASDLWGGIFVSLLVAIVGMVVSLPFGVLLALGRRSS 203

Query: 206 IPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIA 265
           +P L  AC +FIEL RGVP++TVLFMA+ MLPLF+P+    D+LLR L+GV+ FASAY+A
Sbjct: 204 LPALSIACASFIELVRGVPIITVLFMANTMLPLFVPENLAPDRLLRPLIGVALFASAYMA 263

Query: 266 EVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLIS 325
           EV+RGGLQ+I  GQFE A +LGL   Q  RL+I+PQ ++ VIPG+VN FI LFKD++L++
Sbjct: 264 EVVRGGLQAIPSGQFEGAEALGLGRWQTQRLVILPQALRAVIPGVVNNFIALFKDTTLVA 323

Query: 326 IINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSK 385
           ++ +FD L  V     +  W      TTG  F    +++FCF++S YS+F+E+      +
Sbjct: 324 VVGIFDFLRTVDSARLDPVWAGPTIATTGYAFAAMFYFVFCFAMSRYSLFVERRFSHERR 383


>gi|215488577|ref|YP_002331008.1| predicted amino-acid transporter subunit [Escherichia coli O127:H6
           str. E2348/69]
 gi|215266649|emb|CAS11088.1| predicted amino-acid transporter subunit [Escherichia coli O127:H6
           str. E2348/69]
 gi|320194756|gb|EFW69386.1| Glutamate Aspartate transport system permease protein GltK
           [Escherichia coli WV_060327]
          Length = 367

 Score =  299 bits (766), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 165/371 (44%), Positives = 233/371 (62%), Gaps = 15/371 (4%)

Query: 15  LLQPSLPPVYQRG-IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGS 73
           L  P  P  +     + W+ KN F +  + LLT   I L+   +P +++W FL A W+GS
Sbjct: 6   LSHPPRPASHNSSRAMVWVRKNLFSSLSNSLLTIGCIWLMWELLPPLLNWAFLQANWVGS 65

Query: 74  NRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPM 133
            R  CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM
Sbjct: 66  TRADCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPM 114

Query: 134 LIPSFPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISM 192
                P +     +   ++P+  ++++YGG LGL  VET  WGGL +TL+I+  GI  ++
Sbjct: 115 FWKILPYRGRYIAVWAVIYPLIVWWLMYGGFLGLERVETRQWGGLTLTLIIASVGIAGAL 174

Query: 193 PLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRA 252
           P GILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RA
Sbjct: 175 PWGILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRA 234

Query: 253 LLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVN 312
           L+GV  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VN
Sbjct: 235 LVGVILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVN 294

Query: 313 TFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLY 372
           T I LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S Y
Sbjct: 295 TIIALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRY 352

Query: 373 SVFIEKTLHKG 383
           S  +EK  + G
Sbjct: 353 SQHLEKRFNTG 363


>gi|330429590|gb|AEC20924.1| putative amino acid ABC transporter permease protein [Pusillimonas
           sp. T7-7]
          Length = 365

 Score =  299 bits (766), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 162/371 (43%), Positives = 243/371 (65%), Gaps = 23/371 (6%)

Query: 21  PPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTT 80
           PP   +G++ W+  + F +P + LLT L+  LLL ++P +I W+F+ A +   N   C  
Sbjct: 13  PPRAHQGVLGWLRASLFSSPLNTLLTVLVAWLLLMAVPALIDWLFISANFNAQNAQECR- 71

Query: 81  VSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPS--- 137
              GG        ACWAFI +++   +FG YP  ++WRP+L     SI+L  +++ S   
Sbjct: 72  -QSGG--------ACWAFIAEKHRLILFGVYPYDEQWRPLL----ASIILIAVIVCSCIR 118

Query: 138 -FPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
            F + FL  I +  L  +    +++GG+ GLS VE S WGGL +TL+++ FGI ++ P G
Sbjct: 119 WFWKPFLGVIWIVAL--VVVGILMWGGVFGLSHVENSRWGGLPLTLILATFGIAVAFPFG 176

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           +LLALGR S++P ++  C+ +IEL RGVPL+++LFM+S+MLPLFLP+ + +DKLLRA + 
Sbjct: 177 LLLALGRRSHMPAVKALCVVYIELIRGVPLISLLFMSSVMLPLFLPEGFSIDKLLRAQIA 236

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           +  FA+AY+AE +RGGLQ+I KGQ+E A+S+GLSY Q+MR II+PQ +K VIP +V  FI
Sbjct: 237 IILFAAAYVAETVRGGLQAIPKGQYEGADSIGLSYWQQMRKIILPQALKVVIPPLVGIFI 296

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD+SL+ II +FDL    +   +++ W      T   +FI F+++IFC+SIS YS  
Sbjct: 297 SLFKDTSLVVIIGIFDLTQAAKTAVADAAWRG--FSTEAYLFIAFIYFIFCYSISRYSQS 354

Query: 376 IEKTLHKGSKK 386
           +EK L  G ++
Sbjct: 355 LEKHLQTGYQR 365


>gi|288958133|ref|YP_003448474.1| general L-amino acid transport system permease protein
           [Azospirillum sp. B510]
 gi|288910441|dbj|BAI71930.1| general L-amino acid transport system permease protein
           [Azospirillum sp. B510]
          Length = 368

 Score =  298 bits (763), Expect = 9e-79,   Method: Compositional matrix adjust.
 Identities = 159/366 (43%), Positives = 231/366 (63%), Gaps = 12/366 (3%)

Query: 21  PPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTT 80
           PP    G IAW+  N F +  + +LT L+I LL  +IP  ++W+ + A    S   VC  
Sbjct: 15  PPANTVGPIAWLRNNLFNSWYNAILTILVIGLLGSAIPPFLNWLLIRAHGFESTSAVCRQ 74

Query: 81  VSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPR 140
            + G         ACW FI ++    +FG +P  Q+WRP++       LL       F +
Sbjct: 75  DASG---------ACWGFISEKLRFIMFGMFPWEQQWRPLVTIGIFIALLVASCDRRFWK 125

Query: 141 KFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLAL 200
            +L  +   GL  + +  +  G LGL+ VE +LWGGL +T+++S  G+ ++ PL ILLAL
Sbjct: 126 PWLGLVWAAGL-ALVAVLMWGGVLGLTYVENTLWGGLPLTIILSVIGLAVAFPLSILLAL 184

Query: 201 GRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFA 260
           GR SN+P ++  C+T+IEL RGVPL+++LFMAS+MLPLFLP+   +DKLLRA +    FA
Sbjct: 185 GRRSNMPAVKVLCVTYIELIRGVPLISLLFMASVMLPLFLPNGVSIDKLLRAQIAFILFA 244

Query: 261 SAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKD 320
           +AY+AE +RGGLQ+I KGQ+EAA+ LGLSY QKMR I++PQ +   IP +VNTFI  FKD
Sbjct: 245 AAYMAEAIRGGLQAIPKGQYEAADGLGLSYWQKMRKIVLPQALAVAIPPLVNTFISFFKD 304

Query: 321 SSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTL 380
           +SL+ II ++DLLG  +   S+ +W          +FIG ++WIFCFS+S YS  +E+ L
Sbjct: 305 TSLVIIIGLYDLLGTAKAALSDPSWRGFY--REAYLFIGVIYWIFCFSMSKYSQKLERDL 362

Query: 381 HKGSKK 386
           ++G ++
Sbjct: 363 NRGHRR 368


>gi|50119203|ref|YP_048370.1| L-amino acid ABC transporter permease [Pectobacterium atrosepticum
           SCRI1043]
 gi|49609729|emb|CAG73163.1| L-amino acid ABC transporter permease protein [Pectobacterium
           atrosepticum SCRI1043]
          Length = 364

 Score =  297 bits (761), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 163/371 (43%), Positives = 231/371 (62%), Gaps = 16/371 (4%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
           Q   PP+ +   + W  +N F +  + LLT   + LL  +IP +++W    A WIG+ R 
Sbjct: 8   QNRQPPLLR--AMQWARRNLFSSIANSLLTLFCLWLLWIAIPPLLNWAIFQANWIGTTRN 65

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            CT            + ACW FI+ R+  F++G YP  + WR       G + + PM + 
Sbjct: 66  DCTR-----------DGACWVFIHARFGHFMYGLYPATEVWRINFALAIGLLSILPMFLK 114

Query: 137 SFPRKFLNSILLFGLFPIFSFFVLYGGLG-LSIVETSLWGGLLVTLVISFFGIIISMPLG 195
           + P +     +    +P+ ++++LYGG G LS VET  WGGL +TL+I+  GI  ++PLG
Sbjct: 115 TIPYRGRYIAVWTVAYPLIAWWLLYGGFGGLSRVETYQWGGLTLTLIIAAVGIAGALPLG 174

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           ILLALGR S +P++R   + FIE +RGVPL+TVLFM+S+MLPLFL +   +DKLLRAL+G
Sbjct: 175 ILLALGRRSTLPIVRMLSVVFIEFWRGVPLITVLFMSSVMLPLFLTEGTTIDKLLRALVG 234

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           V  F SAY+AEV+RGGLQ++ KGQ+EAA SLGL Y +   L+I+PQ +K VIPG+VNT I
Sbjct: 235 VILFQSAYVAEVVRGGLQALPKGQYEAAESLGLGYWRMQGLVILPQALKMVIPGLVNTII 294

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD+SL+ II +FDL   ++    + TW+     T G +F   V+WIFCFS+S YS  
Sbjct: 295 SLFKDTSLVIIIGLFDLFSSIQQATVDPTWLG--MSTEGYVFAAMVYWIFCFSMSRYSQH 352

Query: 376 IEKTLHKGSKK 386
           +E   + G   
Sbjct: 353 LENRFNTGHNS 363


>gi|238782938|ref|ZP_04626966.1| Inner membrane amino-acid ABC transporter permease protein yhdY
           [Yersinia bercovieri ATCC 43970]
 gi|238716141|gb|EEQ08125.1| Inner membrane amino-acid ABC transporter permease protein yhdY
           [Yersinia bercovieri ATCC 43970]
          Length = 369

 Score =  296 bits (759), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 166/357 (46%), Positives = 231/357 (64%), Gaps = 14/357 (3%)

Query: 28  IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQ 87
           ++ W  KN F +  + LLT L + L+   IP +++W   +A W+G++RT CT        
Sbjct: 22  MVFWARKNLFSSWSNSLLTLLCLWLMWQLIPPLLNWTIFNANWLGTSRTDCTR------- 74

Query: 88  PDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSIL 147
                 ACW FI+ R+ QF++G YP+ QRWR     + G + L P+   + PR+     +
Sbjct: 75  ----EGACWVFIHARFGQFMYGLYPIEQRWRINTTLIIGLLTLLPLFWRAMPRRGRYLAV 130

Query: 148 LFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNI 206
               +P+  + +LYGG LGLS VET  WGGL +TL+I+  GI  ++PLGILLAL R S++
Sbjct: 131 WIVAYPLLVWVMLYGGFLGLSRVETRQWGGLTLTLIIAAVGIAGALPLGILLALARRSSM 190

Query: 207 PVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAE 266
           PV+R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV  F SAY+AE
Sbjct: 191 PVVRILSVVFIEFWRGVPLITVLFMSSVMLPLFMTEGTSIDKLIRALVGVVLFQSAYVAE 250

Query: 267 VLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISI 326
           V+RGGLQ++ KGQ EAA SLGL Y +   L+I+PQ +K VIPG+VNT I LFKD+SL+ I
Sbjct: 251 VVRGGLQALPKGQTEAAESLGLGYWKTQGLVILPQALKMVIPGLVNTIIALFKDTSLVII 310

Query: 327 INMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKG 383
           I +FDL   V+    +  W+     T G +F   V+WIFCFS+S YS  +EK  H G
Sbjct: 311 IGLFDLFSSVQQATVDPAWLG--MSTEGYVFAATVYWIFCFSMSRYSQHLEKRFHTG 365


>gi|330814054|ref|YP_004358293.1| glutamate Aspartate transport system permease protein GltK
           [Candidatus Pelagibacter sp. IMCC9063]
 gi|327487149|gb|AEA81554.1| glutamate Aspartate transport system permease protein GltK
           [Candidatus Pelagibacter sp. IMCC9063]
          Length = 347

 Score =  296 bits (759), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 165/354 (46%), Positives = 228/354 (64%), Gaps = 14/354 (3%)

Query: 29  IAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQP 88
           I W  +N F   KD LLT  I+ L   SIP +++WVFLDA + G ++  CT    GG   
Sbjct: 4   INWSKQNLFANWKDSLLTITILYLFYVSIPPLLNWVFLDATFFGDSKKDCT----GG--- 56

Query: 89  DGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILL 148
                ACW FI    ++F +G YP  Q WR  L F+   I +      S   K    I L
Sbjct: 57  ----GACWVFINVWIKRFTYGMYPNDQIWRINLAFVIFFISIGSYFFVSSKIKKYIFIFL 112

Query: 149 FGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIP 207
             +FP  + F+ +GG LGL  VET +WGGL +TL IS F II   P+G+LLA+GR SN+P
Sbjct: 113 TLVFPFLAIFLFHGGSLGLEEVETRVWGGLFLTLFISVFSIIFCFPIGVLLAMGRRSNLP 172

Query: 208 VLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEV 267
           V++Y  I FIEL+RGVPL+TVLFMA++M P+FLP   ++DKL+R ++ ++ F SAYIAEV
Sbjct: 173 VIKYFSIGFIELWRGVPLITVLFMAAVMFPVFLPSGTNLDKLIRVIIAITLFESAYIAEV 232

Query: 268 LRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISII 327
           +RGGLQ+I +GQ++AANS+G+ Y +   LII+PQ +K VIPG+ NTFI LFKD+ LI ++
Sbjct: 233 VRGGLQAIPRGQYDAANSIGMGYWKSHLLIILPQALKIVIPGVANTFIALFKDTPLILVV 292

Query: 328 NMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
            + +LLG+V +  +   W+     T G +F  FV++IFCFS+S YS+ +E  L 
Sbjct: 293 GLMELLGMVNMAKTNPAWLG--LATEGYVFAAFVYFIFCFSMSRYSLSLENKLK 344


>gi|262404014|ref|ZP_06080569.1| amino acid ABC transporter permease protein [Vibrio sp. RC586]
 gi|262349046|gb|EEY98184.1| amino acid ABC transporter permease protein [Vibrio sp. RC586]
          Length = 279

 Score =  295 bits (756), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 146/281 (51%), Positives = 210/281 (74%), Gaps = 3/281 (1%)

Query: 107 IFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGL-G 165
           ++G YP A+ WRP L F+T +I +  +     P++    ++   ++P F+  +LYGG+ G
Sbjct: 1   MYGFYPAAELWRPRLFFITLAIFVALLAYEKTPKRGWIWLVFVNIYPFFAAILLYGGVFG 60

Query: 166 LSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPL 225
           L +VET  WGGLLVTL+I+  GII+S+P+G+ LALGR S++P++R  C  +IE++RGVPL
Sbjct: 61  LEVVETHKWGGLLVTLIIALVGIIVSLPIGVALALGRRSDMPIIRSLCTVYIEVWRGVPL 120

Query: 226 VTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANS 285
           +TVLFMAS+MLPLFL +  +++KLLRAL+GV  F++AY+AEV+RGGLQ+I KGQ+EAA++
Sbjct: 121 ITVLFMASVMLPLFLSEGSEINKLLRALIGVVMFSAAYMAEVIRGGLQAIPKGQYEAADA 180

Query: 286 LGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTW 345
           LGLSY +KM LII+PQ +K  IP IVNTFIGLFKD+SL+ II MFD+LGI +   ++  W
Sbjct: 181 LGLSYWKKMGLIILPQALKITIPSIVNTFIGLFKDTSLVLIIGMFDVLGIGQSANTDPNW 240

Query: 346 ISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
           +   T +   +F+  VFW+FCF +S YS+++E  LH G K+
Sbjct: 241 LGFATES--YVFVALVFWVFCFGMSRYSIWLEGKLHTGHKR 279


>gi|238794644|ref|ZP_04638250.1| Inner membrane amino-acid ABC transporter permease protein yhdY
           [Yersinia intermedia ATCC 29909]
 gi|238726033|gb|EEQ17581.1| Inner membrane amino-acid ABC transporter permease protein yhdY
           [Yersinia intermedia ATCC 29909]
          Length = 369

 Score =  295 bits (755), Expect = 8e-78,   Method: Compositional matrix adjust.
 Identities = 165/357 (46%), Positives = 231/357 (64%), Gaps = 14/357 (3%)

Query: 28  IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQ 87
           ++ W  KN F +  + LLT L + L+   IP +++W   +A W+G++RT CT        
Sbjct: 22  MVFWAKKNLFSSWTNSLLTLLCLWLMWQLIPPLLNWTIFNANWLGTSRTDCTR------- 74

Query: 88  PDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSIL 147
                 ACW FI+ R+ QF++G YP+ QRWR     L G + L P+   + PR+     +
Sbjct: 75  ----EGACWVFIHARFGQFMYGLYPIEQRWRINTTLLIGLLTLIPLFWRAMPRRGRYLAV 130

Query: 148 LFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNI 206
               +P+  + +LYGG LGL+ VET  WGGL +TL+I+  GI  ++PLGILLAL R S++
Sbjct: 131 WMVAYPLLVWLMLYGGFLGLTRVETRQWGGLTLTLIIAAVGIAGALPLGILLALARRSSM 190

Query: 207 PVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAE 266
           PV+R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV  F SAY+AE
Sbjct: 191 PVVRILSVVFIEFWRGVPLITVLFMSSVMLPLFMTEGTSIDKLIRALVGVVLFQSAYVAE 250

Query: 267 VLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISI 326
           V+RGGLQ++ +GQ EAA SLGL Y +   L+I+PQ +K VIPG+VNT I LFKD+SL+ I
Sbjct: 251 VVRGGLQALPRGQTEAAESLGLGYWKTQGLVILPQALKMVIPGLVNTIIALFKDTSLVII 310

Query: 327 INMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKG 383
           I +FDL   V+    +  W+     T G +F   V+WIFCFS+S YS  +EK  H G
Sbjct: 311 IGLFDLFSSVQQATVDPAWLG--MSTEGYVFAAAVYWIFCFSMSRYSQHLEKRFHTG 365


>gi|163854809|ref|YP_001629107.1| putative amino acid ABC transporter permease protein [Bordetella
           petrii DSM 12804]
 gi|163258537|emb|CAP40836.1| putative amino acid ABC transporter permease protein [Bordetella
           petrii]
          Length = 366

 Score =  295 bits (754), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 160/371 (43%), Positives = 238/371 (64%), Gaps = 23/371 (6%)

Query: 21  PPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTT 80
           PP  Q G+  W+ +  F +P  IL T L+  +LL ++P ++ W FL A +  +    C  
Sbjct: 14  PPRSQVGVWPWLKERLFSSPVSILATVLVAWILLMAVPALVEWAFLQADFTSTTSQECRK 73

Query: 81  VSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPR 140
            +           ACWAFI +++   +FG YP  ++WRP+L     +I+L  +++ S  R
Sbjct: 74  AA----------GACWAFIAEKHRLILFGTYPYDEQWRPLL----ATIILIGVIVCSGLR 119

Query: 141 KFLNS----ILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
           +F N+    I + GL  +    +++GG LGL+ VE SLWGGL +TL++S FGI  + P G
Sbjct: 120 RFWNARLALIWVVGLTAVA--VLMWGGVLGLTYVENSLWGGLPLTLILSTFGIAFAFPFG 177

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           +LLALGR S +P ++  C+ +IEL RGVPL+++LFM+S+MLPLFLP  + +DKLLRA + 
Sbjct: 178 VLLALGRKSKMPAIKALCVVYIELIRGVPLISLLFMSSVMLPLFLPVGFSIDKLLRAQIA 237

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           +  FA+AYIAE +RGGLQ+I KGQ+E A+SLGL+Y Q+MR II+PQ ++ VIP +V+ FI
Sbjct: 238 IIMFAAAYIAETVRGGLQAIPKGQYEGADSLGLNYWQQMRKIILPQALRIVIPPLVSIFI 297

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD+SL+ II +FDL    +   S++ W          +FI  ++++FCFS+S YS  
Sbjct: 298 ALFKDTSLVVIIGIFDLTLAAKAALSDAAWRG--FGVEAYVFISLIYFVFCFSMSKYSQR 355

Query: 376 IEKTLHKGSKK 386
           +EK L  G K+
Sbjct: 356 LEKRLATGHKR 366


>gi|153822068|ref|ZP_01974735.1| amino acid ABC transporter, permease protein [Vibrio cholerae B33]
 gi|126520401|gb|EAZ77624.1| amino acid ABC transporter, permease protein [Vibrio cholerae B33]
          Length = 279

 Score =  295 bits (754), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 147/281 (52%), Positives = 207/281 (73%), Gaps = 3/281 (1%)

Query: 107 IFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGL-G 165
           ++G YP A+ WRP L F T ++ +  +     P++    ++   ++P F+  +LYGG+ G
Sbjct: 1   MYGFYPAAELWRPRLFFFTLALFVALLAYEKTPKRGWIWLVFVNIYPFFAALLLYGGVFG 60

Query: 166 LSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPL 225
           L +VET  WGGLLVTL+I+  GII S+P+G+ LALGR S++P++R  C  +IE++RGVPL
Sbjct: 61  LEVVETHKWGGLLVTLIIALVGIIASLPIGVALALGRRSDMPIIRSLCTVYIEVWRGVPL 120

Query: 226 VTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANS 285
           +TVLFMAS+MLPLFL    ++DKLLRAL+GV  F++AY+AEV+RGGLQ+I KGQ+EAA++
Sbjct: 121 ITVLFMASVMLPLFLSQGSEIDKLLRALIGVVMFSAAYMAEVIRGGLQAIPKGQYEAADA 180

Query: 286 LGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTW 345
           LGLSY +KM LII+PQ +K  IP IVNTFIGLFKD+SL+ II MFD+LGI +   ++  W
Sbjct: 181 LGLSYWKKMGLIILPQALKITIPSIVNTFIGLFKDTSLVLIIGMFDVLGIGQSANTDPNW 240

Query: 346 ISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
           +   T +   +F+  VFWIFCF +S YS+++E  LH G K+
Sbjct: 241 LGFATES--YVFVALVFWIFCFGMSRYSIWLEGKLHTGHKR 279


>gi|188532409|ref|YP_001906206.1| Putative transport system permease protein [Erwinia tasmaniensis
           Et1/99]
 gi|188027451|emb|CAO95298.1| Putative transport system permease protein [Erwinia tasmaniensis
           Et1/99]
          Length = 366

 Score =  294 bits (753), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 158/356 (44%), Positives = 225/356 (63%), Gaps = 14/356 (3%)

Query: 29  IAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQP 88
           IAW  KN F +  + LLT L + ++  ++P  ++W+   A W G  RT C+         
Sbjct: 20  IAWARKNLFSSIGNSLLTLLCLWIMWEALPPALNWLVFQANWTGDTRTDCSK-------- 71

Query: 89  DGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILL 148
                ACW FI+ R+ Q ++G YP   RWR  L  + G + + PM + + PR+    I  
Sbjct: 72  ---EGACWVFIHARFGQLMYGLYPHELRWRINLALIVGLLSIVPMFLKNLPRRGSYIIGW 128

Query: 149 FGLFPIFSFFVLYGGLGL-SIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIP 207
             ++P+  + ++YGGL     VET  WGGL +TL+I+  GI  ++P G+LLALGR S +P
Sbjct: 129 AVVYPLLVWLLMYGGLLGLERVETRQWGGLTLTLIIAAVGIAGALPTGVLLALGRRSQMP 188

Query: 208 VLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEV 267
           V+R  C+ FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV  F SAY+AEV
Sbjct: 189 VVRTLCVLFIEFWRGVPLITVLFMSSVMLPLFMAEGSSIDKLIRALVGVILFQSAYVAEV 248

Query: 268 LRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISII 327
           +RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I LFKD+SL+ II
Sbjct: 249 VRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTIIALFKDTSLVIII 308

Query: 328 NMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKG 383
            +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  +E+  H G
Sbjct: 309 GLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQHLEQRFHTG 362


>gi|242241101|ref|YP_002989282.1| polar amino acid ABC transporter inner membrane subunit [Dickeya
           dadantii Ech703]
 gi|242133158|gb|ACS87460.1| polar amino acid ABC transporter, inner membrane subunit [Dickeya
           dadantii Ech703]
          Length = 362

 Score =  294 bits (752), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 164/366 (44%), Positives = 233/366 (63%), Gaps = 14/366 (3%)

Query: 22  PVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTV 81
           P      IAW  +N F +  + +LT + + LL   +P +++W    A WIG +R  CT  
Sbjct: 9   PTPVNNAIAWARRNLFSSVTNSILTLVCLWLLWELLPPLLNWAIFKASWIGDSRGDCT-- 66

Query: 82  SQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRK 141
                 PDG   ACW FI+ R+ QF++G YP  + WR     +   I + PM   + P +
Sbjct: 67  ------PDG---ACWVFIHARFSQFMYGLYPREEIWRINFALVLALISILPMFWRALPHR 117

Query: 142 FLNSILLFGLFPIFSFFVLYGGLG-LSIVETSLWGGLLVTLVISFFGIIISMPLGILLAL 200
                +   ++P+ ++++L+GG G L  VET  WGGL +T++I+  GI  ++PLGILLAL
Sbjct: 118 GRYIAVWCVVYPLLAWWLLFGGFGGLPRVETRQWGGLTLTIIIAAIGIAGALPLGILLAL 177

Query: 201 GRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFA 260
           GR SN+P+LR  C+ FIE +RGVPL+TVLFM+S+MLPLFL +  ++DKLLRAL+GV  F 
Sbjct: 178 GRRSNMPILRSLCVIFIEFWRGVPLITVLFMSSVMLPLFLTEGTNIDKLLRALVGVILFQ 237

Query: 261 SAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKD 320
           SAY+AEV+RGGLQ++ KGQ+EAA +L L Y +   L+I+PQ +K VIPG+VNT I LFKD
Sbjct: 238 SAYVAEVVRGGLQALPKGQYEAAQALALGYWRMQGLVILPQALKLVIPGLVNTIIALFKD 297

Query: 321 SSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTL 380
           +SL+ II +FDL   ++    + TW+     T G +F   ++WIFCFS+S YS  +EK  
Sbjct: 298 TSLVIIIGLFDLFSSIQQATVDPTWLG--MSTEGYVFAAILYWIFCFSMSRYSQHLEKRF 355

Query: 381 HKGSKK 386
             G K 
Sbjct: 356 DTGHKS 361


>gi|149908406|ref|ZP_01897069.1| amino acid ABC transporter, permease protein [Moritella sp. PE36]
 gi|149808569|gb|EDM68504.1| amino acid ABC transporter, permease protein [Moritella sp. PE36]
          Length = 370

 Score =  293 bits (751), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 161/375 (42%), Positives = 238/375 (63%), Gaps = 19/375 (5%)

Query: 6   KEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVF 65
           KE       + +    P   +G++ W+ +N F T  + LLT L    +  +IP ++ W+ 
Sbjct: 7   KEDNMAVYTMKEAKSAPSTSKGLVFWLRENLFSTIPNTLLTLLGFYFIYTTIPPLLDWMI 66

Query: 66  LDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLT 125
            DA W G+   V   V +G         A W FI ++++QF++G YP +  WRP LV + 
Sbjct: 67  FDATWSGTKEEV---VKEG---------ARWIFIIEKFDQFMYGFYPESLHWRPNLVAVI 114

Query: 126 GSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVIS 184
              L    L+P      +  +++  LFP   F ++ GG  GL +V T  WGGL++T++++
Sbjct: 115 S--LAFVFLVPRLKNIKVKLVIML-LFPFVCFVLISGGWFGLEVVGTEKWGGLMLTILVA 171

Query: 185 FFGIIISMPLGILLALGRNS-NIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDT 243
             GII S P+GILLALGR S N+P++++ CI FIE  RGVPL+T+LFMAS++LPLF  D 
Sbjct: 172 AVGIIASFPIGILLALGRQSDNMPIVKFLCIGFIEFIRGVPLITILFMASVVLPLFFSDG 231

Query: 244 WDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVI 303
            D DKLLRAL+G++ F +AYIAEV+RGGLQ+I KGQ+EA+ SLGL+Y Q M LII+PQ +
Sbjct: 232 IDFDKLLRALIGITLFQAAYIAEVIRGGLQAIPKGQYEASESLGLTYWQGMILIILPQAL 291

Query: 304 KRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFW 363
           K  IP +V +FI LFKD++L+ II +FD+L +V +  S++ W+       G +F+  ++W
Sbjct: 292 KISIPNLVGSFISLFKDTTLVLIIGLFDILAMVTLTNSDTNWLG--FEIEGYVFVTMIYW 349

Query: 364 IFCFSISLYSVFIEK 378
           +FCFS+S YS  IE+
Sbjct: 350 VFCFSMSQYSRVIER 364


>gi|317404418|gb|EFV84835.1| amino acid ABC transporter permease [Achromobacter xylosoxidans
           C54]
          Length = 367

 Score =  293 bits (751), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 162/371 (43%), Positives = 237/371 (63%), Gaps = 22/371 (5%)

Query: 21  PPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTT 80
           PP    G  AW+    F +P +IL+T L+   LL S+P ++ W F+ A +  +N   C  
Sbjct: 14  PPKTHVGAWAWLRSRLFSSPLNILITVLLAWFLLMSVPALVEWAFIKANFTAANAQECRA 73

Query: 81  VSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPR 140
            S GG        ACWAFI +++   +FG YP  ++WRP    L  +I+L  +++ S  R
Sbjct: 74  -SVGG--------ACWAFIIEKHRLILFGTYPYDEQWRP----LIATIILVAVIVCSGIR 120

Query: 141 KFLN----SILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
           +F N     I   GL  +    +++GG LGL+ VE + WGGL +TL++S FGI  + P+G
Sbjct: 121 RFWNWKLAIIWTVGLTAVA--ILMWGGVLGLTYVENARWGGLPLTLILSTFGIAFAFPIG 178

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           +LLALGR S +P ++  C+ +IEL RGVPL+++LFM+S+MLPLFLP+ + +DKLLRA + 
Sbjct: 179 VLLALGRRSKMPAIKALCVVYIELIRGVPLISLLFMSSVMLPLFLPEGFSIDKLLRAQIA 238

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           +  FA+AYIAE +RGGLQ+I KGQ+E A+SLGL+Y Q+MR II+PQ +K VIP +V+ FI
Sbjct: 239 IIMFAAAYIAETVRGGLQAIPKGQYEGADSLGLNYWQQMRKIILPQALKIVIPPLVSIFI 298

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD+SL+ II +FDL    +   S++ W          +FI  ++++FCFS+S YS  
Sbjct: 299 ALFKDTSLVVIIGIFDLTLAAKAALSDAAWRG--FGVEAYLFISLIYFVFCFSMSKYSQA 356

Query: 376 IEKTLHKGSKK 386
           +EK L  G  +
Sbjct: 357 LEKRLATGHAR 367


>gi|319778957|ref|YP_004129870.1| Glutamate Aspartate transport system permease protein GltK
           [Taylorella equigenitalis MCE9]
 gi|317108981|gb|ADU91727.1| Glutamate Aspartate transport system permease protein GltK
           [Taylorella equigenitalis MCE9]
          Length = 356

 Score =  293 bits (751), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 163/371 (43%), Positives = 236/371 (63%), Gaps = 19/371 (5%)

Query: 19  SLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVC 78
           SL      G   W+ KN F +P  I+ T LI+  L+FSIP ++ W+F+DA +  +    C
Sbjct: 2   SLAMTSHSGPWYWLRKNLFASPAHIIATVLILWFLIFSIPLLVDWLFIDANFDATKAADC 61

Query: 79  TTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSF 138
              +           ACW+F+  +Y   +FG YP  ++WRP +V L   +L+  ++  + 
Sbjct: 62  RDSA----------GACWSFVRHKYRMILFGLYPYFEQWRPFVVTL---LLIAVLIYSAL 108

Query: 139 PRKFLNSILLFGLFPIFSF--FVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
           PR + N  L+F    + +    ++YGG+ GLS VET+ WGGL +TL++S FGI+ + PLG
Sbjct: 109 PRAW-NRSLIFVWLVVLTICGILMYGGVFGLSHVETARWGGLPITLMLSIFGIMFATPLG 167

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           I+LALGR S++P++R    ++IEL RGVP V++LFMAS+M+PLF P+    +KLLRA L 
Sbjct: 168 IILALGRRSHMPLIRALSTSYIELVRGVPFVSLLFMASVMVPLFFPEGVTFNKLLRAQLA 227

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           V  + SAYIAEV+RGGLQSI KGQ+E A SLGLSY Q MRLII+PQ +  VIP +V+ FI
Sbjct: 228 VIIYMSAYIAEVVRGGLQSIPKGQYEGAKSLGLSYWQYMRLIILPQALTVVIPPLVSIFI 287

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            +FKD+SL+ II ++DL    +V  S+  W  S       +F+ F+++IFCF++S YS +
Sbjct: 288 SIFKDTSLVVIIGIYDLTLSAKVALSDPQW--SGLGLEAYVFLAFIYFIFCFAMSKYSRY 345

Query: 376 IEKTLHKGSKK 386
           IE  L  G + 
Sbjct: 346 IEARLRTGHRH 356


>gi|330950962|gb|EGH51222.1| amino acid ABC transporter permease [Pseudomonas syringae Cit 7]
          Length = 279

 Score =  293 bits (749), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 146/281 (51%), Positives = 203/281 (72%), Gaps = 3/281 (1%)

Query: 107 IFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGG-LG 165
           ++G +P   RWR  L  +   +   P+ I  FPRK +  I    ++P+ +F++L+GG  G
Sbjct: 1   MYGYFPNELRWRVDLTAILAIVGAAPLFISKFPRKAVYGIAFLVIYPVVAFYLLHGGAFG 60

Query: 166 LSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPL 225
           L+ V TS WGGL++TLVI+  GI+ ++PLGI+LALGR SN+P +R  C+TFIE +RGVPL
Sbjct: 61  LTNVPTSQWGGLMLTLVIATVGIVGALPLGIVLALGRRSNMPAVRVVCVTFIEFWRGVPL 120

Query: 226 VTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANS 285
           +TVLFM+S+MLPLF+P+  + DKLLRAL+GV  F SAYIAEV+RGG+Q+I KGQ+EAA++
Sbjct: 121 ITVLFMSSVMLPLFMPEGMNFDKLLRALIGVILFQSAYIAEVVRGGMQAIPKGQYEAASA 180

Query: 286 LGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTW 345
           +GL Y + M L+I+PQ +K VIPGIVNTFI LFKD+SL+ II +FDLL  V+   ++  W
Sbjct: 181 MGLGYWRSMGLVILPQALKMVIPGIVNTFIALFKDTSLVIIIGLFDLLNSVKQATADPAW 240

Query: 346 ISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
           +     T G +F   VFWIFCF +S YS+ +E+ L  G K+
Sbjct: 241 LG--MATEGYVFAALVFWIFCFGMSRYSMHLERKLDTGHKR 279


>gi|227113999|ref|ZP_03827655.1| L-amino acid ABC transporter permease protein [Pectobacterium
           carotovorum subsp. brasiliensis PBR1692]
          Length = 362

 Score =  292 bits (748), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 159/359 (44%), Positives = 224/359 (62%), Gaps = 14/359 (3%)

Query: 29  IAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQP 88
           + W  +N F +  + LLT   + LL  +IP +++W    A WIG+ R  CT         
Sbjct: 16  MQWARRNLFSSISNSLLTLFCLWLLWVAIPPLLNWAIFQANWIGTTRNDCTR-------- 67

Query: 89  DGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILL 148
                ACW FI+ R+  F++G YP  + WR         + + PM + + P +     + 
Sbjct: 68  ---EGACWVFIHARFGHFMYGLYPAEEVWRINFALAIALLSILPMFLKTIPYRGRYIAVW 124

Query: 149 FGLFPIFSFFVLYGGLG-LSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIP 207
              +P+ ++++LY G G LS VET  WGGL +TL+I+  GI  ++PLGILLALGR S +P
Sbjct: 125 TVAYPLIAWWLLYSGFGGLSRVETYQWGGLTLTLIIAAVGIAGALPLGILLALGRRSTLP 184

Query: 208 VLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEV 267
           ++R   + FIE +RGVPL+TVLFM+S+MLPLFL +   +DKLLRAL+GV  F SAY+AEV
Sbjct: 185 IVRMLSVIFIEFWRGVPLITVLFMSSVMLPLFLTEGTTIDKLLRALVGVILFQSAYVAEV 244

Query: 268 LRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISII 327
           +RGGLQ++ KGQ+EAA SLGL Y +   L+I+PQ +K VIPG+VNT I LFKD+SL+ II
Sbjct: 245 VRGGLQALPKGQYEAAESLGLGYWRMQGLVILPQALKMVIPGLVNTIISLFKDTSLVIII 304

Query: 328 NMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
            +FDL   ++    + TW+     T G +F   V+WIFCFS+S YS  +E   + G K 
Sbjct: 305 GLFDLFSSIQQATVDPTWLG--MSTEGYVFAAMVYWIFCFSMSRYSQHLENRFNTGHKS 361


>gi|258545566|ref|ZP_05705800.1| general amino acid ABC superfamily ATP binding cassette
           transporter, permease protein [Cardiobacterium hominis
           ATCC 15826]
 gi|258519266|gb|EEV88125.1| general amino acid ABC superfamily ATP binding cassette
           transporter, permease protein [Cardiobacterium hominis
           ATCC 15826]
          Length = 339

 Score =  292 bits (747), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 164/345 (47%), Positives = 224/345 (64%), Gaps = 17/345 (4%)

Query: 37  FGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACW 96
           F +P   +LT L + LL   +P +  W    A + GS    CT+             ACW
Sbjct: 2   FASPVHAVLTVLALYLLYRIVPQLFLWALWLADFRGSTAADCTS-----------GGACW 50

Query: 97  AFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFGLF--PI 154
            FI  R  QF++G YP ++RWR  L+FL G    T + +     K     LLF L   P+
Sbjct: 51  VFIKVRLSQFLYGFYPESERWRVWLLFL-GITPATFLALWCCEGKKRLWALLFALLVLPV 109

Query: 155 FSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYAC 213
            S+++L GG+ GL  V  +LWGG+++TLV++  G++ S+P GILLALGR S++P LR  C
Sbjct: 110 LSWYLLRGGVFGLPEVRPNLWGGMMLTLVVASAGLLFSLPFGILLALGRTSDMPFLRGVC 169

Query: 214 ITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQ 273
           + FIEL+RGVPLVTVLFMA++MLPLFLP +W +D L+RAL+GV+ FASAY+AEV+RGGLQ
Sbjct: 170 VAFIELWRGVPLVTVLFMANVMLPLFLPPSWHIDNLMRALIGVALFASAYMAEVVRGGLQ 229

Query: 274 SISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLL 333
           +I +GQFEAA+SLGL Y  KMRLII+PQ +  VIPGI NTF+GLFKD++L+SII ++D L
Sbjct: 230 AIPRGQFEAADSLGLGYWAKMRLIILPQALTTVIPGITNTFVGLFKDTTLVSIIGLYDFL 289

Query: 334 GIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEK 378
           GIV     +  W+       G  F   V+++ C+ +S  S  IE+
Sbjct: 290 GIVHSAGQDPAWLGH--GMEGYAFCALVYFLLCYGMSHTSYRIER 332


>gi|187479526|ref|YP_787551.1| L-amino acid ABC transporter permease [Bordetella avium 197N]
 gi|115424113|emb|CAJ50666.1| L-amino acid ABC transporter, permease protein [Bordetella avium
           197N]
          Length = 366

 Score =  291 bits (745), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 159/369 (43%), Positives = 236/369 (63%), Gaps = 19/369 (5%)

Query: 21  PPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTT 80
           PP+   G+  W+    F +P  IL T ++  L+L ++P +I W F+ A +  +    C  
Sbjct: 14  PPMGHTGVWPWLKSRLFSSPLSILTTVILAWLILMAVPALIEWAFIRANFSATTAQECR- 72

Query: 81  VSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPR 140
            + GG        ACWAFI +++   +FG YP  ++WRP    L  + +L  +++ S  R
Sbjct: 73  -ASGG--------ACWAFIVEKHRLILFGTYPYDEQWRP----LIATFILIAVIVLSGMR 119

Query: 141 KFLNSILLFGLFPIFSF--FVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPLGIL 197
           +F   IL        S    +++GG+ GL+ VE S WGGL +TL++S FGI  + P+G+L
Sbjct: 120 RFWRPILALIWVVGLSLVAILMWGGVFGLTFVENSRWGGLPLTLILSTFGIAFAFPIGVL 179

Query: 198 LALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVS 257
           LALGR SN+P ++  C+ +IEL RGVPL+++LFM+S+MLPLFLP+ + +DKLLRA + + 
Sbjct: 180 LALGRRSNMPAIKALCVVYIELIRGVPLISLLFMSSVMLPLFLPEGFSIDKLLRAQIAII 239

Query: 258 AFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGL 317
            FA+AYIAE +RGGLQ+ISKGQ+E A+SLGLSY QKMR II+PQ +K VIP +V+ FI L
Sbjct: 240 LFAAAYIAETVRGGLQAISKGQYEGADSLGLSYWQKMRKIILPQALKVVIPPLVSIFIAL 299

Query: 318 FKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIE 377
           FKD+SL+ II +FDL    +   S++ W          +FI  ++++FCFS+S YS  +E
Sbjct: 300 FKDTSLVVIIGIFDLTLAAKAALSDAAWRG--FGIEAYLFISLIYFVFCFSMSKYSQHLE 357

Query: 378 KTLHKGSKK 386
           + L  G ++
Sbjct: 358 RRLATGHQR 366


>gi|311109072|ref|YP_003981925.1| general L-amino acid transporter permease AAPM [Achromobacter
           xylosoxidans A8]
 gi|310763761|gb|ADP19210.1| general L-amino acid transport system permease protein AAPM
           [Achromobacter xylosoxidans A8]
          Length = 366

 Score =  291 bits (744), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 159/371 (42%), Positives = 237/371 (63%), Gaps = 23/371 (6%)

Query: 21  PPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTT 80
           PP    G  AW+    F +P +IL+T L+   LL ++P ++ W F+ A +  +N   C  
Sbjct: 14  PPSTHVGFWAWLKSRLFSSPLNILITVLLAWFLLMAVPALVEWAFIKANFSATNAQECR- 72

Query: 81  VSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPR 140
            + GG        ACWAFI +++   +FG YP  ++WRP    L  +++L  +++ S  R
Sbjct: 73  -ASGG--------ACWAFIIEKHRLILFGTYPFDEQWRP----LIATVILVAVIVCSGIR 119

Query: 141 KFLN----SILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
           +F N     I   GL  +    +++GG+ GLS VE + WGGL +TL++S FGI  + P+G
Sbjct: 120 RFWNWKLAVIWTVGLTAVA--LLMWGGVFGLSYVENARWGGLPLTLILSTFGIAFAFPIG 177

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           +LLALGR S +P ++  C+ +IEL RGVPL+++LFM+S+MLPLFLP+ + +DKLLRA + 
Sbjct: 178 VLLALGRRSKMPAIKALCVVYIELIRGVPLISLLFMSSVMLPLFLPEGFSIDKLLRAQIA 237

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           +  FA+AYIAE +RGGLQ+I KGQ+E A+SLGL+Y Q+MR II+PQ +K VIP +V+ FI
Sbjct: 238 IIMFAAAYIAETVRGGLQAIPKGQYEGADSLGLNYWQQMRKIILPQALKIVIPPLVSIFI 297

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD+SL+ II +FDL    +   S++ W          +FI  ++++FCFS+S YS  
Sbjct: 298 ALFKDTSLVVIIGIFDLTLAAKAALSDAAWRG--FGVEAYLFISLIYFVFCFSMSKYSQA 355

Query: 376 IEKTLHKGSKK 386
           +EK L  G  +
Sbjct: 356 LEKRLATGHAR 366


>gi|293605348|ref|ZP_06687733.1| general amino acid ABC superfamily ATP binding cassette
           transporter, permease protein [Achromobacter piechaudii
           ATCC 43553]
 gi|292816287|gb|EFF75383.1| general amino acid ABC superfamily ATP binding cassette
           transporter, permease protein [Achromobacter piechaudii
           ATCC 43553]
          Length = 367

 Score =  290 bits (741), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 156/369 (42%), Positives = 231/369 (62%), Gaps = 18/369 (4%)

Query: 21  PPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTT 80
           PP  Q G  AW+      +P +IL+T L+   L+ S+P ++ W FL A +  +N   C  
Sbjct: 14  PPSTQVGAWAWVRSRLLSSPLNILITVLLAWFLMMSLPALVEWAFLKANFTATNAMECRA 73

Query: 81  VSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPR 140
            S GG        ACWAFI +++   +FG YP  ++WRP    L  +++L  +++ S  R
Sbjct: 74  -SAGG--------ACWAFIIEKHRLILFGTYPFDEQWRP----LIATLILIAVIVCSGMR 120

Query: 141 KFLNSILLF---GLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGIL 197
           +F N  L     G     +  +  G  GL+ VE S WGGL +TL+++ FGI  + P+G+L
Sbjct: 121 RFWNGKLALIWTGGLTAVALLMWGGVFGLTYVENSRWGGLPLTLILATFGIAFAFPIGVL 180

Query: 198 LALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVS 257
           LALGR S +P ++  C+ +IEL RGVPL+++LFM+S+MLPLFLP+ + +DKLLRA + + 
Sbjct: 181 LALGRRSKMPAIKALCVVYIELIRGVPLISLLFMSSVMLPLFLPEGFTIDKLLRAQIAII 240

Query: 258 AFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGL 317
            FA+AYIAE +RGGLQ+I KGQ+E A+SLGL+Y Q+MR II+PQ +K VIP +V  FI L
Sbjct: 241 MFAAAYIAETVRGGLQAIPKGQYEGADSLGLNYWQQMRKIILPQALKIVIPPLVGIFISL 300

Query: 318 FKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIE 377
           FKD+SL+ II +FDL    +   S++ W          +FI  ++++FC+S+S YS  +E
Sbjct: 301 FKDTSLVVIIGIFDLTLAAKAALSDAAWRG--FGVEAYLFISLIYFVFCYSMSKYSQALE 358

Query: 378 KTLHKGSKK 386
           + L  G  +
Sbjct: 359 QRLATGHAR 367


>gi|182678575|ref|YP_001832721.1| polar amino acid ABC transporter, inner membrane subunit
           [Beijerinckia indica subsp. indica ATCC 9039]
 gi|182634458|gb|ACB95232.1| polar amino acid ABC transporter, inner membrane subunit
           [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 385

 Score =  288 bits (738), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 160/384 (41%), Positives = 241/384 (62%), Gaps = 17/384 (4%)

Query: 10  YVRKRLLQPSLPPVYQR-GIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDA 68
           Y+R+    P LPP   R  ++  I + FF +    LLT     L+L+ +P ++ +  +DA
Sbjct: 12  YLRQES-APLLPPPKDRTSLLERIRRGFFSSLSSSLLTLAAGALILWLLPDLLRFTLIDA 70

Query: 69  VWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSI 128
           VW   +   C     G         ACWAF+  +   F FG+YP+A+RWR + V L G +
Sbjct: 71  VWSAPDGAACRAPDAG---------ACWAFVAQKLPYFTFGSYPVAERWRVVTVLLLGFV 121

Query: 129 LLTPMLIP----SFPRKFLNSILLFGLFPIFSFFVLYGG--LGLSIVETSLWGGLLVTLV 182
           L+  +L P    +   K + ++L F L+P+ +  +L G   LGL +V+T LWGG+ ++LV
Sbjct: 122 LIAWLLWPIRKGAHTDKRVAALLFFLLYPLIALILLRGTPWLGLPLVDTDLWGGIFLSLV 181

Query: 183 ISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPD 242
           ++  GI++S+PLGI LALGR S +PV+  A   FIE  RGVP++TVLFMA+ MLPLFLP 
Sbjct: 182 VAGVGIVVSLPLGIFLALGRRSTLPVVSLASTLFIEFVRGVPMITVLFMANFMLPLFLPA 241

Query: 243 TWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQV 302
           +  VD+L+R L+GV+ FASAY+AEV+RGGLQ++ KGQFE A +LGL   + ++L+++PQ 
Sbjct: 242 SMSVDRLIRPLIGVALFASAYMAEVVRGGLQAVPKGQFEGAAALGLPPWKTLQLVVLPQA 301

Query: 303 IKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVF 362
           +  VIPGIVNTFIGLFKD++L++ + +FD L  V     +  W       +G +F    +
Sbjct: 302 LAHVIPGIVNTFIGLFKDTTLVAAVGIFDFLRTVDSARLDPAWAGPTISASGYLFAALFY 361

Query: 363 WIFCFSISLYSVFIEKTLHKGSKK 386
           ++FCF +S YS+ +E+ L +G  +
Sbjct: 362 FVFCFGMSRYSIGVERRLARGQAR 385


>gi|209966387|ref|YP_002299302.1| general L-amino acid transport system permease protein AapM
           [Rhodospirillum centenum SW]
 gi|209959853|gb|ACJ00490.1| general L-amino acid transport system permease protein AapM
           [Rhodospirillum centenum SW]
          Length = 365

 Score =  288 bits (738), Expect = 8e-76,   Method: Compositional matrix adjust.
 Identities = 155/363 (42%), Positives = 227/363 (62%), Gaps = 19/363 (5%)

Query: 27  GIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGI 86
           G +AW+  N F T  + LLT L++ +   ++PG+I W   DAVWI  +   C    Q G 
Sbjct: 19  GPLAWMRANLFSTWYNALLTLLVLWVAAQALPGVIAWALRDAVWIADDAAAC---RQAG- 74

Query: 87  QPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNS- 145
                  ACWAFI ++    +FG YP  Q WRP +  L     +  ML+ S  R+     
Sbjct: 75  ------GACWAFIAEKARFILFGTYPYQQHWRPAVAMLA----VIAMLLASADRRLWGRP 124

Query: 146 -ILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRN 203
            +L++GL    +  +++GG  GL  V T+ WGGL +TL ++  G+ ++ P  ILLALGR 
Sbjct: 125 LLLVWGLGLGVAGALMFGGFAGLDYVPTARWGGLPLTLALAVVGLAVAFPFSILLALGRT 184

Query: 204 SNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAY 263
            ++PV++  C+ +IE  RGVPL+++LFMAS+M PLFLP    VDKLLRA +G+  FA+AY
Sbjct: 185 GDLPVVKAICVVYIEAVRGVPLISILFMASVMFPLFLPQGVTVDKLLRAQVGLILFAAAY 244

Query: 264 IAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSL 323
           +AEV+RGGLQ+I KGQ+EAA +LGLSY Q+ RLII+PQ +  VIP +VNTFIG FKD+SL
Sbjct: 245 LAEVVRGGLQAIPKGQYEAAAALGLSYWQRTRLIILPQALGLVIPPLVNTFIGFFKDTSL 304

Query: 324 ISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKG 383
           + II + DLL   +   ++  W          +F+  +++ FCF++S YS+ +E+T  +G
Sbjct: 305 VIIIGLMDLLSTAKTALTDPAWRGFY--KEAYLFVAAIYFTFCFALSRYSMHLERTFSQG 362

Query: 384 SKK 386
            ++
Sbjct: 363 RRR 365


>gi|218658873|ref|ZP_03514803.1| general L-amino acid ABC transporter, permease protein [Rhizobium
           etli IE4771]
          Length = 216

 Score =  286 bits (732), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 141/191 (73%), Positives = 165/191 (86%)

Query: 161 YGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELF 220
           YGG GL +VET LWGGLLVTLV+SF GI +S PLGI+LALGR S +PV+R  CI FIE+ 
Sbjct: 26  YGGFGLEVVETPLWGGLLVTLVLSFVGIAVSFPLGIILALGRRSQMPVIRTVCIVFIEVV 85

Query: 221 RGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQF 280
           RGVPL+TVLFMAS+MLPLFLP  W VDKLLRA++GVS FASAY+AEV+RGGLQ+I KGQF
Sbjct: 86  RGVPLITVLFMASVMLPLFLPAGWTVDKLLRAIIGVSIFASAYMAEVIRGGLQAIPKGQF 145

Query: 281 EAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNF 340
           E A+SLGL Y QKMRL+IMPQ IK VIPGIVNTFIG+FKD+SL+SII+MFDLLGIVR+NF
Sbjct: 146 EGADSLGLGYWQKMRLVIMPQAIKLVIPGIVNTFIGMFKDTSLVSIISMFDLLGIVRLNF 205

Query: 341 SESTWISSVTP 351
            +  W ++VTP
Sbjct: 206 VDPNWATAVTP 216


>gi|33594683|ref|NP_882327.1| putative amino acid ABC transporter permease protein [Bordetella
           pertussis Tohama I]
 gi|33598477|ref|NP_886120.1| putative amino acid ABC transporter permease protein [Bordetella
           parapertussis 12822]
 gi|33603420|ref|NP_890980.1| putative amino acid ABC transporter permease protein [Bordetella
           bronchiseptica RB50]
 gi|33564759|emb|CAE44084.1| putative amino acid ABC transporter permease protein [Bordetella
           pertussis Tohama I]
 gi|33574606|emb|CAE39256.1| putative amino acid ABC transporter permease protein [Bordetella
           parapertussis]
 gi|33577544|emb|CAE34809.1| putative amino acid ABC transporter permease protein [Bordetella
           bronchiseptica RB50]
          Length = 366

 Score =  286 bits (731), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 158/369 (42%), Positives = 239/369 (64%), Gaps = 19/369 (5%)

Query: 21  PPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTT 80
           PP    G+  W+    F +P  IL T L+  L+L ++P ++ W       IG+N T   T
Sbjct: 14  PPSGHVGVWHWLRTRLFSSPLSILATVLLAWLVLMAVPALVEWAL-----IGANFT--AT 66

Query: 81  VSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPR 140
            +Q   Q +G   ACWAFI +++   +FG YP  ++WRP+L     +I+L  +++ S  R
Sbjct: 67  SAQECRQSEG---ACWAFIVEKHRLILFGTYPYDEQWRPLL----ATIILIAVIVCSGMR 119

Query: 141 KFLN-SILLFGLFPIFSFFVL-YGG-LGLSIVETSLWGGLLVTLVISFFGIIISMPLGIL 197
           +F   S+ L  +  + +  VL +GG LGL+ VE + WGGL +TL+++ FGI ++ P G+L
Sbjct: 120 RFWKPSLALVWIVGLSAVAVLMWGGVLGLTYVENARWGGLPLTLILATFGIALAFPFGVL 179

Query: 198 LALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVS 257
           LALGR S +P ++  C+ +IEL RGVPL+++LFM+S+MLPLFLP+ + +DKLLRA + + 
Sbjct: 180 LALGRRSRMPAIKALCVVYIELIRGVPLISLLFMSSVMLPLFLPEGFSIDKLLRAQIAII 239

Query: 258 AFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGL 317
            FA+AYIAE +RGGLQ+I KGQ+E A+SLGL+Y Q+MR +I+PQ +K VIP +V+ FI L
Sbjct: 240 MFAAAYIAETVRGGLQAIPKGQYEGADSLGLTYWQQMRKVILPQALKIVIPPLVSIFIAL 299

Query: 318 FKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIE 377
           FKD+SL+ II +FDL    +   S++ W          +FI  ++++FCFS+S YS  +E
Sbjct: 300 FKDTSLVVIIGIFDLTLAAKAALSDAAWRG--FGVEAYVFIALIYFVFCFSMSKYSQALE 357

Query: 378 KTLHKGSKK 386
             L  G ++
Sbjct: 358 HRLATGHQR 366


>gi|293602097|ref|ZP_06684550.1| amino acid ABC superfamily ATP binding cassette transporter,
           permease protein [Achromobacter piechaudii ATCC 43553]
 gi|292819499|gb|EFF78527.1| amino acid ABC superfamily ATP binding cassette transporter,
           permease protein [Achromobacter piechaudii ATCC 43553]
          Length = 366

 Score =  285 bits (729), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 159/371 (42%), Positives = 235/371 (63%), Gaps = 23/371 (6%)

Query: 21  PPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTT 80
           PP    G   W+    F +P +IL+T L+   LL ++P ++ W F  A +  +N   C  
Sbjct: 14  PPSTHVGAWPWLKARLFSSPLNILITVLLAWFLLMAVPALLEWAFFKADFNAANAQECR- 72

Query: 81  VSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPR 140
            + GG        ACWAFI +++   +FG YP  ++WRP    L  +I+L  ++I S  R
Sbjct: 73  -ASGG--------ACWAFIIEKHRLILFGTYPFDEQWRP----LIATIILVGVIICSGIR 119

Query: 141 KFLN----SILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
            F N    +I   GL  +    +++GG+ GL+ VE + WGGL +TL++S FGI  + P+G
Sbjct: 120 YFWNWKLAAIWTVGLTAVA--LLMWGGVFGLTYVENARWGGLPLTLILSTFGIAFAFPIG 177

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           +LLALGR S +P ++  C+ +IEL RGVPL+++LFM+S+MLPLFLP+ + +DKLLRA + 
Sbjct: 178 VLLALGRRSKMPAIKALCVVYIELIRGVPLISLLFMSSVMLPLFLPEGFSIDKLLRAQIA 237

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           +  FA+AYIAE +RGGLQ+I KGQ+E A+SLGL+Y Q+MR II+PQ +K VIP +V+ FI
Sbjct: 238 IILFAAAYIAETVRGGLQAIPKGQYEGADSLGLNYWQQMRKIILPQALKIVIPPLVSIFI 297

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD+SL+ II +FDL    +   S++ W          +FI  ++++FCFS+S YS  
Sbjct: 298 ALFKDTSLVVIIGIFDLTLAAKAALSDAAWRG--FGVEAYLFISAIYFVFCFSMSKYSQA 355

Query: 376 IEKTLHKGSKK 386
           +EK L    K+
Sbjct: 356 LEKRLATDHKR 366


>gi|254469494|ref|ZP_05082899.1| amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine [Pseudovibrio sp. JE062]
 gi|211961329|gb|EEA96524.1| amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine [Pseudovibrio sp. JE062]
          Length = 372

 Score =  282 bits (722), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 161/389 (41%), Positives = 247/389 (63%), Gaps = 25/389 (6%)

Query: 4   SCKEFPYVRKRLLQPSLPPVY-QRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIH 62
           S   F YV     +P LPP     G + W  +N F +P + +LT + + ++  ++PGI +
Sbjct: 2   SENTFAYVATSE-KPQLPPPQGTTGAVGWARENLFSSPLNTILTLVSVFVVFSTVPGIFN 60

Query: 63  WVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILV 122
           W F+++VW  ++   C  +++        N ACWA I +RY QF+FG YP    WRPIL 
Sbjct: 61  WAFVNSVWNANSLDECRALTE--------NGACWAVIRERYHQFLFGFYPTELYWRPILA 112

Query: 123 FLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLV 182
           F+   + L P L    P++   +++    +P  +F++++GG GL  V ++  GGLL+T++
Sbjct: 113 FVLLFVALVPALWDGMPKRG-AALMASMTYPFVAFWLIWGGFGLEPVSSTKLGGLLLTMI 171

Query: 183 ISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPD 242
           I   GI  S+P+GI+LAL R+SN+P+++   + FIE  RGVPL+T+LF+A ++L  FLP 
Sbjct: 172 IGVSGISFSLPIGIVLALSRSSNLPIVKSLAVIFIEFIRGVPLITLLFVAHVLLNYFLPK 231

Query: 243 TWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQV 302
             + D +LR ++ V+ FASAY+AEV+RGGL ++ KGQ+EAA++LGLSY Q MRLII+PQ 
Sbjct: 232 GVNFDIVLRVVIMVTLFASAYMAEVIRGGLAALPKGQYEAADALGLSYWQSMRLIILPQA 291

Query: 303 IKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGF-- 360
           +K  IPGIVNTFIGLFKD++L+ II + D LG+V    ++  W          IF+    
Sbjct: 292 LKISIPGIVNTFIGLFKDTTLVLIIGLMDPLGLVAPTLADQRWNG--------IFVELYA 343

Query: 361 ----VFWIFCFSISLYSVFIEKTLHKGSK 385
               +F+IFCF++S YS+++E+ LH G +
Sbjct: 344 FIAFMFFIFCFAMSRYSMYLERKLHTGHR 372


>gi|89901104|ref|YP_523575.1| amino acid ABC transporter permease [Rhodoferax ferrireducens T118]
 gi|89345841|gb|ABD70044.1| Amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine [Rhodoferax ferrireducens T118]
          Length = 367

 Score =  281 bits (719), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 154/371 (41%), Positives = 233/371 (62%), Gaps = 24/371 (6%)

Query: 22  PVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTV 81
           PV   G +AW+  N     K  L T ++  +LL+ +P I++W    A W+  N   C   
Sbjct: 15  PVDTEGPVAWVKANLLADWKTTLATLIVGGVLLWLVPQILNWAVFKAAWL-PNYEACRAP 73

Query: 82  SQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRK 141
             G         ACW  I ++Y   IFG YP  ++WRP    L  ++LLT +L+ S  R 
Sbjct: 74  GVG---------ACWGVIAEKYRVIIFGRYPFEEQWRP----LIATVLLTGLLVASCVRM 120

Query: 142 FLNSIL-LFGLFPIFSFFVL-YGG-LGLSIVETSLWGGLLVTLVISFFGIIISMPLGILL 198
           F  + L L  +  + +FF L YG  LGL+ V+T  WGGL +T++++   +++S P+ +L+
Sbjct: 121 FWKTWLPLLWVVVLAAFFTLMYGNSLGLTQVDTDRWGGLPLTILLASLSLVMSFPIALLV 180

Query: 199 ALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSA 258
           ALGR S++P +R  C  ++EL RGVPL++VLFMAS M PLF+P  + +D L+R L+G++ 
Sbjct: 181 ALGRRSSLPAIRSFCTIYVELIRGVPLISVLFMASFMFPLFMPQGFKIDVLIRVLVGITL 240

Query: 259 FASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLF 318
           FA+AY AEV+RGGLQ+I KGQ EAA +LGLSY Q  R I++PQ +  V+PGI+N FI  F
Sbjct: 241 FAAAYSAEVIRGGLQAIPKGQVEAAATLGLSYWQTQRKIVLPQALAMVVPGIMNNFISTF 300

Query: 319 KDSSLISIINMFDLLGIVRVNF-SESTWISSVTPTT--GLIFIGFVFWIFCFSISLYSVF 375
           KD+SL++I+++++L G + +   S+S W     P T  G IFI  ++++FCFS+S YS +
Sbjct: 301 KDTSLVTIVSLYELTGAMSLALNSDSNW----RPFTIEGYIFIALIYFVFCFSMSRYSHW 356

Query: 376 IEKTLHKGSKK 386
           +EK ++K   +
Sbjct: 357 VEKQVNKSKLR 367


>gi|330945316|gb|EGH46938.1| amino acid ABC transporter permease [Pseudomonas syringae pv. pisi
           str. 1704B]
          Length = 252

 Score =  281 bits (718), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 140/253 (55%), Positives = 190/253 (75%), Gaps = 3/253 (1%)

Query: 135 IPSFPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISMP 193
           I  FPRK +  I    ++P+ +F++L+GG  GL+ V TS WGGL++TLVI+  GI+ ++P
Sbjct: 2   ISKFPRKAVYGITFLVIYPVVAFYLLHGGAFGLTNVPTSQWGGLMLTLVIATVGIVGALP 61

Query: 194 LGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRAL 253
           LGILLALGR SN+P +R  C+TFIE +RGVPL+TVLFM+S+MLPLF+P+  + DKLLRAL
Sbjct: 62  LGILLALGRRSNMPAVRVVCVTFIEFWRGVPLITVLFMSSVMLPLFMPEGMNFDKLLRAL 121

Query: 254 LGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNT 313
           +GV  F SAYIAEV+RGG+Q+I KGQ+EAA+++GL Y + M L+I+PQ +K VIPGIVNT
Sbjct: 122 IGVILFQSAYIAEVVRGGMQAIPKGQYEAASAMGLGYWRSMGLVILPQALKMVIPGIVNT 181

Query: 314 FIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYS 373
           FI LFKD+SL+ II +FDLL  V+   ++  W+     T G +F   VFWIFCF +S YS
Sbjct: 182 FIALFKDTSLVIIIGLFDLLNSVKQATADPAWLG--MATEGYVFAALVFWIFCFGMSRYS 239

Query: 374 VFIEKTLHKGSKK 386
           + +E+ L  G K+
Sbjct: 240 MHLERKLDTGHKR 252


>gi|288550479|ref|ZP_05970605.2| general amino acid ABC transporter, permease protein [Enterobacter
           cancerogenus ATCC 35316]
 gi|288315400|gb|EFC54338.1| general amino acid ABC transporter, permease protein [Enterobacter
           cancerogenus ATCC 35316]
          Length = 323

 Score =  281 bits (718), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 151/328 (46%), Positives = 206/328 (62%), Gaps = 14/328 (4%)

Query: 57  IPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQR 116
           +P +++W  L A W G+ R  CT              ACW FI+ R+ QF++G YP  QR
Sbjct: 5   LPPLLNWALLQANWTGTTREDCTKA-----------GACWVFIHQRFGQFMYGLYPHEQR 53

Query: 117 WRPILVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWG 175
           WR  L    G   +  M     P +         ++P+  + +LYG  LGL  VET  WG
Sbjct: 54  WRINLALAIGLFSIAVMFWKKVPHRGRYIACWVVVYPVVVWVLLYGDFLGLERVETRQWG 113

Query: 176 GLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIM 235
           GL +TL+I+  GI  ++P GILLALGR S +PV+R   + FIE +RGVPL+TVLFM+S+M
Sbjct: 114 GLTLTLIIASVGIAGALPWGILLALGRRSTMPVVRVLSVIFIEFWRGVPLITVLFMSSVM 173

Query: 236 LPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMR 295
           LPLF+ +   +DKL+RAL+GV  F SAY+AEV+RGGLQ++ KGQ+EAA SL LSY +   
Sbjct: 174 LPLFMAEGTTIDKLIRALVGVILFQSAYVAEVVRGGLQALPKGQYEAAESLALSYWKTQG 233

Query: 296 LIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGL 355
           L+I+PQ +K VIPG+VNT I LFKD+SL+ II +FDL   V+    +  W+     T G 
Sbjct: 234 LVILPQALKLVIPGLVNTIIALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGY 291

Query: 356 IFIGFVFWIFCFSISLYSVFIEKTLHKG 383
           +F   ++WIFCFS+S YS  +EK  + G
Sbjct: 292 VFAALIYWIFCFSMSRYSQHLEKRFNTG 319


>gi|262277478|ref|ZP_06055271.1| general L-amino acid transport system permease protein AapM [alpha
           proteobacterium HIMB114]
 gi|262224581|gb|EEY75040.1| general L-amino acid transport system permease protein AapM [alpha
           proteobacterium HIMB114]
          Length = 348

 Score =  279 bits (714), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 151/355 (42%), Positives = 227/355 (63%), Gaps = 20/355 (5%)

Query: 31  WIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDG 90
           +I + FF +P D  LT  I  L+  +IP ++ W+F+ A + G ++  C +   GG     
Sbjct: 7   YIREKFFSSPIDAFLTISISYLIYLTIPPLLDWMFISATFSGESKKECVS---GG----- 58

Query: 91  WNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSF-PRKFLNSILLF 149
              ACW F+   + +F++G YP  + WR  L F    IL+  +++  F   K+   + LF
Sbjct: 59  ---ACWVFVKIWFNRFLYGMYPNDEVWRVNLPF---GILVVSIIVYRFLNEKYKKYLFLF 112

Query: 150 GL--FPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNI 206
            +  FPI S  +  GG LGL  VET  WGGL +TLVIS F II   PLG+LLA+GR SN+
Sbjct: 113 LIIPFPILSLMLFSGGFLGLMPVETREWGGLFLTLVISIFAIIFCFPLGVLLAMGRRSNL 172

Query: 207 PVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAE 266
           PV+RY  + FIE +RGVPL+TVLFMA +M PL LP   ++DKL+R ++ ++ F +AY+AE
Sbjct: 173 PVVRYFSVGFIEFWRGVPLITVLFMAGVMFPLLLPAGTNMDKLVRVIIAITLFEAAYMAE 232

Query: 267 VLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISI 326
           V+RGGLQ++ +GQ++A+ ++G+ Y +    II+PQ +K VIPGI NTFI LFKD+ L+ +
Sbjct: 233 VVRGGLQAVGRGQYDASKAIGMGYWKSHIFIILPQALKLVIPGIANTFIALFKDTPLVFV 292

Query: 327 INMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
           + + ++LG+V +  +   W+     T G +F+  V+WIFCF++S YS+ IE+ L 
Sbjct: 293 VGLLEILGMVNLAKTNPAWLG--MATEGYVFVALVYWIFCFAMSRYSLSIEEKLK 345


>gi|90419551|ref|ZP_01227461.1| amino acid ABC transporter, permease protein [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90336488|gb|EAS50229.1| amino acid ABC transporter, permease protein [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 499

 Score =  279 bits (713), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 134/228 (58%), Positives = 179/228 (78%)

Query: 159 VLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIE 218
           ++ G  GL  V T+LWGGL+VTLV++  GI  S+PLGILLALGR S++P +R  CI FIE
Sbjct: 272 LMTGDFGLRPVPTNLWGGLMVTLVVAVSGIAASLPLGILLALGRRSSMPAVRLFCIVFIE 331

Query: 219 LFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKG 278
            +RGVPL+TVLFMA+ MLPLFLP+    ++LLRAL+GV+ F++AY+AEV+RGGLQ+I KG
Sbjct: 332 FWRGVPLITVLFMANFMLPLFLPEGVTFNQLLRALVGVALFSAAYMAEVIRGGLQAIPKG 391

Query: 279 QFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRV 338
           Q+E A+++ L+Y QKMR+II+PQ +  VIPGIVNTFIGLFKD+SL+ II + DLLG VR 
Sbjct: 392 QYEGADAMALTYWQKMRMIILPQALTLVIPGIVNTFIGLFKDTSLVYIIGLADLLGTVRR 451

Query: 339 NFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
            F++  WI+  TP TGL+F  F++W+FCFS+S YS++ E+ L  G K 
Sbjct: 452 GFNDPDWITPTTPATGLVFAAFIYWLFCFSMSRYSIYTERRLDTGHKS 499



 Score = 99.4 bits (246), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 81/139 (58%), Gaps = 6/139 (4%)

Query: 25  QRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQG 84
           + G I  + +N F TP D +L+ +    ++++   I +W +LDAV+ GS+RT C      
Sbjct: 23  EVGFIGNVRRNLFATPLDSVLSVIAGAFIVWAAMNIFNWAWLDAVFTGSDRTACL----- 77

Query: 85  GIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLN 144
            ++  G   ACWAF+  ++ QF++G YP  +RWR  +  +  ++L+  + IP  P K LN
Sbjct: 78  -VEDGGHGGACWAFVSAKFGQFMYGVYPFGERWRIDVTVVLLALLVAGLAIPRMPHKRLN 136

Query: 145 SILLFGLFPIFSFFVLYGG 163
           +ILLF +FP  +  +L GG
Sbjct: 137 AILLFAVFPFVALVLLTGG 155


>gi|114706426|ref|ZP_01439328.1| polar amino acid ABC transport permease protein aapM-1 [Fulvimarina
           pelagi HTCC2506]
 gi|114538287|gb|EAU41409.1| polar amino acid ABC transport permease protein aapM-1 [Fulvimarina
           pelagi HTCC2506]
          Length = 497

 Score =  277 bits (708), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 132/229 (57%), Positives = 176/229 (76%)

Query: 158 FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFI 217
           F +     L  V T+LWGGL++TLV++  GI  S+P G+LLALGR S++P +R  C+ FI
Sbjct: 269 FAMTADFDLRYVPTNLWGGLMLTLVVALSGIAASLPFGVLLALGRRSHMPAVRLICVIFI 328

Query: 218 ELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISK 277
           E +RGVPL+TVLFMA+ MLPLF+P+  + + LLRAL+GV+ FASAY+AEV+RGGLQ+I K
Sbjct: 329 EFWRGVPLITVLFMATFMLPLFMPEGVNFNSLLRALVGVALFASAYMAEVVRGGLQAIPK 388

Query: 278 GQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVR 337
           GQ+E A+++ LSY QK RLII+PQ +K VIPGIVNTFIGLFKD+SL+ II + DLLG V+
Sbjct: 389 GQYEGADAMALSYWQKTRLIILPQALKIVIPGIVNTFIGLFKDTSLVYIIGLADLLGTVK 448

Query: 338 VNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
             F++  WI+  TP TGL+F  FV+W FCF +S YS+F+E+ L  G K+
Sbjct: 449 RGFADPNWITPTTPATGLLFAAFVYWCFCFGMSRYSIFVERRLDTGHKR 497



 Score =  103 bits (258), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 63/155 (40%), Positives = 94/155 (60%), Gaps = 8/155 (5%)

Query: 10  YVRKRLLQPSLP-PVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDA 68
           YV  + L P LP P    G IA + KN F TP D +LT +    ++++I  +  +V+LDA
Sbjct: 8   YVSTKEL-PQLPAPRNDAGPIAVLRKNLFATPVDTILTLVCGLFIVWAIWNLFSFVWLDA 66

Query: 69  VWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSI 128
           V+ G++R  C  + +GG    G   ACWAF+  +  QF++G YP A+RWR   VFL  ++
Sbjct: 67  VFEGADREAC--LVEGG----GHGGACWAFVEAKLGQFVYGTYPSAERWRVDTVFLLLAL 120

Query: 129 LLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGG 163
           L   +LIP+ P K +N+ILLF +FP+ +  +L GG
Sbjct: 121 LTAGLLIPNVPYKRINAILLFAVFPVVTLVLLTGG 155


>gi|110633468|ref|YP_673676.1| polar amino acid ABC transporter, inner membrane subunit
           [Mesorhizobium sp. BNC1]
 gi|110284452|gb|ABG62511.1| general L-amino acid ABC transporter membrane protein
           [Chelativorans sp. BNC1]
          Length = 498

 Score =  275 bits (702), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 135/228 (59%), Positives = 174/228 (76%)

Query: 159 VLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIE 218
           VL    GL  V TS WGGL++TLV++  GI  S+PLGILLALGR S++P +R   I FIE
Sbjct: 271 VLAADFGLQHVPTSQWGGLMLTLVVALTGIAASLPLGILLALGRRSHLPAVRLFSIIFIE 330

Query: 219 LFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKG 278
            +RGVPL+TVLFM++ M+PL LP+    ++LLRAL+GV+ F++AY+AEV+RGGLQ+I KG
Sbjct: 331 FWRGVPLITVLFMSAFMIPLLLPEGVTFNQLLRALIGVAIFSAAYMAEVIRGGLQAIPKG 390

Query: 279 QFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRV 338
           Q+E A +LGL Y Q MRL+IMPQ IK VIPGIVNTFIGLFKD+SL+ II + DLLG VR 
Sbjct: 391 QYEGAEALGLGYWQMMRLVIMPQAIKLVIPGIVNTFIGLFKDTSLVYIIGLADLLGTVRR 450

Query: 339 NFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
            FS+  WI+  T  TGL+F GFV+W+FCF +S YS+F+E+    G K+
Sbjct: 451 GFSDPNWITPTTAATGLVFAGFVYWLFCFGMSRYSMFMERRFDTGHKR 498



 Score = 90.1 bits (222), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 70/132 (53%), Gaps = 6/132 (4%)

Query: 10  YVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAV 69
           YV +   QP  PP  + GI+A   KN F TP D ++T ++     ++   +I W    AV
Sbjct: 8   YVAREQKQPLPPPPSEFGIVATFRKNLFATPLDSVITIVLGLFTAWAAWRLIQWGISAAV 67

Query: 70  WIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSIL 129
           + G NR  C     G +       ACWAF+  +  QF++G YP++QRWR  LVF+    L
Sbjct: 68  FTGGNREACLATEGGEV------GACWAFVRAKLGQFLYGIYPLSQRWRVDLVFILLVAL 121

Query: 130 LTPMLIPSFPRK 141
           + P+ IP+ P K
Sbjct: 122 MLPLAIPTAPFK 133


>gi|242280378|ref|YP_002992507.1| polar amino acid ABC transporter inner membrane subunit
           [Desulfovibrio salexigens DSM 2638]
 gi|242123272|gb|ACS80968.1| polar amino acid ABC transporter, inner membrane subunit
           [Desulfovibrio salexigens DSM 2638]
          Length = 367

 Score =  274 bits (700), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 147/367 (40%), Positives = 230/367 (62%), Gaps = 16/367 (4%)

Query: 21  PPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTT 80
           PP  Q G+I W+ KN      + +LT +    +  ++     W   +A     + T+   
Sbjct: 15  PPATQVGVIGWVCKNLLCPWYNAVLTIVSCWAIWSAVAPFWEWAVTNA-----SITLDPE 69

Query: 81  VSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPR 140
           V++       ++ A W FI D +  F+ G YP  +RWRP++      IL++  L+ S+ R
Sbjct: 70  VAKE------YSGAAWGFIRDMWPVFMTGVYPAEERWRPLIALCIVVILVSLSLVASYRR 123

Query: 141 KFLNSILLFGLFPIFSFFVLYGG--LGLSIVETSLWGGLLVTLVISFFGIIISMPLGILL 198
             L  IL F + PI  F ++YGG  +GL +V T  WGGL++T+++S   ++ + P+ +LL
Sbjct: 124 SRLLKILWF-VSPIVVFALVYGGEIVGLPVVGTHYWGGLMLTIMLSIVAMLAAFPISVLL 182

Query: 199 ALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSA 258
           ALGR S++P+ +  C+ +IEL RGVPL+T+LFMAS++LPLFLP   ++DK+LRAL+G++ 
Sbjct: 183 ALGRTSDMPIAKPFCVAYIELIRGVPLITILFMASVVLPLFLPAGMELDKVLRALVGITM 242

Query: 259 FASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLF 318
           F SAY+AE +RGGLQ ISKGQ+EAA++LG+SY +K  ++I+PQ ++ VIP +VN FIG+ 
Sbjct: 243 FFSAYLAENIRGGLQGISKGQYEAADALGMSYWKKTIVVILPQALRIVIPPMVNNFIGIL 302

Query: 319 KDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEK 378
           KD+SL+ I+ + DLL I     S   W   +      +FI F +WI C+++S YS ++E+
Sbjct: 303 KDTSLVGIVGLVDLLQIAFATTSNPKWFGRL--EEAYVFIAFWYWILCYALSSYSQYLER 360

Query: 379 TLHKGSK 385
            +   SK
Sbjct: 361 KMPSASK 367


>gi|296533469|ref|ZP_06896049.1| amino acid ABC superfamily ATP binding cassette transporter,
           permease protein [Roseomonas cervicalis ATCC 49957]
 gi|296266204|gb|EFH12249.1| amino acid ABC superfamily ATP binding cassette transporter,
           permease protein [Roseomonas cervicalis ATCC 49957]
          Length = 384

 Score =  273 bits (699), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 154/375 (41%), Positives = 222/375 (59%), Gaps = 21/375 (5%)

Query: 16  LQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWI---- 71
           L P  PP+   G +AW   N F       +T  ++ LL     G I W FL+A+W     
Sbjct: 19  LAPRRPPLLAVGPVAWARANLFSGWLSTAVTLALLYLLARWTMGFIDWAFLNAIWSVPMV 78

Query: 72  -GSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILL 130
            G+ +T      QG       + ACWA I +++   +FG YP  + WRP L  L    L 
Sbjct: 79  NGTAQTQACRALQG-------SGACWAVIGEKHRFILFGTYPYEEHWRPALCVL----LF 127

Query: 131 TPMLIPSFPRKFLN---SILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFG 187
             + I S  R+F     +++      +    +  G LGLS V    WGGL++TL++S FG
Sbjct: 128 IGLYIVSAMRRFWRPALAVIWVATLVVIGVLMWGGVLGLSYVPQERWGGLVITLILSTFG 187

Query: 188 IIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVD 247
           I  + PL IL+ALGR S +P ++  CI ++EL RGVPL+++LFMAS+M PLFLP+  ++D
Sbjct: 188 IAFAFPLSILVALGRRSRMPAIKLLCILYVELIRGVPLISLLFMASVMFPLFLPEGINID 247

Query: 248 KLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVI 307
           KLLRA + +  FA+AY+AEV+RGGLQ++ KGQ+EAA +LGLSY QK   II+PQ ++ VI
Sbjct: 248 KLLRAQIAIILFAAAYLAEVVRGGLQALPKGQYEAAEALGLSYWQKTGFIILPQALRLVI 307

Query: 308 PGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCF 367
           P +VNTFIG FKD+SL+ II +FDLL   +    E  W          + +G ++++FCF
Sbjct: 308 PPLVNTFIGFFKDTSLVLIIGIFDLLTAGKTAIVEPAWQGFGIEV--YVVVGLIYFVFCF 365

Query: 368 SISLYSVFIEKTLHK 382
           ++S YS  +E  L++
Sbjct: 366 AMSRYSQNLEAELNR 380


>gi|288962138|ref|YP_003452433.1| general L-amino acid transport system permease protein
           [Azospirillum sp. B510]
 gi|288914404|dbj|BAI75889.1| general L-amino acid transport system permease protein
           [Azospirillum sp. B510]
          Length = 405

 Score =  271 bits (693), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 150/359 (41%), Positives = 218/359 (60%), Gaps = 16/359 (4%)

Query: 29  IAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQP 88
           I+W   N F TP +  L+   + LL   +P + +W+ L+A W G +   C   +      
Sbjct: 62  ISWTRNNLFNTPLNTALSLACLALLWLVVPPMANWLLLNASWSGGSE-ACREAA------ 114

Query: 89  DGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILL 148
                ACW+ I  ++    FG YP  ++WRP L       +L    + +F R +L     
Sbjct: 115 ----GACWSVIVVKHRLIFFGTYPYDEQWRPFLACALFVAMLGASGVRAFWRPWLAGAWA 170

Query: 149 FGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIP 207
             L  +    +++GG+ GL  V    WGGL +TL++S F I ++ PL ILLALGR S +P
Sbjct: 171 LTL--VGMGVLMWGGVAGLGYVPNDRWGGLPITLMLSVFSIALAFPLSILLALGRQSALP 228

Query: 208 VLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEV 267
            +R  C+ FIE  RGVPLV+VLFMAS+M PLFLP+   VDKLLRAL G++ F +AY+AE 
Sbjct: 229 AIRTFCVGFIETMRGVPLVSVLFMASVMFPLFLPEGVTVDKLLRALAGMTLFTAAYLAEA 288

Query: 268 LRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISII 327
           +RGGLQ+I KGQ+EAA++LGLSY QK  LI++PQ ++ VIP IVN FI  FKD+SL++I+
Sbjct: 289 VRGGLQAIPKGQYEAADALGLSYWQKTMLIVLPQALRIVIPPIVNQFISAFKDTSLVTIV 348

Query: 328 NMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
            ++DLL    V  ++  W          +F G +FWIFCFS+S YS ++E+  ++ +++
Sbjct: 349 GLYDLLTAATVATTDPEWRPYFAEV--YVFAGLMFWIFCFSMSRYSQWLERLANRYTRR 405


>gi|218514142|ref|ZP_03510982.1| general L-amino acid ABC transporter, permease protein [Rhizobium
           etli 8C-3]
          Length = 210

 Score =  269 bits (687), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 126/210 (60%), Positives = 162/210 (77%)

Query: 28  IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQ 87
           ++AWI +N   TPKD++LT L +  + +++   + W+F+ AVW G +RT C T  QGGIQ
Sbjct: 1   MVAWIRRNLLATPKDMVLTTLAVVFIAWALLHAVDWLFVQAVWRGPDRTFCATAVQGGIQ 60

Query: 88  PDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSIL 147
           PDGW+ ACWAF+  +++QFI+G YP+ +RWRP LV +   +LL PMLIPS PRK +N++L
Sbjct: 61  PDGWSGACWAFVNAKFDQFIYGRYPLDERWRPTLVGILFVLLLVPMLIPSAPRKGVNALL 120

Query: 148 LFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIP 207
           LFG  PI SFF+LYGG GL IVET LWGGLLVTLV+SF GI +S PLGI+LALGR S +P
Sbjct: 121 LFGALPIVSFFLLYGGYGLEIVETPLWGGLLVTLVLSFVGIAVSFPLGIILALGRRSQMP 180

Query: 208 VLRYACITFIELFRGVPLVTVLFMASIMLP 237
           V+R  CI FIE+ RGVPL+TVLFMAS+MLP
Sbjct: 181 VIRTVCIVFIEVVRGVPLITVLFMASVMLP 210


>gi|330899536|gb|EGH30955.1| amino acid ABC transporter permease [Pseudomonas syringae pv.
           japonica str. M301072PT]
          Length = 283

 Score =  266 bits (680), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 137/287 (47%), Positives = 193/287 (67%), Gaps = 13/287 (4%)

Query: 17  QPSLPPVYQR-GIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNR 75
           +P +PP  +  G +AW+ +N F +  + LLT   + L+   +P II W  LDA WIG+ +
Sbjct: 7   KPDMPPPGKVFGPVAWMRQNLFSSWINTLLTLFSLYLIYLVVPPIISWSLLDANWIGTTK 66

Query: 76  TVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLI 135
             CT              ACW FI  R+ QF++G +P   RWR  L  +   +   P+ I
Sbjct: 67  ADCTKA-----------GACWVFIEQRFGQFMYGYFPNELRWRVDLTAILAIVGAAPLFI 115

Query: 136 PSFPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISMPL 194
             FPRK +  I    ++P+ +F++L+GG  GL+ V TS WGGL++TLVI+  GI+ ++PL
Sbjct: 116 SKFPRKAVYGITFLVIYPVVAFYLLHGGAFGLTNVPTSQWGGLMLTLVIATVGIVGALPL 175

Query: 195 GILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALL 254
           GILLALGR SN+P +R  C+TFIE +RGVPL+TVLFM+S+MLPLF+P+  + DKLLRAL+
Sbjct: 176 GILLALGRRSNMPAVRVVCVTFIEFWRGVPLITVLFMSSVMLPLFMPEGMNFDKLLRALI 235

Query: 255 GVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQ 301
           GV  F SAYIAEV+RGG+Q+I KGQ+EAA+++GL Y + M L+I+PQ
Sbjct: 236 GVILFQSAYIAEVVRGGMQAIPKGQYEAASAMGLGYWRSMGLVILPQ 282


>gi|260223280|emb|CBA33684.1| General L-amino acid transport system permease protein aapM
           [Curvibacter putative symbiont of Hydra magnipapillata]
          Length = 367

 Score =  265 bits (677), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 150/369 (40%), Positives = 229/369 (62%), Gaps = 20/369 (5%)

Query: 22  PVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTV 81
           PV   G++AWI  N FG  K  L T +I   LL  +P  ++W  + AVW+  N   C   
Sbjct: 15  PVKTDGLVAWIRFNLFGDWKTTLGTLVIGAFLLAIVPRFLNWALVQAVWV-PNFEACHVE 73

Query: 82  SQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRK 141
             G         ACW  I +++   IFG +P  ++WRP    L  ++LL  +L+ S  R 
Sbjct: 74  GAG---------ACWGVIVEKFRIIIFGRFPFEEQWRP----LIATLLLCSLLVASCMRM 120

Query: 142 FLNSIL-LFGLFPIFSFFVLYGG--LGLSIVETSLWGGLLVTLVISFFGIIISMPLGILL 198
           F  + L L  +  + SFF+L  G   G+S V+T  WGGL +TL++S   + ++ PL +L+
Sbjct: 121 FWKAWLGLAWVVVLGSFFMLMSGDVFGMSKVDTDRWGGLPLTLLLSSLSMAMAFPLALLI 180

Query: 199 ALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSA 258
           ALGR SN+P ++  C  ++EL RGVPL++VLFMAS M PL +P  +++D L+R   G++ 
Sbjct: 181 ALGRRSNLPAIKSLCTIYVELIRGVPLISVLFMASFMFPLLMPQGFNIDVLVRVPAGITL 240

Query: 259 FASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLF 318
           FA+AY+AEV+RGGLQ++ KGQ EAA +LGLSY Q  R I++PQ +  V+PGI+N FI  F
Sbjct: 241 FAAAYMAEVIRGGLQAVPKGQIEAAATLGLSYWQTQRKIVLPQALSMVVPGIMNNFISTF 300

Query: 319 KDSSLISIINMFDLLGIVRVNF-SESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIE 377
           KD+SL++I+++++L G + +   S++ W        G +FI  +++ FCFS+S YS++IE
Sbjct: 301 KDTSLVTIVSLYELTGSMSLALNSDADW--RPYKIEGYLFIALIYFGFCFSMSRYSLWIE 358

Query: 378 KTLHKGSKK 386
           K ++K   +
Sbjct: 359 KQVNKSKLR 367


>gi|27378024|ref|NP_769553.1| ABC transporter permease [Bradyrhizobium japonicum USDA 110]
 gi|27351170|dbj|BAC48178.1| blr2913 [Bradyrhizobium japonicum USDA 110]
          Length = 368

 Score =  263 bits (673), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 142/357 (39%), Positives = 215/357 (60%), Gaps = 19/357 (5%)

Query: 28  IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWI--GSNRTVCTTVSQGG 85
           ++ W+  N F +  + +L+ +++ +L   I   + W   +AVW+   ++ + C  V   G
Sbjct: 23  VLRWLRTNLFSSIPNGILSVVLLAILAKGIFSFVQWGIANAVWLTPANDSSACRAVRGFG 82

Query: 86  IQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNS 145
                   ACWA I ++Y   +FG YP  ++WRP L      +L   +   S  R F   
Sbjct: 83  --------ACWAIIPEKYRFILFGTYPFDEQWRPAL----SVVLFIALFYLSSRRAFWRR 130

Query: 146 ILLF---GLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGR 202
            L++   G+  + S  +  G  GLS V    WGGL VTL+++ FG+    PLGIL+ALGR
Sbjct: 131 ELVYLWIGVLALISVLMWGGVFGLSFVSQDRWGGLPVTLILATFGLAFGFPLGILVALGR 190

Query: 203 NSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASA 262
            S +P +R   + ++EL RGVPLV++LFMAS+M PLF+P  +++DKLLRA + +  FA A
Sbjct: 191 RSKLPAIRSLSVLYVELIRGVPLVSLLFMASVMFPLFMPSGFNIDKLLRAQIAIILFAGA 250

Query: 263 YIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSS 322
           Y+AEV+RGGLQ++ +GQ+EAA +LGLSY +K RLI++PQ I+ VIP +VNTFI  FKD+S
Sbjct: 251 YLAEVIRGGLQAVPRGQYEAAEALGLSYWRKHRLIVLPQAIRHVIPPLVNTFIAFFKDTS 310

Query: 323 LISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKT 379
           L+ II +FDLL   +    +  W          IF+  ++++FCF++S YS  +E  
Sbjct: 311 LVLIIGIFDLLTTAKTAIIDPAWQQFSVEV--YIFVAAIYFVFCFAMSRYSRGLEAA 365


>gi|260426627|ref|ZP_05780606.1| glutamate/glutamine/aspartate/asparagine transport system
           permeaseprotein BztC [Citreicella sp. SE45]
 gi|260421119|gb|EEX14370.1| glutamate/glutamine/aspartate/asparagine transport system
           permeaseprotein BztC [Citreicella sp. SE45]
          Length = 438

 Score =  263 bits (671), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 153/438 (34%), Positives = 237/438 (54%), Gaps = 60/438 (13%)

Query: 4   SCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHW 63
             +   +VR  + +   PP+ Q G   W+ +N   TP +++LT + + L+   +  ++ W
Sbjct: 5   HAQTVAFVRDTMTEQQEPPLSQSGAYKWMRENLLSTPLNVILTLVSVWLIYSVLSHVMPW 64

Query: 64  VFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVF 123
                +W  S+ + C T+       D  N ACWA I +R++Q +FG YP    WRP+L F
Sbjct: 65  AVF-GIWDASSLSECRTIRDELYGADA-NVACWAVISERWKQLLFGFYPPEHYWRPVLAF 122

Query: 124 LTGSILLTPMLIPSFPRKFL---------------------------------------- 143
           +   + ++P+L  S PRK L                                        
Sbjct: 123 VLFLVAISPVLFSSLPRKLLAFSVVAPFILFWLIWGGTVWGPICVALGFVIGWAIIRYAS 182

Query: 144 ------NSILLFGLFPIFSFFVLYGGL----------GLSIVETSLWGGLLVTLVISFFG 187
                  S++L  + P+  +FVL G L          GL  V++   GG ++ ++I   G
Sbjct: 183 PYIGALGSVILAIVVPLLYWFVLAGPLDDLLASILPIGLEQVQSKQMGGFMLAMIIGISG 242

Query: 188 IIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVD 247
           I +S+PLGI+LALGR S++ ++    + FIE+ RGVPL+  LF AS++L  FLP   + D
Sbjct: 243 IALSLPLGIVLALGRQSDLFLINKCSVIFIEVIRGVPLIVWLFTASLLLNYFLPPGTNFD 302

Query: 248 KLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVI 307
            +LR ++ V+ F+SAYIAEV+RGGL ++ KGQ+EAA++LGL Y + MRL+I+PQ +K  I
Sbjct: 303 LMLRVIIMVTLFSSAYIAEVVRGGLAALPKGQYEAADALGLDYWKSMRLVILPQALKISI 362

Query: 308 PGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCF 367
           PGIVNTFIGLFKD++L+  I + D +G+     + + W          +FIG  F+IFCF
Sbjct: 363 PGIVNTFIGLFKDTTLVVFIGLLDPIGLSNAIRASTEWNGIYWEL--FVFIGLCFFIFCF 420

Query: 368 SISLYSVFIEKTLHKGSK 385
           S+  YS+F+EK L +  +
Sbjct: 421 SMGRYSLFLEKKLRREHR 438


>gi|302339788|ref|YP_003804994.1| polar amino acid ABC transporter inner membrane subunit
           [Spirochaeta smaragdinae DSM 11293]
 gi|301636973|gb|ADK82400.1| polar amino acid ABC transporter, inner membrane subunit
           [Spirochaeta smaragdinae DSM 11293]
          Length = 357

 Score =  262 bits (669), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 151/360 (41%), Positives = 223/360 (61%), Gaps = 21/360 (5%)

Query: 26  RGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGG 85
           + ++  I +++F +P  I+L+ +I+ L +     +I W F++AVW G NR V        
Sbjct: 6   KNLLKTIKRDYFNSPFTIMLSLVILYLAVRLGIWLIQWAFINAVWSGENREVAVK----- 60

Query: 86  IQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNS 145
                 N A WAFI  +   FIFG YP  Q WR I+ FL    ++    IP F +K  + 
Sbjct: 61  ------NGATWAFIRAKIRFFIFGFYPKDQIWRIIITFL----IMALSFIPYFMKKIHHK 110

Query: 146 ILLFG----LFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALG 201
           +L+F     ++PI   F L GG GL  V T+ WGGL +TL++S  G++ S P+GI LALG
Sbjct: 111 VLVFASHMLIWPIVIIFFLSGGAGLEKVSTNDWGGLTLTLILSSLGLLYSFPIGIALALG 170

Query: 202 RNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFAS 261
           R S+ PV+R   + +IE FRG+PL+T+LFMAS+++P FLP    VDK++R ++G++ F S
Sbjct: 171 RRSSWPVIRGLSVAYIEFFRGIPLITILFMASVVVPFFLPPQISVDKIIRIIVGMTCFQS 230

Query: 262 AYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDS 321
           AY+AEV+RGGLQSI KGQ+EA++SLG  +  +  LII+PQV+K  +  I    I   KD+
Sbjct: 231 AYLAEVIRGGLQSIPKGQYEASDSLGFGFSLQQYLIILPQVLKVTVANIGGISISFLKDT 290

Query: 322 SLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
           +L+ II MFDLLG+V    S+S W+       G +F G ++W+ CF+IS  +  IE+ +H
Sbjct: 291 TLVLIIGMFDLLGMVSPLASDSNWLG--MEPEGYLFAGLIYWLICFTISRITNRIEEKVH 348


>gi|71083648|ref|YP_266368.1| putative amino-acid ABC transporter permease protein yhdY
           [Candidatus Pelagibacter ubique HTCC1062]
 gi|71062761|gb|AAZ21764.1| Similar to amino-acid ABC transporter permease protein yhdY
           [Candidatus Pelagibacter ubique HTCC1062]
          Length = 426

 Score =  261 bits (667), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 143/358 (39%), Positives = 227/358 (63%), Gaps = 24/358 (6%)

Query: 28  IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQ 87
           I+  ++KN   +  +  L+  II L++FS+P +++W   DA   G  +  CT    GG  
Sbjct: 78  ILDSLNKNINPSNFNAALSLCIIFLIIFSLPPLLNWFIFDANISGDTKEACT----GG-- 131

Query: 88  PDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSF-PRKFLNSI 146
                 ACW +I   + +F++G YP A++WR  + F+    +L+ M    F P KF N +
Sbjct: 132 -----GACWVYIKVWFNRFMYGMYPNAEQWRINITFIA---VLSFMAAGFFVPAKFRNYL 183

Query: 147 LLFG--LFPIFSFFVLY-----GGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLA 199
            L+   + PI SF ++Y     G  GL  VET  WGGL +T ++SFF +I   P+G++LA
Sbjct: 184 SLYYTLILPIISFILIYYLISGGSFGLEWVETGAWGGLSLTFIVSFFSLIFCFPIGMMLA 243

Query: 200 LGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAF 259
           LGR S++PV++Y+ ++FIE +RGVPL+TVLFM+++M P+FLPD   VDKL+R ++ ++ F
Sbjct: 244 LGRRSDLPVVKYSSLSFIEFWRGVPLITVLFMSAVMFPMFLPDGTYVDKLIRVVVAITLF 303

Query: 260 ASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFK 319
            +AY AEV+RGGLQ++ +GQ++AA SLG+ Y +    +I+PQ +K VIPGI NTF+ L K
Sbjct: 304 EAAYTAEVIRGGLQALPRGQYDAAKSLGMGYWKLHIFVILPQALKLVIPGIANTFLALVK 363

Query: 320 DSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIE 377
           D+ LI ++ + +++G++ +  +   W+       G +F G +FWI C+S+S YS  +E
Sbjct: 364 DTPLIFVVGLLEVVGMLNLAKTNPEWLG--FSMEGYVFAGIIFWIICYSMSKYSQKLE 419


>gi|126731933|ref|ZP_01747736.1| ABC transporter, membrane spanning protein (amino acid) [Sagittula
           stellata E-37]
 gi|126707465|gb|EBA06528.1| ABC transporter, membrane spanning protein (amino acid) [Sagittula
           stellata E-37]
          Length = 461

 Score =  261 bits (667), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 130/242 (53%), Positives = 179/242 (73%), Gaps = 1/242 (0%)

Query: 144 NSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRN 203
             + L+G  P+ +  V+   LG  +VET+ WGGL +TLV++ FGI+IS+P+G+LLALGR 
Sbjct: 221 GGLALWGGLPLVTM-VIDLALGTEVVETNKWGGLTITLVVAIFGIVISLPVGMLLALGRR 279

Query: 204 SNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAY 263
           SN P+++Y+ + FIE+ RG+PL++VLF AS MLP FL    D +KLLRA++GV  FASAY
Sbjct: 280 SNAPIIKYSSVIFIEVVRGIPLISVLFFASAMLPYFLEPGVDFNKLLRAMIGVVLFASAY 339

Query: 264 IAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSL 323
           +AEV+RGGLQ+I KGQ+E   SLGLS+ Q+MRLIIMPQ +  VIPGIVNTFIGLFKD++L
Sbjct: 340 MAEVIRGGLQAIPKGQYEGGMSLGLSFWQQMRLIIMPQALTTVIPGIVNTFIGLFKDTTL 399

Query: 324 ISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKG 383
           + II++FDLLGI+     +  W +  T  TG + I  ++WIFCF +S YSV +E+ L + 
Sbjct: 400 VLIISIFDLLGILNNTLKDPEWSTPTTAYTGYLTIALIYWIFCFGMSRYSVHMERKLDRS 459

Query: 384 SK 385
            +
Sbjct: 460 HR 461


>gi|91763311|ref|ZP_01265275.1| amino-acid ABC transporter permease protein yhdY-like protein
           [Candidatus Pelagibacter ubique HTCC1002]
 gi|91717724|gb|EAS84375.1| amino-acid ABC transporter permease protein yhdY-like protein
           [Candidatus Pelagibacter ubique HTCC1002]
          Length = 426

 Score =  261 bits (666), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 143/358 (39%), Positives = 227/358 (63%), Gaps = 24/358 (6%)

Query: 28  IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQ 87
           I+  ++KN   +  +  L+  II L++FS+P +++W   DA   G  +  CT    GG  
Sbjct: 78  ILDSLNKNINPSNFNAALSLCIIFLIIFSLPPLLNWFIFDANISGDTKEACT----GG-- 131

Query: 88  PDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSF-PRKFLNSI 146
                 ACW +I   + +F++G YP A++WR  + F+    +L+ M    F P KF N +
Sbjct: 132 -----GACWVYIKVWFNRFMYGMYPNAEQWRINITFIA---VLSFMAAGFFVPAKFRNYL 183

Query: 147 LLFG--LFPIFSFFVLY-----GGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLA 199
            L+   + PI SF ++Y     G  GL  VET  WGGL +T ++SFF +I   P+G++LA
Sbjct: 184 SLYYTLILPIISFILIYYLISGGSFGLEWVETGAWGGLSLTFIVSFFSLIFCFPIGMMLA 243

Query: 200 LGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAF 259
           LGR S++PV++Y+ ++FIE +RGVPL+TVLFM+++M P+FLPD   VDKL+R ++ ++ F
Sbjct: 244 LGRRSDLPVVKYSSLSFIEFWRGVPLITVLFMSAVMFPMFLPDGTYVDKLIRVVVAITLF 303

Query: 260 ASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFK 319
            +AY AEV+RGGLQ++ +GQ++AA SLG+ Y +    +I+PQ +K VIPGI NTF+ L K
Sbjct: 304 EAAYTAEVIRGGLQALPRGQYDAAKSLGMGYWKLHIFVILPQALKLVIPGIANTFLALVK 363

Query: 320 DSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIE 377
           D+ LI ++ + +++G++ +  +   W+       G +F G +FWI C+S+S YS  +E
Sbjct: 364 DTPLIFVVGLLEVVGMLNLAKTNPEWLG--FSMEGYVFAGIIFWIICYSMSKYSQKLE 419


>gi|114771235|ref|ZP_01448655.1| glutamate/glutamine/aspartate/asparagine ABC transporter, permease
           protein [alpha proteobacterium HTCC2255]
 gi|114548160|gb|EAU51047.1| glutamate/glutamine/aspartate/asparagine ABC transporter, permease
           protein [alpha proteobacterium HTCC2255]
          Length = 434

 Score =  257 bits (657), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 164/435 (37%), Positives = 239/435 (54%), Gaps = 60/435 (13%)

Query: 6   KEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVF 65
            +  +VRK ++     P+ Q GII W  KN F    + +LT ++   ++  +  I+ WVF
Sbjct: 2   ADLSFVRKEIIPQRAAPLSQTGIIGWFRKNMFSDIPNTILTIIVGYFIISILGNILPWVF 61

Query: 66  LDAVWIGSNRTVCTTV-SQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFL 124
               W   + T C  + ++ G    G   ACW  I +R+ Q +FG YP    WRPIL F+
Sbjct: 62  -SPTWNSVSLTECRGILAELGRSGHGGGGACWGVIRERWLQLLFGFYPSELYWRPILAFV 120

Query: 125 TGSILLTPMLIPSFPRK--FLNSILLFGLF------------PIFS-FFVLYGG------ 163
              + L P+L     RK  +L +I  F  F             +FS F V Y G      
Sbjct: 121 LLGLALAPVLFDKASRKLIYLTAIYPFLCFWLIWGGSIWFPVTVFSGFIVAYLGYVYVNK 180

Query: 164 -----------------------------------LGLSIVETSLWGGLLVTLVISFFGI 188
                                              +G   +E+   GG ++ ++I   GI
Sbjct: 181 AFGSLAGVIASIALPVLWWLFITSPLSISLHSIMPIGSEAIESDRLGGFMLAVLIGVTGI 240

Query: 189 IISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDK 248
            +S+P+GILLALGR SN+P+L+  C+ FIE  RGVPL+T+LF+AS +L +FLP   + D 
Sbjct: 241 ALSLPIGILLALGRQSNLPILKAVCVCFIEFIRGVPLITLLFVASTLLNIFLPPGSNFDL 300

Query: 249 LLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIP 308
           +LR ++ V+ FASAY+AEV+RGGL ++ KGQ+EAA+SLGL Y +  RLIIMPQ +K  IP
Sbjct: 301 ILRVMIMVTLFASAYMAEVVRGGLAALPKGQYEAADSLGLDYWKAQRLIIMPQALKISIP 360

Query: 309 GIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFS 368
           GIV+TFIGLFKD++L+SII + D LG+     ++  W   +    G  F+G +F+IFCFS
Sbjct: 361 GIVSTFIGLFKDTTLVSIIGLLDPLGLSTNIRADMAWNGILWELYG--FVGLIFFIFCFS 418

Query: 369 ISLYSVFIEKTLHKG 383
           +S YS+++E+ L  G
Sbjct: 419 MSRYSMYLERKLATG 433


>gi|56697223|ref|YP_167588.1| amino acid ABC transporter, permease protein [Ruegeria pomeroyi
           DSS-3]
 gi|56678960|gb|AAV95626.1| amino acid ABC transporter, permease protein [Ruegeria pomeroyi
           DSS-3]
          Length = 375

 Score =  256 bits (653), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 136/365 (37%), Positives = 221/365 (60%), Gaps = 15/365 (4%)

Query: 22  PVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTV 81
           P  Q G IAW+  N FG  KD  +T  ++ +LL  +P +I W+ ++A ++G + T     
Sbjct: 26  PASQIGPIAWLRANLFGGWKDTAITLSLLAVLLAVVPNLIEWLLINATFLGDDETCRQNA 85

Query: 82  SQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRK 141
                       ACW F+  +++  + G YP    WRP +  L   +L           +
Sbjct: 86  G-----------ACWPFLQAKFQVLMVGVYPQDLSWRPAIAALALLVLAGFTYADRI--R 132

Query: 142 FLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALG 201
            +  I+ + + PIF+  ++ G  G+  V+ SLWGGL+++++++  G+I+S+PLG+LLALG
Sbjct: 133 GIALIVAWAVLPIFALIMIGGAFGMQEVDQSLWGGLMLSVLLALVGVIVSIPLGVLLALG 192

Query: 202 RNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFAS 261
           R+   P ++  C+ FIEL RGVPL+T+LFMAS+M+PLFLP    ++ LLR  +G+  F+S
Sbjct: 193 RHYGSPAVKAICVAFIELVRGVPLITILFMASVMMPLFLPPDLVINNLLRIQIGMILFSS 252

Query: 262 AYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDS 321
           AY+AEV+RGGLQ+I KGQ EA+ +LG+S  + +  +++PQ ++ V+P ++   I LFKD+
Sbjct: 253 AYMAEVVRGGLQAIPKGQTEASLALGVSPARTIIFVVVPQALRHVLPPLIGRCIALFKDT 312

Query: 322 SLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
           SL+ I+ + D LG+VR    +  W+         +F  FV+W+ C+S+SLY   +E+   
Sbjct: 313 SLVIIVGLLDFLGMVRGAALDPEWLG--FQAEAYVFAAFVYWLICYSLSLYGRALERRGP 370

Query: 382 KGSKK 386
            GSK+
Sbjct: 371 AGSKR 375


>gi|90424050|ref|YP_532420.1| amino acid ABC transporter permease [Rhodopseudomonas palustris
           BisB18]
 gi|90106064|gb|ABD88101.1| Amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine [Rhodopseudomonas palustris
           BisB18]
          Length = 499

 Score =  255 bits (651), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 129/247 (52%), Positives = 178/247 (72%)

Query: 140 RKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLA 199
           R  L S+ +F    +  F +     GL IV+T +WGGLLVTLV+S  GI+ SMP+GI LA
Sbjct: 253 RALLRSLAMFAGIAVVIFVMRLDRGGLPIVDTRMWGGLLVTLVVSVTGIVTSMPVGIALA 312

Query: 200 LGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAF 259
           LGR S IP++R   + FIE +RGVPL+TVLF A+ MLPLFLP  + VD L+R L+G++ F
Sbjct: 313 LGRRSTIPLIRIFSVLFIEFWRGVPLITVLFFATYMLPLFLPGNFTVDGLVRVLIGIALF 372

Query: 260 ASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFK 319
           A AY AEV+RGGLQ+I +GQ EAA++LGLSY +   L++MPQ ++ VIPG+VN+FI LFK
Sbjct: 373 AGAYNAEVIRGGLQAIPRGQAEAASALGLSYWKITGLVVMPQALRHVIPGLVNSFIALFK 432

Query: 320 DSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKT 379
           D+SL+SI+ +FDLLG +R +F++ TW +  T  TG  F G V+++FCF +S YS+F+E  
Sbjct: 433 DTSLVSIVALFDLLGSLRASFADPTWSTPTTLFTGFAFTGIVYFVFCFGMSRYSLFVEHR 492

Query: 380 LHKGSKK 386
           L+   + 
Sbjct: 493 LNAHRRS 499



 Score = 98.6 bits (244), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 57/154 (37%), Positives = 85/154 (55%), Gaps = 5/154 (3%)

Query: 10  YVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAV 69
           +VR+ L+     PV   G   +I    F TP + +LT +   LL  +I   + ++ +DAV
Sbjct: 8   FVRQDLVDSRPAPVKTTGFTGFIRTRLFNTPTNAILTIVGAALLWLTIVPTVKFLLIDAV 67

Query: 70  WIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSIL 129
           W G++RT C     G         ACW F+  ++ QF++G YP  +RWR  L F   ++L
Sbjct: 68  WQGTSRTDCLAAGAGHEV-----GACWPFVQAKFAQFVYGFYPEQERWRVNLTFGLAALL 122

Query: 130 LTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGG 163
           L P+LIP  P K LN+ L F  FP+ +FF+L+GG
Sbjct: 123 LLPLLIPRVPAKSLNAGLFFVAFPVVAFFLLHGG 156


>gi|254464809|ref|ZP_05078220.1| amino acid ABC transporter, permease protein [Rhodobacterales
           bacterium Y4I]
 gi|206685717|gb|EDZ46199.1| amino acid ABC transporter, permease protein [Rhodobacterales
           bacterium Y4I]
          Length = 366

 Score =  254 bits (648), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 136/365 (37%), Positives = 220/365 (60%), Gaps = 15/365 (4%)

Query: 22  PVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTV 81
           P  Q G IAW+  N FG  KD  +T  ++ +LL  +P +I W+ ++A + G + T     
Sbjct: 17  PASQFGPIAWLRANLFGGWKDTAITLSLLAVLLAVVPNLIEWLLINATFGGDDETCRQNA 76

Query: 82  SQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRK 141
                       ACW F+  +++  + G YP    WRP +  L   +L           +
Sbjct: 77  G-----------ACWPFLQAKFQVLMVGVYPQDLSWRPAIAALALLVLAGFTYADRI--R 123

Query: 142 FLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALG 201
            +  I+ + L P+F+  ++ G  G+  V+ SLWGGL+++++++  G+I+S+PLG+LLALG
Sbjct: 124 GIALIVAWALLPVFALIMIGGAFGMQEVDQSLWGGLMLSVLLALVGVIVSIPLGVLLALG 183

Query: 202 RNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFAS 261
           R+   P ++  C+ FIEL RGVPL+T+LFMAS+M+PLFLP    ++ LLR  +G+  F+S
Sbjct: 184 RHYGSPAVKAICVAFIELVRGVPLITILFMASVMMPLFLPPDLVINNLLRIQIGMILFSS 243

Query: 262 AYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDS 321
           AY+AEV+RGGLQ+I KGQ EA+ +LG+S  + +  +++PQ ++ V+P ++   I LFKD+
Sbjct: 244 AYMAEVVRGGLQAIPKGQTEASLALGVSPARTIIFVVVPQALRHVLPPLIGRCIALFKDT 303

Query: 322 SLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
           SL+ I+ + D LG+VR    +  W+         +F  FV+W+ C+S+SLY   +E+   
Sbjct: 304 SLVIIVGLLDFLGMVRGAALDPEWLG--FQAEAYVFAAFVYWLICYSLSLYGRALERRGP 361

Query: 382 KGSKK 386
            GSK+
Sbjct: 362 AGSKR 366


>gi|299133837|ref|ZP_07027031.1| polar amino acid ABC transporter, inner membrane subunit [Afipia
           sp. 1NLS2]
 gi|298591673|gb|EFI51874.1| polar amino acid ABC transporter, inner membrane subunit [Afipia
           sp. 1NLS2]
          Length = 454

 Score =  253 bits (647), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 128/250 (51%), Positives = 178/250 (71%)

Query: 136 PSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
           P+  R  L+S L F    I    +     GL +V+T LWGGLLVTLV+S  GI+ SMP+G
Sbjct: 204 PNGRRAGLSSALTFAGIAIVIVALRLDQGGLPVVDTRLWGGLLVTLVVSITGIVASMPVG 263

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           I LALGR S IP+LR  C+ FIE +RGVPL+TVLF A+ MLPLFLP  + +D L+R L+G
Sbjct: 264 IALALGRTSRIPLLRIFCVAFIEFWRGVPLITVLFFATYMLPLFLPGDFTIDALVRVLVG 323

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           ++ FA AY AEV+RGGL +I +GQ EAAN+LGLSY +   LI++PQ ++ VIP +VN+FI
Sbjct: 324 IALFAGAYNAEVIRGGLLAIPRGQREAANALGLSYWKTTGLIVLPQALRHVIPALVNSFI 383

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD++L+ I+++FDLLG +R  F++ TW +  T  TG  F G ++W+ CF++S YS+F
Sbjct: 384 ALFKDTTLVLIVSLFDLLGQLRAAFADPTWATPTTLFTGFAFTGIIYWVGCFAMSRYSLF 443

Query: 376 IEKTLHKGSK 385
           +E+ L+   +
Sbjct: 444 VERRLNAHRQ 453



 Score = 79.0 bits (193), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 71/135 (52%), Gaps = 5/135 (3%)

Query: 10  YVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAV 69
           +VRK L      PV   G++ ++    F +P +I LT   + L    +   I ++ +DAV
Sbjct: 8   FVRKTLAPARKAPVITTGLVGFLRMRLFNSPLNIALTFASVALAWLILEPTIRFLLIDAV 67

Query: 70  WIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSIL 129
           W G++RT C     G   P G   ACW FI  ++ Q I+G YP  QRWR  L F   ++L
Sbjct: 68  WTGADRTACLADKAG--HPVG---ACWPFIQAKFTQLIYGFYPEDQRWRANLTFALAALL 122

Query: 130 LTPMLIPSFPRKFLN 144
           L P+L+P  P K LN
Sbjct: 123 LAPLLVPKIPGKTLN 137


>gi|75675719|ref|YP_318140.1| amino acid ABC transporter, inner membrane component [Nitrobacter
           winogradskyi Nb-255]
 gi|74420589|gb|ABA04788.1| amino acid ABC transporter membrane protein 2, PAAT family
           [Nitrobacter winogradskyi Nb-255]
          Length = 506

 Score =  253 bits (645), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 124/222 (55%), Positives = 168/222 (75%)

Query: 165 GLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVP 224
           GL +V+T LWGGLLVTLV+S  GI+ S+P+GI LALGR S +P++R   I FIE +RGVP
Sbjct: 285 GLPVVDTRLWGGLLVTLVVSVTGIVSSIPIGIALALGRRSTLPLIRVFSIAFIEFWRGVP 344

Query: 225 LVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAAN 284
           L+TVLF A+ MLPLFLP  + VD L+R L+G++ FA AY AEV+RGGL ++  GQ EAA+
Sbjct: 345 LITVLFFATYMLPLFLPGNFTVDGLVRVLIGIALFAGAYNAEVIRGGLAAVPGGQAEAAH 404

Query: 285 SLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSEST 344
           +LGLSY +   LI+MPQ ++ VIPG+VN+FI LFKD+SL+SI+ +FDLLGI+R +F++ T
Sbjct: 405 ALGLSYWKTTGLIVMPQAVRHVIPGLVNSFIALFKDTSLVSIVALFDLLGILRASFADPT 464

Query: 345 WISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
           W +  T  TG  F G +++ FCFSIS YS+F+E  L+   + 
Sbjct: 465 WATPTTLFTGFAFTGLIYFAFCFSISRYSLFVEHRLNAHRRT 506



 Score = 84.7 bits (208), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 68/176 (38%), Positives = 99/176 (56%), Gaps = 8/176 (4%)

Query: 10  YVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLL-LFSIPGIIHWVFLDA 68
           +VR  L+     PV    ++ ++    F +P + LLT + + LL LF +P +  ++F+DA
Sbjct: 9   FVRDDLVPERRAPVTTTNLLRFVQIRLFNSPGNALLTFVGVALLWLFVVPAV-RFLFIDA 67

Query: 69  VWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSI 128
            W G +RT C     G  Q  G   ACW F+  +  QFI+G YP  +RWR  L FL  ++
Sbjct: 68  AWEGQDRTSCLAADAG--QSIG---ACWPFVQAKITQFIYGFYPEPERWRVNLTFLLAAV 122

Query: 129 LLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVIS 184
           LL P+LIP  P K LN+ L F  FP+ +FF+L+GG G++    S   GLL +L  S
Sbjct: 123 LLLPLLIPRLPAKRLNAGLFFVAFPVTAFFLLHGG-GITGFGVSWSAGLLSSLADS 177


>gi|149913101|ref|ZP_01901635.1| hypothetical protein RAZWK3B_03895 [Roseobacter sp. AzwK-3b]
 gi|149813507|gb|EDM73333.1| hypothetical protein RAZWK3B_03895 [Roseobacter sp. AzwK-3b]
          Length = 428

 Score =  252 bits (644), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 151/436 (34%), Positives = 237/436 (54%), Gaps = 63/436 (14%)

Query: 4   SCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHW 63
           S  +  +VR+ +L    PP    G I W+  N F  P + ++T L I  +   + G + W
Sbjct: 2   SKSDIAFVRREMLPEKAPPATAAGPIKWVRDNLFPGPINTIMTLLAIYFIYQIVSGAMPW 61

Query: 64  VFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFG-NYPMAQRWRPILV 122
            FL+ VW  S+   C  V QG          C++ + +R+ Q +FG  YP  Q WRP L 
Sbjct: 62  -FLNGVWTTSSLAECREVLQGA------TGGCFSVLTERWNQLLFGFQYPSEQYWRPTLA 114

Query: 123 FLTGSILLTPMLIPSFPRK---------FLNSILLFG---LFPIFSFFVLYGG------- 163
           F+   + + P+L  + PRK         F+   L++G   L P+ +   L  G       
Sbjct: 115 FVLLFVAVAPVLFVALPRKLLIFTGLYPFIAFWLIWGGTLLVPLVALIGLVAGYVVFLRV 174

Query: 164 ---------------------------------LGLSIVETSLWGGLLVTLVISFFGIII 190
                                            L L  V++   GG ++ +++    + +
Sbjct: 175 ETKGFATAALTGLVAVVLVWWLGGYVSTAASETLALEPVQSRNMGGFMLNMILGTVCVSL 234

Query: 191 SMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLL 250
           S+P GILLALGR S++P++++ C+ FIE  RGVPL+T+LF+A+++L  FLP   + D +L
Sbjct: 235 SLPFGILLALGRQSDMPIIKWICVIFIEFIRGVPLITLLFVANVVLAYFLPPGSNFDLIL 294

Query: 251 RALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGI 310
           R ++ ++ FASAYIAEV+RGGL ++ +GQ+EAA+SLGL Y Q MRLII+PQ +K  IPGI
Sbjct: 295 RVIIMITMFASAYIAEVIRGGLAALPRGQYEAADSLGLDYAQSMRLIILPQALKISIPGI 354

Query: 311 VNTFIGLFKDSSLISIINMFDLLGIVRVN-FSESTWISSVTPTTGLIFIGFVFWIFCFSI 369
           VN  +GLFKD++L+S+I+MFDL+G++R    + + W        G  F   +F++ C+ I
Sbjct: 355 VNVSVGLFKDTTLVSVISMFDLVGMIRGPILAATEWNGVYWELWG--FAVVLFFVVCYGI 412

Query: 370 SLYSVFIEKTLHKGSK 385
           S YS ++E+ L +  +
Sbjct: 413 SQYSQWLERQLQRDHR 428


>gi|224367655|ref|YP_002601818.1| AapM [Desulfobacterium autotrophicum HRM2]
 gi|223690371|gb|ACN13654.1| AapM [Desulfobacterium autotrophicum HRM2]
          Length = 364

 Score =  252 bits (644), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 140/367 (38%), Positives = 213/367 (58%), Gaps = 22/367 (5%)

Query: 21  PPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTT 80
           PP+   G+I W+  N F    + +LT +++ LL  ++P  I W F+D++W  +       
Sbjct: 15  PPITNIGVIGWVRANLFNGVLNSILTLVVLALLWLTVPPFIKWAFIDSLWTST------- 67

Query: 81  VSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPR 140
               G +    + ACW+ I       IFG YP   +WRP    L   +LL  +L  S  R
Sbjct: 68  ----GAECQAIDGACWSIIPANLRFIIFGFYPHDLQWRP----LAAMVLLVALLFYSQDR 119

Query: 141 KFLNSILLF----GLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGI 196
           +     L++    GLF +            S VE++ WGGL +TL++S FG+  + P G+
Sbjct: 120 QHWKKHLIYAWAIGLFTMGLLLKGGILGFES-VESNKWGGLPLTLLLSVFGLTAAYPFGV 178

Query: 197 LLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGV 256
            LALGR S +PV++   + +IEL RGVPL+++LFM+S++ PL LP+   ++K+LRA + +
Sbjct: 179 FLALGRQSRMPVIKAFSVVYIELIRGVPLISLLFMSSVVFPLLLPEGVTLNKILRAQVAI 238

Query: 257 SAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIG 316
             F +AYIAEV+RGGLQ +++GQ+EAA SLGL+Y Q MRLII+PQ +K VIP  V+  I 
Sbjct: 239 IMFTAAYIAEVVRGGLQGMNRGQYEAAESLGLNYFQTMRLIILPQALKIVIPPSVSILIS 298

Query: 317 LFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFI 376
            FKD+SL+ II ++DLL   +   S   W+         IF+  ++++ CF +S YS  +
Sbjct: 299 AFKDTSLVVIIALYDLLKTTQTTLSHPQWMG--FSAEAYIFVALIYFVCCFFMSNYSRRL 356

Query: 377 EKTLHKG 383
           E+ L  G
Sbjct: 357 ERELDTG 363


>gi|148255316|ref|YP_001239901.1| putative amino acid ABC transporter permease [Bradyrhizobium sp.
           BTAi1]
 gi|146407489|gb|ABQ35995.1| amino acid ABC transporter membrane protein 2, PAAT family
           [Bradyrhizobium sp. BTAi1]
          Length = 506

 Score =  251 bits (642), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 121/222 (54%), Positives = 168/222 (75%)

Query: 165 GLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVP 224
           GL IV+T LWGG+LVTLV+S  GI+ SMP+GI LALGR S IP++R   I FIEL RGVP
Sbjct: 285 GLPIVDTRLWGGMLVTLVVSVIGIVASMPIGIALALGRRSTIPLIRLFSIAFIELVRGVP 344

Query: 225 LVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAAN 284
           L+TVLF A+ MLPLFLP    +D L+RAL+GV+ F+ AY+AEV+RGGLQ+I +GQ EAA+
Sbjct: 345 LITVLFFATYMLPLFLPGNMRIDGLVRALVGVALFSGAYMAEVIRGGLQAIPRGQAEAAS 404

Query: 285 SLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSEST 344
           +LGLS+ +    I++PQ ++ VIPGIVN+FI LFKD+SL+SI+ +FDLLG ++ +F++  
Sbjct: 405 ALGLSWWKTTSFIVLPQALRHVIPGIVNSFISLFKDTSLVSIVALFDLLGSLKASFADPV 464

Query: 345 WISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
           W +  T  TG  F G ++++FCF +S YS+ +E+ L+   + 
Sbjct: 465 WATPTTAFTGFAFTGLIYFVFCFGMSRYSLLVERRLNAHRRH 506



 Score = 93.6 bits (231), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 54/158 (34%), Positives = 87/158 (55%), Gaps = 6/158 (3%)

Query: 10  YVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAV 69
           ++R+ +      PV   G   ++      +P +ILLT +   L+ F++   + ++ +DAV
Sbjct: 9   FIRQDMAGERPAPVKTTGFTGFVRTRLLNSPTNILLTLVSALLIWFTVIPALKFLLVDAV 68

Query: 70  WIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSIL 129
           W+G +R  C   + G         ACW ++  ++ QF++G YP A+RWR  L +    +L
Sbjct: 69  WVGKDREACLEQNVGHAV-----GACWPYVTAKFGQFMYGFYPDAERWRVNLTYGLAVVL 123

Query: 130 LTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLS 167
           L P+LIP  P K LN+ L F   P+ +FF+LYGG GLS
Sbjct: 124 LVPLLIPRLPAKGLNAGLFFFALPVVAFFLLYGG-GLS 160


>gi|114766876|ref|ZP_01445798.1| ABC glutamate/glutamine/aspartate/asparagine transporter, inner
           membrane subunit BztC [Pelagibaca bermudensis HTCC2601]
 gi|114540922|gb|EAU43982.1| ABC glutamate/glutamine/aspartate/asparagine transporter, inner
           membrane subunit BztC [Roseovarius sp. HTCC2601]
          Length = 438

 Score =  251 bits (642), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 151/438 (34%), Positives = 234/438 (53%), Gaps = 60/438 (13%)

Query: 4   SCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHW 63
             +   +VR  +++   PP+ Q G   WIH+N F TP +++LT + + ++   +  ++ W
Sbjct: 5   HAQTVAFVRDTMVEEQEPPLSQSGAYKWIHENMFSTPLNVILTVVSLFVIWTVLSHLLPW 64

Query: 64  VFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVF 123
             +  +W   +   C  +       D  + ACWA I +R+ Q +FG YP    WRP+L F
Sbjct: 65  AVM-GIWDADSLAQCREIRDEIYGADA-SVACWAVISERWNQLLFGFYPPELYWRPVLAF 122

Query: 124 LTGSILLTPMLIPSFPRK---------FLNSILLFG------------------------ 150
           +     + P+L  S PRK         F+   LL+G                        
Sbjct: 123 VLFLAAIAPVLFASVPRKALWFSAAAPFVLYWLLWGGSLWGPIAVAAGFALGAVVMRFAA 182

Query: 151 -------------LFPIFSFFVLYGGLGLSI----------VETSLWGGLLVTLVISFFG 187
                          P+  +F L G L  ++          V ++  GG ++ ++I   G
Sbjct: 183 PALGALAAVLLAIFVPLLYWFTLSGPLAGALNAVIPLELVNVRSNDMGGFMLAMIIGVSG 242

Query: 188 IIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVD 247
           I +S+PLGI+LALGR S++ ++    + FIE+ RGVPL+  LF AS++L  FLP   + D
Sbjct: 243 IALSLPLGIVLALGRQSDLFIINKCSVIFIEVIRGVPLIVWLFTASLLLNYFLPPGTNFD 302

Query: 248 KLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVI 307
            +LR ++ V+ F+SAYIAEV+RGGL ++ KGQ+EAA++LGL Y + MRLII+PQ +K  I
Sbjct: 303 LMLRVIIMVTLFSSAYIAEVVRGGLAALPKGQYEAADALGLDYWKSMRLIILPQALKISI 362

Query: 308 PGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCF 367
           PGIVNTFIGLFKD++L+  I + D +G+     + + W          +FIG  F+IFCF
Sbjct: 363 PGIVNTFIGLFKDTTLVVFIGLLDPIGLSNAIRASTDWNGIYWEL--FVFIGLCFFIFCF 420

Query: 368 SISLYSVFIEKTLHKGSK 385
           S+  YS+F+EK L +  +
Sbjct: 421 SMGRYSLFLEKKLRREHR 438


>gi|144899136|emb|CAM76000.1| binding-protein-dependent transport system inner membrane component
           [Magnetospirillum gryphiswaldense MSR-1]
          Length = 380

 Score =  251 bits (641), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 147/361 (40%), Positives = 223/361 (61%), Gaps = 17/361 (4%)

Query: 29  IAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQP 88
           ++W   N F +  + +LT L + LL  ++P ++ W   +A W  ++ T        G   
Sbjct: 34  LSWAKSNLFDSVPNTVLTLLALLLLWETVPPLLSWGLFNATWSVADGTAAACRDSTG--- 90

Query: 89  DGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILL 148
                ACWA + ++    +FG YP  Q WRP+L     + ++  ML  S  R+F    L 
Sbjct: 91  -----ACWALMGEKNRLMLFGVYPYDQHWRPLL----ATAIVIAMLATSALRRFWRPALG 141

Query: 149 F---GLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSN 205
           +   G   + ++ +  G  GL+ VET+ WGGL +TL ++  GI+++ PL I+LALGR SN
Sbjct: 142 YAWLGTVVVVAWLMWGGFFGLTYVETAQWGGLPLTLGLALLGIVLAFPLSIVLALGRRSN 201

Query: 206 IPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIA 265
           +P ++  C  +IEL RGVPLV+VLFMAS+M PLFLP+   +DKLLRAL G++ F +AY+A
Sbjct: 202 LPAIKAICTGYIELVRGVPLVSVLFMASVMFPLFLPEGVTIDKLLRALAGMTLFTAAYLA 261

Query: 266 EVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLIS 325
           E +RGGLQ+I +GQ EAA++LGLSY +KMRLI++PQ ++ VIP IVN FI  FKD+SL++
Sbjct: 262 EAVRGGLQAIPRGQEEAADALGLSYWRKMRLIVLPQALRLVIPPIVNQFISCFKDTSLVT 321

Query: 326 IINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSK 385
           I+ ++DLL   +   ++  W        G +    V+W FCF +S YS ++E+ L  G++
Sbjct: 322 IVGLYDLLAATKAALADPEWRPFF--VEGYVAAALVYWCFCFFMSRYSQWLERELATGTR 379

Query: 386 K 386
           +
Sbjct: 380 R 380


>gi|84499806|ref|ZP_00998094.1| ABC glutamate/glutamine/aspartate/asparagine transporter, inner
           membrane subunit BztC [Oceanicola batsensis HTCC2597]
 gi|84392950|gb|EAQ05161.1| ABC glutamate/glutamine/aspartate/asparagine transporter, inner
           membrane subunit BztC [Oceanicola batsensis HTCC2597]
          Length = 434

 Score =  251 bits (640), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 156/439 (35%), Positives = 243/439 (55%), Gaps = 77/439 (17%)

Query: 10  YVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTAL----IICLLLFSIPGIIHWVF 65
           YV++  + PS PP  + G + W+ +N F +  + ++T L    I  L ++++P I     
Sbjct: 11  YVQRSQIPPSPPPATEAGAVRWVRENLFSSTANAIMTLLGLLAIYHLAVWALPWI----- 65

Query: 66  LDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFG-NYPMAQRWRPILVFL 124
           L+ VW   + + C  +       DG   AC+A I +R+ Q +FG  YP  + WRP L F+
Sbjct: 66  LNGVWNADSLSECREIL------DGARGACFAVIAERWNQLLFGFKYPSTEYWRPTLAFV 119

Query: 125 TGSILLTPMLIPSFPRKFLNSILLFGLFPIFSF------------FVLYG---------- 162
              +  +P+L    PR+ L   +L  L+P   F            F L G          
Sbjct: 120 LLLVSASPVLFSKLPRQLL---VLTALYPFVGFWLIWGGSIWVPVFALLGIVAGYYAFKQ 176

Query: 163 --------GLGLSIVETSLW---------------------------GGLLVTLVISFFG 187
                   GL  ++V  +L+                           GG ++ L++    
Sbjct: 177 LERQSFAMGLIGAVVAAALFWWVTGFVIPDLSRIIPISLPEVPSRDMGGFMLNLILGTVC 236

Query: 188 IIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVD 247
           I +S+P+GI+LALGR S +P++++ C+ FIE  RGVPL+T+LF+A+++L  FLP   + D
Sbjct: 237 ISLSLPIGIVLALGRRSQMPLIKWICVIFIEFIRGVPLITLLFVANVVLAYFLPPGSNFD 296

Query: 248 KLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVI 307
            +LR ++ ++ FASAYIAEV+RGGL ++ KGQ+EAA+SLGL Y Q MRLII+PQ +K  I
Sbjct: 297 LILRVIIMITMFASAYIAEVIRGGLAALPKGQYEAADSLGLDYPQAMRLIILPQALKISI 356

Query: 308 PGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCF 367
           PGIVN  +GLFKD++L+S+I+MFD++G++R     ST  + V      IF   +F+I C+
Sbjct: 357 PGIVNVAVGLFKDTTLVSVISMFDMVGMIRGPILASTDWNGVYWEL-FIFAALLFFIVCY 415

Query: 368 SISLYSVFIEKTLHKGSKK 386
           +IS YS ++E+ L  G K+
Sbjct: 416 NISQYSQWLERQLDTGHKR 434


>gi|298291389|ref|YP_003693328.1| polar amino acid ABC transporter inner membrane subunit [Starkeya
           novella DSM 506]
 gi|296927900|gb|ADH88709.1| polar amino acid ABC transporter, inner membrane subunit [Starkeya
           novella DSM 506]
          Length = 458

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 124/222 (55%), Positives = 169/222 (76%)

Query: 165 GLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVP 224
           GL  VET  WGGLLVTLVI+  GI+ S+PLGI LALGR S +P++R   + FIE +RGVP
Sbjct: 237 GLPYVETRQWGGLLVTLVIAVTGIVASLPLGIALALGRRSQMPIVRLLSVVFIEFWRGVP 296

Query: 225 LVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAAN 284
           L+TVLF A+ MLPLFLP   + D LLRAL+GV+ F++AY+AEV+RGGLQ+I KGQ+E A 
Sbjct: 297 LITVLFFATYMLPLFLPQGSNPDGLLRALVGVALFSAAYMAEVIRGGLQAIPKGQYEGAM 356

Query: 285 SLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSEST 344
           ++GL++ Q MRLII+PQ +  VIPGIVN+FI LFKD++L+ I+++FD LG +R +F++  
Sbjct: 357 AVGLTWSQMMRLIILPQALTLVIPGIVNSFISLFKDTTLVLIVSIFDFLGQLRASFTDPN 416

Query: 345 WISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
           W S VT  TG  F G V+++FCF +S YS+F+E+ L+   + 
Sbjct: 417 WASPVTLYTGFAFAGVVYFLFCFGMSRYSLFVERRLNTSHRH 458



 Score =  100 bits (248), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 59/154 (38%), Positives = 92/154 (59%), Gaps = 9/154 (5%)

Query: 10  YVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAV 69
           ++R  ++ P  PP  Q G I W+ +N F +  + +LT + + L+L  +P ++ ++F+DAV
Sbjct: 10  FIRTEMVAPLPPPRRQVGAIGWMRENLFSSILNTVLTLVGLGLVLLIVPPLVRFMFIDAV 69

Query: 70  WIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSIL 129
           W G +R  C     G         ACW FI  +  Q I+G YP+ QRWRP +VF  G++L
Sbjct: 70  WTGQSREACLAPGTG---------ACWPFINAKLGQLIYGFYPIDQRWRPNIVFAAGAVL 120

Query: 130 LTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGG 163
           L P+L+ S+P K LN+ L F ++PI +F +L GG
Sbjct: 121 LVPLLVLSWPFKKLNAFLFFVIYPIVAFILLTGG 154


>gi|92117597|ref|YP_577326.1| amino acid ABC transporter permease [Nitrobacter hamburgensis X14]
 gi|91800491|gb|ABE62866.1| amino acid ABC transporter membrane protein 2, PAAT family
           [Nitrobacter hamburgensis X14]
          Length = 506

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 124/222 (55%), Positives = 167/222 (75%)

Query: 165 GLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVP 224
           GL IV T LWGGLLVTLV+S  GI+ S+P+GI LALGR S IP++R   I FIE +RG+P
Sbjct: 285 GLPIVNTRLWGGLLVTLVVSVTGIVASIPIGIALALGRRSTIPLIRIFSIAFIEFWRGIP 344

Query: 225 LVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAAN 284
           L+TVLF A+ MLPLFLP  + VD L+R L+GV+ FA AY AEV+RGGL +I +GQ EAA+
Sbjct: 345 LITVLFFATYMLPLFLPGNFTVDGLVRVLIGVALFAGAYNAEVIRGGLAAIPRGQAEAAH 404

Query: 285 SLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSEST 344
           +LGLSY +   LI+MPQ ++ VIPG+VN+FI LFKD+SL+SI+ +FDLLG +R +F++ T
Sbjct: 405 ALGLSYWKTTGLIVMPQALRHVIPGLVNSFIALFKDTSLVSIVALFDLLGSLRASFADPT 464

Query: 345 WISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
           W +  T  TG  F G ++++FCF +S YS+F+E  L+   + 
Sbjct: 465 WATPTTLFTGFAFAGIIYFVFCFGMSRYSLFVEHRLNAHRRS 506



 Score = 83.6 bits (205), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 61/154 (39%), Positives = 86/154 (55%), Gaps = 5/154 (3%)

Query: 10  YVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAV 69
           +VR  L+     P+   G + ++    F TP + LLT +   LL F I   I ++ +DAV
Sbjct: 9   FVRADLVPERPAPIKTIGFVGFLRTRLFNTPTNALLTIVGALLLWFIIVPTIRFLLVDAV 68

Query: 70  WIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSIL 129
           W G +RT C     G  Q  G   ACW F+  +  QFI+G YP  +RWR  L FL  ++L
Sbjct: 69  WEGKDRTSCLAADAG--QSIG---ACWPFVQAKITQFIYGFYPEPERWRVNLTFLLAAVL 123

Query: 130 LTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGG 163
           L P+LIP  P K LN+ + F  FP+ +FF+L+GG
Sbjct: 124 LLPLLIPRLPAKSLNAGVFFVAFPVVAFFLLHGG 157


>gi|158423211|ref|YP_001524503.1| amino acid ABC transporter permease protein [Azorhizobium
           caulinodans ORS 571]
 gi|158330100|dbj|BAF87585.1| amino acid ABC transporter permease protein [Azorhizobium
           caulinodans ORS 571]
          Length = 466

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 126/222 (56%), Positives = 167/222 (75%)

Query: 165 GLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVP 224
           GL  VET  WGG++VTLVI+  GII S+PLGILLALGR S +P++  A   FIE +RGVP
Sbjct: 245 GLEWVETRQWGGMMVTLVIAVTGIIASLPLGILLALGRRSKMPLMHIASTLFIEFWRGVP 304

Query: 225 LVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAAN 284
           LVTVLF A+ MLPLFLP  + +D LLRAL+GV+ FASAY+AEV+RGGLQ+I KGQ+E A 
Sbjct: 305 LVTVLFFATYMLPLFLPGRFTIDGLLRALVGVALFASAYMAEVVRGGLQAIPKGQYEGAM 364

Query: 285 SLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSEST 344
           +LGL     MRL+++PQ +K VIPGIVNTFI LFKD++L+ I+++FDLLG++R  F++ +
Sbjct: 365 ALGLPGTLMMRLVVLPQALKLVIPGIVNTFIALFKDTTLVLIVSIFDLLGVLRAAFTDPS 424

Query: 345 WISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
           W +  T  TG  F G  ++IFCF +S YS+ +EK L +  + 
Sbjct: 425 WATPTTLYTGFGFAGLFYFIFCFGMSRYSLALEKRLDRNHRH 466



 Score =  116 bits (290), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 59/154 (38%), Positives = 90/154 (58%), Gaps = 5/154 (3%)

Query: 10  YVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAV 69
           +V   +  P  PPV  RG +AW+  +  G+P  ILLT   + ++  ++P +I +  +DAV
Sbjct: 14  FVAPAMKAPEPPPVSARGPVAWVRAHLLGSPLQILLTLFGLWVVWLAVPPLIRFFLIDAV 73

Query: 70  WIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSIL 129
           + G NR  C     G  +P G   ACW FI  ++ Q ++G YP A+RWR  +V+    IL
Sbjct: 74  YTGDNRNACLPDVVG--RPVG---ACWPFIAAKWNQIVYGFYPEAERWRVNVVYALAVIL 128

Query: 130 LTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGG 163
           L P+L+   P K LN++L FG+FP+ +F +L GG
Sbjct: 129 LVPLLLQKVPYKRLNALLFFGVFPVVAFVLLTGG 162


>gi|85717303|ref|ZP_01048257.1| amino acid ABC transporter, inner membrane component [Nitrobacter
           sp. Nb-311A]
 gi|85695892|gb|EAQ33796.1| amino acid ABC transporter, inner membrane component [Nitrobacter
           sp. Nb-311A]
          Length = 506

 Score =  250 bits (638), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 122/222 (54%), Positives = 167/222 (75%)

Query: 165 GLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVP 224
           GL +V+T LWGGLLVTLV+S  GI+ S+P+GI LALGR S +P++R   I FIE +RGVP
Sbjct: 285 GLPVVDTRLWGGLLVTLVVSVTGIVSSIPIGIALALGRRSTLPLIRIFSIAFIEFWRGVP 344

Query: 225 LVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAAN 284
           L+TVLF A+ MLPLFLP  + +D L+R L+G++ FA AY AEV+RGGL +I  GQ EAA+
Sbjct: 345 LITVLFFATYMLPLFLPGNFTIDGLVRVLIGIALFAGAYNAEVIRGGLAAIPSGQAEAAH 404

Query: 285 SLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSEST 344
           +LGLSY +   LI+MPQ ++ VIPG+VN+FI LFKD+SL+SI+ +FDLLGI+R +F++  
Sbjct: 405 ALGLSYWKTTGLIVMPQAVRNVIPGLVNSFIALFKDTSLVSIVALFDLLGILRASFADPA 464

Query: 345 WISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
           W +  T  TG  F G +++ FCFS+S YS+F+E  L+   + 
Sbjct: 465 WATPTTLFTGFAFTGLIYFAFCFSMSRYSLFVEHRLNAHRRN 506



 Score = 79.3 bits (194), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 62/155 (40%), Positives = 88/155 (56%), Gaps = 7/155 (4%)

Query: 10  YVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLL-LFSIPGIIHWVFLDA 68
           +VR  L+     PV    ++  +    F +P + LLT +   LL LF +P +  + F+DA
Sbjct: 9   FVRVALVPERRAPVRTTSLVRLLGIRLFSSPSNALLTVVGAALLWLFLVPAV-RFFFVDA 67

Query: 69  VWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSI 128
           VW G NRT C  ++    Q  G   ACW F+  +  QFI+G YP  +RWR  L FL  ++
Sbjct: 68  VWEGQNRTSC--LAADASQSIG---ACWPFVQAKITQFIYGFYPEPERWRVNLTFLLAAV 122

Query: 129 LLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGG 163
           LL P+LIP  P K LN+ L F  FP+ +FF+L+GG
Sbjct: 123 LLLPLLIPRLPAKRLNAGLFFVAFPVAAFFLLHGG 157


>gi|323698174|ref|ZP_08110086.1| polar amino acid ABC transporter, inner membrane subunit
           [Desulfovibrio sp. ND132]
 gi|323458106|gb|EGB13971.1| polar amino acid ABC transporter, inner membrane subunit
           [Desulfovibrio desulfuricans ND132]
          Length = 364

 Score =  250 bits (638), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 137/355 (38%), Positives = 209/355 (58%), Gaps = 22/355 (6%)

Query: 27  GIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGI 86
           G+I W+  N F    + +LT L + LL+ ++P +I W F+ AVW G  + VC        
Sbjct: 22  GVILWLRTNLFSGWFNSVLTILAVLLLVKTVPPLIDWAFIRAVWTGGPQ-VC-------- 72

Query: 87  QPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSI 146
             DG + ACWAFI D+    + G YP    WRP    L   IL   ++  +   +    +
Sbjct: 73  --DG-SGACWAFIADKARVMLIGTYPQDLEWRP----LVAGILFAGVVAATVSGRCKKRV 125

Query: 147 LLFGLFPIF---SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRN 203
           L    +P+    + +++ GG GL+ V+ S+WGGL+++L ++  GII+S+P GILLALGR 
Sbjct: 126 LTVA-WPVLFVAALWLIGGGAGLTEVDQSMWGGLMLSLGLAAVGIILSVPFGILLALGRQ 184

Query: 204 SNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAY 263
           S +  +   C+  IEL RGVPL+T+LFMAS+M+PLFLP    ++ LLR  +G+  F+SAY
Sbjct: 185 SRMVGVSSVCVGLIELIRGVPLITILFMASVMMPLFLPVNLQINNLLRVQVGIILFSSAY 244

Query: 264 IAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSL 323
           IAEV+RGGLQ++  GQ +AA +LGLS       +++PQ ++ V+P ++   I LFKD+SL
Sbjct: 245 IAEVVRGGLQAVPGGQLDAAKALGLSPWMITLFVVLPQALRYVLPALIGRCIALFKDTSL 304

Query: 324 ISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEK 378
           + I+ + D LG+ +    +  W+       G +F   V+W  CF +S Y   +EK
Sbjct: 305 VIIVGLLDFLGMAKAASQDQHWLGH--EVEGYVFCAVVYWCICFGMSRYGRSLEK 357


>gi|254512274|ref|ZP_05124341.1| amino acid ABC transporter, permease protein [Rhodobacteraceae
           bacterium KLH11]
 gi|221535985|gb|EEE38973.1| amino acid ABC transporter, permease protein [Rhodobacteraceae
           bacterium KLH11]
          Length = 432

 Score =  250 bits (638), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 150/441 (34%), Positives = 236/441 (53%), Gaps = 70/441 (15%)

Query: 3   DSCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIH 62
            +     +V +  + P+ PP  + GI+ W+  N F    + +LT   + L+   + G++ 
Sbjct: 4   QTTNPIAFVAEGTIPPAPPPANETGIVKWLRDNLFSGVANTVLTLASLTLIYLLLKGVVP 63

Query: 63  WVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFG-NYPMAQRWRPIL 121
           WVF + VW  S+   C  +  G       + AC+A + +R+ Q I+G  YP    WRP L
Sbjct: 64  WVF-NGVWDASSLAECREILAGK------SGACFAVLSERWPQLIYGFKYPADAYWRPNL 116

Query: 122 VFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGG------------------ 163
            F+   + + P+L    PRK L   +   L+P  +F++++GG                  
Sbjct: 117 AFVLMLVAVAPVLFFDLPRKML---IFTALYPFIAFWLIWGGTILAPLVALVGFVVAGAV 173

Query: 164 -------------LGLSIVETSLW-------------------------GGLLVTLVISF 185
                         G  IV   +W                         GG ++ +++  
Sbjct: 174 FQKLGKNSFAAGFFGAIIVALVVWKIGGALIPEGASENAWLPAVPSRDLGGFMLNMMLGV 233

Query: 186 FGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWD 245
             + +S+PLGI LALGR S++P++++ C+ FIE  RGVPL+T+LF+AS+ML  F P    
Sbjct: 234 TCVSLSVPLGIALALGRQSDMPLIKWICVIFIEFIRGVPLITLLFVASVMLSYFFPPGSS 293

Query: 246 VDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKR 305
           VD  LR ++ ++ F++AYIAEV+RGGL ++ +GQ+EAA+SLGL Y Q MRLII+PQ +K 
Sbjct: 294 VDLFLRVMIMITMFSAAYIAEVIRGGLAALPRGQYEAADSLGLDYPQAMRLIILPQALKI 353

Query: 306 VIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSEST-WISSVTPTTGLIFIGFVFWI 364
            IPGIVN  +GLFKD++L+S+I+MFDL+G++R     ST W        G  F   +F++
Sbjct: 354 SIPGIVNVAVGLFKDTTLVSVISMFDLVGMIRGPILASTEWNGVYWELFG--FAALLFFV 411

Query: 365 FCFSISLYSVFIEKTLHKGSK 385
            C+SIS YS ++E+ L    +
Sbjct: 412 VCYSISQYSQWLERRLATDHR 432


>gi|91977032|ref|YP_569691.1| amino acid ABC transporter permease [Rhodopseudomonas palustris
           BisB5]
 gi|91683488|gb|ABE39790.1| Amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine [Rhodopseudomonas palustris BisB5]
          Length = 502

 Score =  249 bits (637), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 124/221 (56%), Positives = 166/221 (75%)

Query: 165 GLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVP 224
           GL IV T  WGGLLVTLV+S  GI+ SMP+GI LALGR S IP++R  CI FIE +RGVP
Sbjct: 281 GLPIVGTRQWGGLLVTLVVSVTGIVGSMPIGIALALGRRSTIPLIRLFCIGFIEFWRGVP 340

Query: 225 LVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAAN 284
           L+TVLF A+ MLPLFLP  + +D LLR L+G++ FA AY AEV+RGGL +I +GQ EAA+
Sbjct: 341 LITVLFFATYMLPLFLPGNFTIDGLLRVLIGIALFAGAYNAEVVRGGLNAIPRGQGEAAS 400

Query: 285 SLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSEST 344
           +LGLSY +   LI++PQ ++ VIPG+VN+FI LFKD+SL+SI+ +FDLLG +R  F++ T
Sbjct: 401 ALGLSYAKTTGLIVLPQALRHVIPGLVNSFIALFKDTSLVSIVALFDLLGQLRAAFADPT 460

Query: 345 WISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSK 385
           W +  T  TG  F G ++++FCF +S YS+F+E  L+   +
Sbjct: 461 WSTPNTLFTGFAFTGLIYFVFCFGMSRYSLFVEHRLNAHRR 501



 Score = 88.6 bits (218), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 66/175 (37%), Positives = 96/175 (54%), Gaps = 6/175 (3%)

Query: 10  YVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAV 69
           +VR  ++     PV   G +  +    F +P +ILLT +   LL  +I   + ++ +DAV
Sbjct: 11  FVRSEMVPERAAPVRTTGFVGLVGGRLFSSPTNILLTIVGALLLYLTIVPSVKFLLVDAV 70

Query: 70  WIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSIL 129
           W GSNRT C   +   +  D    ACW F+  ++ QF++G YP  +RWR  L F   ++L
Sbjct: 71  WTGSNRTDCLAET---LHRD--VGACWPFVQAKFSQFVYGFYPQPERWRVDLTFALAAVL 125

Query: 130 LTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVIS 184
           L P+LIP  P K LN+ L F  FP+ +FF+L+GG GL     S    LL +LV S
Sbjct: 126 LLPLLIPRAPAKTLNAGLFFIAFPVVAFFLLHGG-GLHGFAVSWTADLLSSLVGS 179


>gi|304391887|ref|ZP_07373829.1| glutamate/glutamine/aspartate/asparagine transport system permease
           protein BztC [Ahrensia sp. R2A130]
 gi|303296116|gb|EFL90474.1| glutamate/glutamine/aspartate/asparagine transport system permease
           protein BztC [Ahrensia sp. R2A130]
          Length = 432

 Score =  249 bits (636), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 165/444 (37%), Positives = 241/444 (54%), Gaps = 70/444 (15%)

Query: 1   MIDSCKE-FPYVRKRLLQPSLP-PVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIP 58
           M D+  E   YV    L P+LP PV  RG  AW   NFF TP+D +L+ ++  L+   + 
Sbjct: 1   MSDTHAETVRYVATHEL-PALPAPVNTRGPAAWARANFFSTPRDTILSIIVGGLIAIGLW 59

Query: 59  GIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFG--------- 109
            ++ W+  D+V++  +   C  +  G         AC+A +  R+ Q IFG         
Sbjct: 60  KLLPWLVFDSVFVAGSLNECREIDSG---------ACFAVVTSRFNQLIFGFYPPELFWR 110

Query: 110 ------------------NYPMAQRWR----PILVF-------LTGSILLTPMLIPSFPR 140
                             N P    W     P+L +       + G +++  M+  +F  
Sbjct: 111 PILAFVLMLVAFAPVLHDNLPRKMLWFSAVFPLLAYWLIWGGTIWGPLMIIAMIALAFVA 170

Query: 141 -----KFLNSI-------------LLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLV 182
                K +N +             +LF   PI S       +GL  VE+S  GG  +T +
Sbjct: 171 FKAVAKSVNPVVGLLAAVAVGILWMLFLHDPIVSALSSAVNVGLEPVESSKLGGFQITFI 230

Query: 183 ISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPD 242
           I   GI+ S+P+GILLALGR S++P L+  C+ FIE  RGVPL+T+LF+AS +L  FLP 
Sbjct: 231 IGVTGIVASLPIGILLALGRGSDMPTLKMICVGFIEFIRGVPLITLLFVASTLLNYFLPP 290

Query: 243 TWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQV 302
             + D +LR ++ V+ FASAY+AEV+RGGL ++ KGQ+EAA++LGL+Y Q  RLII+PQ 
Sbjct: 291 GTNFDIVLRVIIMVTLFASAYMAEVIRGGLAALPKGQYEAADALGLNYWQATRLIILPQA 350

Query: 303 IKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVF 362
           +K  IPGIVNTFIGLFKD+ L+SII + D +GI++   S + W   +      IF+G VF
Sbjct: 351 LKISIPGIVNTFIGLFKDTVLVSIIGILDPIGIMQPIRSSAEWNGIIWELP--IFVGLVF 408

Query: 363 WIFCFSISLYSVFIEKTLHKGSKK 386
           +IFCF +S YS++ E+ L  G + 
Sbjct: 409 FIFCFLMSRYSMYFERKLDTGHRN 432


>gi|146340848|ref|YP_001205896.1| putative amino acid ABC transport, permease [Bradyrhizobium sp.
           ORS278]
 gi|146193654|emb|CAL77671.1| putative amino acid ABC transport, permease protein [Bradyrhizobium
           sp. ORS278]
          Length = 506

 Score =  249 bits (635), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 119/222 (53%), Positives = 167/222 (75%)

Query: 165 GLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVP 224
           GL +V+T LWGG+LVTLV++  GI+ SMP+GI LALGR S IP++R   I FIEL RGVP
Sbjct: 285 GLPVVDTRLWGGMLVTLVVTVIGIVASMPIGIALALGRRSTIPLIRIFSIAFIELVRGVP 344

Query: 225 LVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAAN 284
           L+TVLF A+ MLPLFLP    +D L+RAL+GV+ F+ AY+AEV+RGGLQ+I +GQ EAA+
Sbjct: 345 LITVLFFATYMLPLFLPGNLRIDGLVRALIGVALFSGAYMAEVIRGGLQAIPRGQAEAAS 404

Query: 285 SLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSEST 344
           +LGLS+ +    I++PQ ++ VIPGIVN+FI LFKD+SL+SI+ +FDLLG ++ +F++  
Sbjct: 405 ALGLSWWKTTSFIVLPQALRHVIPGIVNSFISLFKDTSLVSIVALFDLLGSLKASFADPV 464

Query: 345 WISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
           W +  T  TG  F G +++ FCF +S YS+ +E+ L+   + 
Sbjct: 465 WATPTTAFTGFAFTGLIYFAFCFGMSRYSLLVERRLNAHRRN 506



 Score =  108 bits (269), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 56/158 (35%), Positives = 91/158 (57%), Gaps = 6/158 (3%)

Query: 10  YVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAV 69
           ++R+ +      P+   G+I ++      +P +ILLT +   L+ F++   + ++ +DAV
Sbjct: 9   FIRQDMAGERPAPIKTTGVIGFVRTQLLNSPTNILLTLVSALLIWFTVIPALQFLLVDAV 68

Query: 70  WIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSIL 129
           W+G +R  C  ++Q    P G   ACW +I  ++ QF++G YP AQRWR  L ++    L
Sbjct: 69  WVGKDREAC--LAQNAGHPVG---ACWPYITAKFSQFMYGFYPEAQRWRVNLTYVLFVAL 123

Query: 130 LTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLS 167
           L P++I S P K LN+ L     P+ +FF+LYGG GLS
Sbjct: 124 LAPLMIRSVPAKTLNAGLFLVALPVVAFFLLYGG-GLS 160


>gi|167041374|gb|ABZ06127.1| putative binding-protein-dependent transport system inner membrane
           component [uncultured marine microorganism
           HF4000_005K23]
          Length = 420

 Score =  249 bits (635), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 141/353 (39%), Positives = 230/353 (65%), Gaps = 16/353 (4%)

Query: 28  IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQ 87
           I+  ++KN      + +L+ L+I +L+ +IPG+++W+F+DA +IG+++  CT        
Sbjct: 76  ILDQLNKNINSNWFNAILSLLVIFVLIKTIPGLLNWLFIDANFIGTSKEECTG------- 128

Query: 88  PDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSI-LLTPMLIPSFPRKFLNSI 146
               + ACW FI   +++ ++G YP  + WR    FL   + ++T + +    +K++   
Sbjct: 129 ----DGACWIFINVWFKRLVYGIYPSTEIWRINAAFLILIVTVITAIFVGPKIKKYIIIF 184

Query: 147 LLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSN 205
           LLF +FP  +  ++ GG+ GL  V T+ WGGL +T +++ F ++   P+G+L ALGR S+
Sbjct: 185 LLF-IFPFIAISLISGGIFGLKWVATNAWGGLSLTFIVAIFAMLFCFPVGMLFALGRRSS 243

Query: 206 IPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIA 265
            PV++Y  I FIE +RGVPL+TVLFMAS+M P+FLPD   +DKL+R ++ ++ F +AY+A
Sbjct: 244 YPVIKYTSIGFIEFWRGVPLITVLFMASVMFPMFLPDGTYMDKLVRVIIAITLFEAAYMA 303

Query: 266 EVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLIS 325
           EV+RGGLQ++ KGQ++A+ SLG+ Y +   LII+PQ +K  IPGI NTFI LFKD+ LI 
Sbjct: 304 EVIRGGLQALPKGQYDASKSLGMGYWRMHLLIILPQALKITIPGIANTFIALFKDTPLIL 363

Query: 326 IINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEK 378
           ++ + +LLG++ +  +   W+       G +F   V+WIFC+S+S YS  +E+
Sbjct: 364 VVGLLELLGMIDMAKANPDWLG--FAREGYVFAAIVYWIFCYSMSRYSQNLER 414


>gi|86750027|ref|YP_486523.1| polar amino acid ABC transporter, inner membrane subunit
           [Rhodopseudomonas palustris HaA2]
 gi|86573055|gb|ABD07612.1| polar amino acid ABC transporter, inner membrane subunit
           [Rhodopseudomonas palustris HaA2]
          Length = 501

 Score =  248 bits (632), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 122/222 (54%), Positives = 165/222 (74%)

Query: 165 GLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVP 224
           GL IV T  WGGLLVTLV+S  GI+ SMP+GI LALGR S IP++R   + FIE +RGVP
Sbjct: 280 GLPIVGTRQWGGLLVTLVVSVTGIVASMPIGIALALGRRSTIPLIRLFSVGFIEFWRGVP 339

Query: 225 LVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAAN 284
           L+TVLF A+ MLPLFLP  + +D L+R L+GV+ FA AY AEV+RGGL +I +GQ EAA+
Sbjct: 340 LITVLFFATYMLPLFLPGNFTIDGLMRVLIGVALFAGAYNAEVVRGGLNAIPRGQAEAAS 399

Query: 285 SLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSEST 344
           +LGLSY +   LI++PQ ++ VIPG+VN+FI LFKD+SL+SI+ +FDLLG +R  F++ T
Sbjct: 400 ALGLSYAKTTGLIVLPQALRHVIPGLVNSFIALFKDTSLVSIVALFDLLGQLRAAFADPT 459

Query: 345 WISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
           W +  T  TG  F G ++++FCF +S YS+F+E  L+   + 
Sbjct: 460 WSTPTTLFTGFAFTGLIYFVFCFGMSRYSLFVEHRLNAHRRT 501



 Score = 94.4 bits (233), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 59/154 (38%), Positives = 87/154 (56%), Gaps = 5/154 (3%)

Query: 10  YVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAV 69
           +VR  L+     PV   G I  +    F +P +ILLT +   L+ F++   + ++ +DAV
Sbjct: 11  FVRAELVPERAAPVKTTGFIGVMRGRLFNSPTNILLTIVGALLMYFTVVPTVKFLLVDAV 70

Query: 70  WIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSIL 129
           W GSNRT C   +   +  D    ACW F+  +  QF++G YP  +RWR  L F   ++L
Sbjct: 71  WTGSNRTDCLAET---LHRD--VGACWPFVQAKASQFVYGFYPQPERWRVDLTFALAALL 125

Query: 130 LTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGG 163
           L P+LIP  P K LN+ L F  FP+ +FF+L+GG
Sbjct: 126 LLPLLIPRAPAKTLNAGLFFVAFPVLAFFLLHGG 159


>gi|154248468|ref|YP_001419426.1| polar amino acid ABC transporter, inner membrane subunit
           [Xanthobacter autotrophicus Py2]
 gi|154162553|gb|ABS69769.1| polar amino acid ABC transporter, inner membrane subunit
           [Xanthobacter autotrophicus Py2]
          Length = 473

 Score =  247 bits (631), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 124/223 (55%), Positives = 167/223 (74%)

Query: 164 LGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGV 223
           +GL  VET LWGGLLVTLVI+  GI +S+P GILLALGR S +P+++   I FIE +RGV
Sbjct: 251 VGLPQVETRLWGGLLVTLVIAVTGITVSLPFGILLALGRRSKLPLVKALSIIFIEFWRGV 310

Query: 224 PLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAA 283
           PL+TVLF A+ MLPLFLP    +D LLRAL+GV+ FASAY+AEV+RGGLQ+I KGQ+E A
Sbjct: 311 PLITVLFFATYMLPLFLPGRLTIDGLLRALVGVALFASAYMAEVVRGGLQAIPKGQYEGA 370

Query: 284 NSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSES 343
            ++GL     +RL+++PQ +K VIPGIVN FIGLFKD++L+ I+++FDLLG +R  F++ 
Sbjct: 371 MAVGLPSSLMLRLVVLPQALKLVIPGIVNNFIGLFKDTTLVLIVSIFDLLGSMRAAFTDP 430

Query: 344 TWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
            W S  T  TG  F G ++++FCF +S YS+ +EK L +  + 
Sbjct: 431 NWASPTTLFTGFGFAGIIYFVFCFGMSRYSMALEKRLDRAQRH 473



 Score = 97.4 bits (241), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 59/154 (38%), Positives = 88/154 (57%), Gaps = 5/154 (3%)

Query: 10  YVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAV 69
           YV   L +    PV  RG + W+ K+  G+   +LLT   I L+  ++P +I +  +DAV
Sbjct: 19  YVSTTLREQEPAPVATRGPVLWVRKHLVGSVPQVLLTLFGIWLVYVTVPPMIKFFLIDAV 78

Query: 70  WIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSIL 129
           W G+NR  C     G         ACW F++ + +Q I+G YP ++RWR  +V+  G IL
Sbjct: 79  WTGANREACLPEKVGRAV-----GACWPFVWAKLDQLIYGFYPASERWRVNVVYALGVIL 133

Query: 130 LTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGG 163
           L P+LI   P K LN+IL FG++P+ +F +L GG
Sbjct: 134 LLPLLIQKLPGKRLNAILFFGIYPVVAFVLLTGG 167


>gi|294675894|ref|YP_003576509.1| glutamate/aspartate ABC transporter permease BztC [Rhodobacter
           capsulatus SB 1003]
 gi|3182936|sp|Q52665|BZTC_RHOCA RecName: Full=Glutamate/glutamine/aspartate/asparagine transport
           system permease protein BztC
 gi|1655714|gb|AAB17888.1| BztC [Rhodobacter capsulatus SB 1003]
 gi|294474714|gb|ADE84102.1| glutamate/aspartate ABC transporter, permease protein BztC
           [Rhodobacter capsulatus SB 1003]
          Length = 434

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 155/433 (35%), Positives = 234/433 (54%), Gaps = 61/433 (14%)

Query: 10  YVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAV 69
           +VR  +L P   PV Q G I W+ +N F  P +  LT   +   ++ +     W+ L  V
Sbjct: 6   FVRTEMLAPRPAPVSQVGAIKWMRENLFSGPLNTALTVFGLLATVWLVQAAAPWL-LHGV 64

Query: 70  WIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSIL 129
           W  ++ T C  +      P+    ACWA I  R+ QF+FG YP+ Q WR  + F    + 
Sbjct: 65  WNANSLTECRAIIAERWGPEA-TGACWAVIRVRWNQFLFGFYPVDQYWRLFVTFAGLFLA 123

Query: 130 LTPMLIPSFPRKFLNSILL--------------FGLFPIFSFFVLYG------------- 162
           L P+L  + PRK +   LL              +G   + + F + G             
Sbjct: 124 LAPVLFDALPRKLIWGTLLYPLAAFWLLWGGPIWGPVSVLAGFAILGLLFTALAPKLGVP 183

Query: 163 ---GLGLSI--------------------------VETSLWGGLLVTLVISFFGIIISMP 193
              G+GL +                          V++  +GG L+ LVI    I++S+P
Sbjct: 184 VSAGIGLVVAALFWLYAAAPIEAALQSALPLALPEVDSDQFGGFLLALVIGVTAIVVSLP 243

Query: 194 LGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRAL 253
           LGILLALGR S++ +++   +  IE  RGVPL+T+LF AS++L  FLP   + D +LR +
Sbjct: 244 LGILLALGRQSDMLIVKSLSVGIIEFVRGVPLITLLFTASLLLQYFLPPGTNFDLILRVV 303

Query: 254 LGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNT 313
           + V+ FA+AYIAEV+RGGL ++ +GQ+EAA++LGL Y Q  RLIIMPQ +K  IPGIV++
Sbjct: 304 ILVTLFAAAYIAEVIRGGLAALPRGQYEAADALGLDYWQAQRLIIMPQALKISIPGIVSS 363

Query: 314 FIGLFKDSSLISIINMFD-LLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLY 372
           FIGLFKD++L++ + +FD L GI  V  S+  W    T     IF+  +F++F FS+S Y
Sbjct: 364 FIGLFKDTTLVAFVGLFDPLKGISNVVRSDMAWKG--TYWEPYIFVALIFFLFNFSMSRY 421

Query: 373 SVFIEKTLHKGSK 385
           S+++E+ L +  +
Sbjct: 422 SMYLERKLKRDHR 434


>gi|83854939|ref|ZP_00948469.1| ABC glutamate/glutamine/aspartate/asparagine transporter, inner
           membrane subunit BztC [Sulfitobacter sp. NAS-14.1]
 gi|83842782|gb|EAP81949.1| ABC glutamate/glutamine/aspartate/asparagine transporter, inner
           membrane subunit BztC [Sulfitobacter sp. NAS-14.1]
          Length = 431

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 163/440 (37%), Positives = 243/440 (55%), Gaps = 73/440 (16%)

Query: 5   CKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGT-PKDIL-LTALIICLLLFSIPGIIH 62
               PYVR  +L    PP   +G + W+ ++ F + P  IL L AL +  L+ S  G + 
Sbjct: 6   AASVPYVRDTMLPQHAPPPTAQGPVKWVRESLFSSIPYTILTLAALYVIYLILS--GFLP 63

Query: 63  WVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFG-NYPMAQRWRPIL 121
           W+ L  VW  SN   C  V       DG  A C++ + +R+ Q +FG  YP    WRP L
Sbjct: 64  WL-LGGVWTTSNIRECREVL------DGVQAGCFSVLTERWNQLLFGIAYPQDGYWRPTL 116

Query: 122 VFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGL--------------- 166
            F+   + ++P+L  + PR     IL   ++P  +F++++GG  L               
Sbjct: 117 AFVLLFVAVSPVLFSNLPRGL---ILFTVIYPFIAFWLIWGGSLLVPLSALLAVVVGYVV 173

Query: 167 --SIVETSLWGGL---LVTLVISFF--------------------------------GII 189
              IV+TS  GGL   L+  V+++F                                G+I
Sbjct: 174 YSRIVKTSFAGGLFAGLIAGVVTWFVLGFITPSLSGVLALEPVASRNMGGFMLNMILGVI 233

Query: 190 ---ISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDV 246
              +S+P+GILLALGR S++P+++  C+ FIE  RGVPL+T+LF+A+++L  FLP   + 
Sbjct: 234 CVSLSLPMGILLALGRQSSLPIIKLICVVFIEFIRGVPLITLLFVANVVLAYFLPPGTNF 293

Query: 247 DKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRV 306
           D +LR ++ ++ FASAYIAEV+RGGL ++ +GQ+EAA+SLGL Y Q MRLII+PQ +K  
Sbjct: 294 DLILRVIIMITMFASAYIAEVIRGGLAALPRGQYEAADSLGLDYAQAMRLIILPQALKIS 353

Query: 307 IPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSEST-WISSVTPTTGLIFIGFVFWIF 365
           IPGIVN  +GLFKD++L+SII+MFDL+G++R     ST W        G  F   +F++ 
Sbjct: 354 IPGIVNVAVGLFKDTTLVSIISMFDLVGMIRGPILASTDWNGVYWELWG--FAALLFFVV 411

Query: 366 CFSISLYSVFIEKTLHKGSK 385
           C+ IS YS ++E+ L     
Sbjct: 412 CYGISQYSQWLERQLQTDHH 431


>gi|316934240|ref|YP_004109222.1| polar amino acid ABC transporter inner membrane subunit
           [Rhodopseudomonas palustris DX-1]
 gi|315601954|gb|ADU44489.1| polar amino acid ABC transporter, inner membrane subunit
           [Rhodopseudomonas palustris DX-1]
          Length = 501

 Score =  247 bits (630), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 119/221 (53%), Positives = 166/221 (75%)

Query: 165 GLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVP 224
           GL IV+T +WGGLLVTLV+S  GI+ SMP+GI LALGR S IP++R   + FIE +RGVP
Sbjct: 280 GLPIVDTRMWGGLLVTLVVSVTGIVASMPVGIALALGRRSTIPLIRIFSVAFIEFWRGVP 339

Query: 225 LVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAAN 284
           L+TV+F A+ MLPLFLP  + +D L+R L+G++ FA AY AEV+RGGL +I +GQ EAA+
Sbjct: 340 LITVMFFATYMLPLFLPGNFTIDNLVRVLIGIALFAGAYNAEVIRGGLNAIPRGQAEAAS 399

Query: 285 SLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSEST 344
           +LGLSY +   LI++PQ ++ VIPG+VN+FI LFKD+SL+SI+ +FDLLG +R  F++ T
Sbjct: 400 ALGLSYWKTTGLIVLPQALRHVIPGLVNSFIALFKDTSLVSIVALFDLLGQLRAAFADPT 459

Query: 345 WISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSK 385
           W +  T  TG  F G ++++FCF +S YS+ +E  L+   +
Sbjct: 460 WSTPTTLFTGFAFTGLIYFVFCFGMSRYSLSVEHRLNAHRR 500



 Score =  102 bits (255), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 63/154 (40%), Positives = 94/154 (61%), Gaps = 5/154 (3%)

Query: 10  YVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAV 69
           +VR  ++    PPVY+ G++    +  F +P +ILLT +   LL F++   + ++ +DAV
Sbjct: 11  FVRGEMVPQRPPPVYRSGLVGMARQRLFNSPTNILLTVVGALLLYFTVVPTVKFLLIDAV 70

Query: 70  WIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSIL 129
           W G+NRT C   + G   P G   ACW F+  ++ QF++G YP  +RWR  L F  G++L
Sbjct: 71  WTGANRTDCLAETVG--HPVG---ACWPFVQAKFSQFVYGFYPTPERWRVDLTFALGALL 125

Query: 130 LTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGG 163
           L P+LIP  P K LN+ L F  FP+ +FF+LYGG
Sbjct: 126 LLPLLIPRAPAKTLNAGLFFVAFPVLAFFLLYGG 159


>gi|89093224|ref|ZP_01166174.1| general amino acid ABC transporter, permease protein
           [Oceanospirillum sp. MED92]
 gi|89082520|gb|EAR61742.1| general amino acid ABC transporter, permease protein
           [Oceanospirillum sp. MED92]
          Length = 366

 Score =  246 bits (629), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 144/373 (38%), Positives = 215/373 (57%), Gaps = 19/373 (5%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
           QP+  P    G I W+  NFF +  + + T LI+ LL   IP ++ W+ + A W G+ + 
Sbjct: 10  QPA--PNDTVGPIHWVKDNFFSSAANTIATLLILALLATVIPPLVDWLLISANWSGTTQD 67

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPIL--VFLTGSILLTPML 134
            CT            + ACW F+    +QF +G+YP  + WR  L  + L G I  + +L
Sbjct: 68  ACTK-----------DGACWVFVIAWSKQFFYGSYPTEELWRINLCVLMLIGVIASSQLL 116

Query: 135 IPSFPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISMP 193
              +  KF  SI  F L P     +L G  +GL  V T  WGG  + ++++   II++ P
Sbjct: 117 NKDWRNKF--SIPAFLLLPFVCILILDGSWIGLEYVSTDYWGGFALNVLLAAASIIVAFP 174

Query: 194 LGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRAL 253
           L  + ALGR S +P ++   I  IE FRGVP++ + FM S+MLPLF P+  +VDKL+R  
Sbjct: 175 LSFVWALGRRSEMPFIKSVSILLIEFFRGVPVLALFFMGSVMLPLFFPEGTNVDKLVRVW 234

Query: 254 LGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNT 313
           + ++ F + Y+AEV RGG Q++  GQ+EAA+SLGLSY QK  LII+PQVIK  +P I+ T
Sbjct: 235 IVLTLFMAGYMAEVFRGGFQAVPTGQYEAADSLGLSYWQKTLLIILPQVIKVSMPNILAT 294

Query: 314 FIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYS 373
           F+ LFK+++ + II +F++L   +   + S W+   + T G +F+  VFWI C+S+S  S
Sbjct: 295 FVMLFKNTTFLLIIGIFEVLSTTQTALTNSNWLGGHS-TEGYLFVAIVFWICCYSMSRIS 353

Query: 374 VFIEKTLHKGSKK 386
             IE+ L    K 
Sbjct: 354 ASIERKLDTSHKN 366


>gi|149203335|ref|ZP_01880305.1| glutamate/glutamine/aspartate/asparagine ABC transporter, permease
           protein [Roseovarius sp. TM1035]
 gi|149143168|gb|EDM31207.1| glutamate/glutamine/aspartate/asparagine ABC transporter, permease
           protein [Roseovarius sp. TM1035]
          Length = 429

 Score =  246 bits (629), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 153/435 (35%), Positives = 241/435 (55%), Gaps = 64/435 (14%)

Query: 6   KEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVF 65
            +F +VRK +L  + PP  Q G I W+ +N F +P + LLT +   ++   +     W F
Sbjct: 4   DQFAFVRKHMLPEAPPPATQTGAIKWLRENLFSSPGNALLTVVSAYVVFQIVISATPW-F 62

Query: 66  LDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFG-NYPMAQRWRPILVFL 124
           L+ VW   + + C  +       DG   AC+A + +R+ Q +FG  YP    WRP L F+
Sbjct: 63  LNGVWDSPSLSACREIL------DGKTGACFAVLSERWNQLLFGFKYPSELYWRPGLAFV 116

Query: 125 TGSILLTPMLIPS-FPRK---------FLNSILLFG---LFPIFS--------------- 156
              I   P+L    FPRK         F+   L++G   + P+F+               
Sbjct: 117 LLFIAAAPVLFGKVFPRKMLIFTGLYPFIAYWLIWGGSLMVPVFALIGVLVGAVVYSRVV 176

Query: 157 -----------------FFVLYGG--------LGLSIVETSLWGGLLVTLVISFFGIIIS 191
                            F++L G         L +  V +   GG ++ L++    + +S
Sbjct: 177 TVNAGVAVIAAFVAALIFWILSGYVTGPMENVLAIEAVASRDMGGFMINLMLGVVCVSLS 236

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +PLGILLALGR S++P++++ C+ FIE  RGVPL+T+LF+A+++L  FLP   + D +LR
Sbjct: 237 LPLGILLALGRQSSMPIIKWICVVFIEFIRGVPLITLLFVANVVLAYFLPPGTNFDLILR 296

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
            ++ ++ F+SAYIAEV+RGGL ++ +GQ+EAA+SLGL Y Q M+LII+PQ +K  IPGIV
Sbjct: 297 VIIMITMFSSAYIAEVIRGGLAALPRGQYEAADSLGLDYAQAMQLIILPQALKISIPGIV 356

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRVN-FSESTWISSVTPTTGLIFIGFVFWIFCFSIS 370
           N  +GLFKD++L+S+I+MFD++G++R    + + W        G  F   +F+I C+ IS
Sbjct: 357 NVAVGLFKDTTLVSVISMFDIVGMIRGPILASAEWNGVYWELFG--FACVLFFITCYGIS 414

Query: 371 LYSVFIEKTLHKGSK 385
            YS ++E+ L    +
Sbjct: 415 QYSQWLERQLRTDHR 429


>gi|83941462|ref|ZP_00953924.1| ABC glutamate/glutamine/aspartate/asparagine transporter, inner
           membrane subunit BztC [Sulfitobacter sp. EE-36]
 gi|83847282|gb|EAP85157.1| ABC glutamate/glutamine/aspartate/asparagine transporter, inner
           membrane subunit BztC [Sulfitobacter sp. EE-36]
          Length = 431

 Score =  246 bits (629), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 162/440 (36%), Positives = 243/440 (55%), Gaps = 73/440 (16%)

Query: 5   CKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGT-PKDIL-LTALIICLLLFSIPGIIH 62
               PYVR  +L    PP   +G + W+ ++ F + P  IL L AL +  L+ S  G + 
Sbjct: 6   AASVPYVRDTMLPQHAPPPTAQGPVKWVRESLFSSIPYTILTLAALYVIYLILS--GFLP 63

Query: 63  WVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFG-NYPMAQRWRPIL 121
           W+ L  VW  SN   C  V       DG  A C++ + +R+ Q +FG  YP    WRP L
Sbjct: 64  WL-LGGVWTTSNIRECREVL------DGVQAGCFSVLTERWNQLLFGIAYPQDGYWRPTL 116

Query: 122 VFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGL--------------- 166
            F+   + ++P+L  + PR     IL   ++P  +F++++GG  L               
Sbjct: 117 AFVLLFVAVSPVLFSNLPRGL---ILFTVIYPFIAFWLIWGGSLLVPLSALLAVVVGYVV 173

Query: 167 --SIVETSLWGGL---LVTLVISFF--------------------------------GII 189
              IV+TS  GGL   L+  ++++F                                G+I
Sbjct: 174 YSRIVKTSFAGGLFAGLIAGIVTWFICGFITPSLSGVLALEPVASRNMGGFMLNMILGVI 233

Query: 190 ---ISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDV 246
              +S+P+GILLALGR S++P+++  C+ FIE  RGVPL+T+LF+A+++L  FLP   + 
Sbjct: 234 CVSLSLPMGILLALGRQSSLPIIKLICVVFIEFIRGVPLITLLFVANVVLAYFLPPGTNF 293

Query: 247 DKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRV 306
           D +LR ++ ++ FASAYIAEV+RGGL ++ +GQ+EAA+SLGL Y Q MRLII+PQ +K  
Sbjct: 294 DLILRVIIMITMFASAYIAEVIRGGLAALPRGQYEAADSLGLDYAQAMRLIILPQALKIS 353

Query: 307 IPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSEST-WISSVTPTTGLIFIGFVFWIF 365
           IPGIVN  +GLFKD++L+SII+MFDL+G++R     ST W        G  F   +F++ 
Sbjct: 354 IPGIVNVAVGLFKDTTLVSIISMFDLVGMIRGPILASTDWNGVYWELWG--FAALLFFVV 411

Query: 366 CFSISLYSVFIEKTLHKGSK 385
           C+ IS YS ++E+ L     
Sbjct: 412 CYGISQYSQWLERQLQTDHH 431


>gi|115524737|ref|YP_781648.1| polar amino acid ABC transporter, inner membrane subunit
           [Rhodopseudomonas palustris BisA53]
 gi|115518684|gb|ABJ06668.1| polar amino acid ABC transporter, inner membrane subunit
           [Rhodopseudomonas palustris BisA53]
          Length = 500

 Score =  246 bits (629), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 120/222 (54%), Positives = 166/222 (74%)

Query: 165 GLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVP 224
           GL IV+T +WGGLLVTLV+S  GI+ SMP+GI LALGR S IP++R   + FIE +RGVP
Sbjct: 279 GLPIVDTRMWGGLLVTLVVSVTGIVASMPIGIALALGRRSTIPLIRIFSVMFIEFWRGVP 338

Query: 225 LVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAAN 284
           L+TVLF A+ MLPLFLP  + VD ++R L+G++ FA AY AEV+RGGLQ+I +GQ EA++
Sbjct: 339 LITVLFFATYMLPLFLPGNFTVDGMVRVLIGIALFAGAYNAEVVRGGLQAIPRGQAEASS 398

Query: 285 SLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSEST 344
           +LGLSY +   LI++PQ ++ VIPG+VN+FI LFKD+SL+SI+ +FDLLG +R  FS+  
Sbjct: 399 ALGLSYWKTTGLIVLPQALRHVIPGLVNSFIALFKDTSLVSIVALFDLLGQLRAAFSDPV 458

Query: 345 WISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
           W +  T  TG  F G ++++FCF +S YS+ +E  L+   + 
Sbjct: 459 WSTPTTLFTGFAFTGIIYFVFCFGMSRYSLSVEHRLNAHQRH 500



 Score =  100 bits (248), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 69/186 (37%), Positives = 102/186 (54%), Gaps = 6/186 (3%)

Query: 2   IDSCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGII 61
           ++  +   +V + L+ P   P+   G++  +    F +P +ILLT L + LL F+I   +
Sbjct: 1   MNETRTEAFVSQELVPPRPAPLKTTGLVGLMRTRLFNSPTNILLTLLGVSLLYFTIVPSV 60

Query: 62  HWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPIL 121
            ++ +DAVW G +RT C   + G   P G   ACW F+  ++ QF++G YP   RWR  L
Sbjct: 61  KFLLIDAVWQGESRTDCLAETAG--HPVG---ACWPFVQAKFSQFVYGFYPEPDRWRVNL 115

Query: 122 VFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTL 181
            F   ++LL P+LIP  P K LN+ L F  FP+ +FF+L+GG GL     S    LL  L
Sbjct: 116 TFALAALLLLPLLIPRVPAKALNAGLFFIAFPVVAFFLLHGG-GLKGFALSWSADLLSAL 174

Query: 182 VISFFG 187
             SF G
Sbjct: 175 AASFSG 180


>gi|312115906|ref|YP_004013502.1| polar amino acid ABC transporter inner membrane protein
           [Rhodomicrobium vannielii ATCC 17100]
 gi|311221035|gb|ADP72403.1| polar amino acid ABC transporter, inner membrane subunit
           [Rhodomicrobium vannielii ATCC 17100]
          Length = 358

 Score =  246 bits (628), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 139/356 (39%), Positives = 207/356 (58%), Gaps = 18/356 (5%)

Query: 34  KNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNA 93
           +   G   +  +T  +   L F   G + ++   A W G + + C               
Sbjct: 17  RRLLGRAVNAAVTLTLGVALAFVAYGALSFLVFGAAWSG-DVSACRAT----------EG 65

Query: 94  ACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKF----LNSILLF 149
           ACW F+  + +QF+FG YP  + WR     L    LL    +    R+F      + ++ 
Sbjct: 66  ACWPFVAAKLKQFVFGRYPDDELWRAAAAMLLPPALLLAAFLAR--RRFGLAGFAAAVVL 123

Query: 150 GLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVL 209
           GL P+    V   G+ L+ V T +WGGL +TL++S+ GI  S+PLGI+LAL R S+ PV 
Sbjct: 124 GL-PLAFLLVAGDGVLLAPVSTDVWGGLTLTLLVSYTGIAASLPLGIVLALMRRSSWPVP 182

Query: 210 RYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLR 269
           R+  I FIE +RGVPLVTVLFMA++MLPLFLP+   V+K  RAL  ++ FASAY+AEV+R
Sbjct: 183 RWLAICFIEFWRGVPLVTVLFMAAVMLPLFLPEGASVNKPARALFAIAVFASAYMAEVIR 242

Query: 270 GGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINM 329
           GGLQS+ + Q  A  +LGL Y Q + L+I+PQ I+  +PGI  TFIGL KD++L+ +I +
Sbjct: 243 GGLQSVPENQVTAGRALGLRYSQILALVILPQAIRSALPGIAGTFIGLLKDTTLVLVIGL 302

Query: 330 FDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSK 385
           FD LG++++  ++  W +S T  TG  F   VFW  C++I+  S ++E+   +  +
Sbjct: 303 FDFLGMIQLAAADPAWSASTTTLTGYAFAALVFWSLCYAIARVSAYLERVTAESRR 358


>gi|89092422|ref|ZP_01165376.1| general amino acid ABC transporter, permease protein
           [Oceanospirillum sp. MED92]
 gi|89083510|gb|EAR62728.1| general amino acid ABC transporter, permease protein
           [Oceanospirillum sp. MED92]
          Length = 366

 Score =  246 bits (627), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 143/373 (38%), Positives = 215/373 (57%), Gaps = 19/373 (5%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
           QP+  P    G I W+  NFF +  + + T LI+ LL   +P ++ W+ + A W G+ + 
Sbjct: 10  QPA--PNDTVGPIHWVKDNFFSSAMNTIATLLILALLATVVPPLVDWLLISANWSGTTQD 67

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPIL--VFLTGSILLTPML 134
            CT            + ACW F+    +QF +G+YP  + WR  L  + L G I  + +L
Sbjct: 68  ACTK-----------DGACWVFVIAWSKQFFYGSYPTEELWRINLCVLMLIGVIASSQLL 116

Query: 135 IPSFPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISMP 193
              +  KF  SI  F L P     +L G  +GL  V T  WGG  + ++++   II++ P
Sbjct: 117 NKDWRNKF--SIPAFLLLPFVCILILDGSWIGLEYVSTDYWGGFALNVLLAAASIIVAFP 174

Query: 194 LGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRAL 253
           L  + ALGR S +P ++   I  IE FRGVP++ + FM S+MLPLF P+  +VDKL+R  
Sbjct: 175 LSFVWALGRRSEMPFIKSVSILLIEFFRGVPVLALFFMGSVMLPLFFPEGTNVDKLVRVW 234

Query: 254 LGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNT 313
           + ++ F + Y+AEV RGG Q++  GQ+EAA+SLGLSY QK  LII+PQVIK  +P I+ T
Sbjct: 235 IVLTLFMAGYMAEVFRGGFQAVPTGQYEAADSLGLSYWQKTLLIILPQVIKVSMPNILAT 294

Query: 314 FIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYS 373
           F+ LFK+++ + II +F++L   +   + S W+   + T G +F+  VFWI C+S+S  S
Sbjct: 295 FVMLFKNTTFLLIIGIFEVLSTTQTALTNSNWLGGHS-TEGYLFVAIVFWICCYSMSRIS 353

Query: 374 VFIEKTLHKGSKK 386
             IE+ L    K 
Sbjct: 354 ASIERKLDTSHKN 366


>gi|192291212|ref|YP_001991817.1| polar amino acid ABC transporter inner membrane subunit
           [Rhodopseudomonas palustris TIE-1]
 gi|192284961|gb|ACF01342.1| polar amino acid ABC transporter, inner membrane subunit
           [Rhodopseudomonas palustris TIE-1]
          Length = 501

 Score =  245 bits (625), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 118/221 (53%), Positives = 166/221 (75%)

Query: 165 GLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVP 224
           GL +V+T +WGGLLVTLV+S  GI+ SMP+GI LALGR S IP++R   + FIE +RGVP
Sbjct: 280 GLPVVDTRMWGGLLVTLVVSVTGIVASMPIGIALALGRRSTIPLIRIFSVAFIEFWRGVP 339

Query: 225 LVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAAN 284
           L+TV+F A+ MLPLFLP  + +D L+R L+G++ FA AY AEV+RGGL +I +GQ EAA+
Sbjct: 340 LITVMFFATYMLPLFLPGNFTIDNLMRVLIGIALFAGAYNAEVIRGGLNAIPRGQAEAAS 399

Query: 285 SLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSEST 344
           +LGLSY +   LI++PQ ++ VIPG+VN+FI LFKD+SL+SI+ +FDLLG +R  F++ T
Sbjct: 400 ALGLSYWKITGLIVLPQALRHVIPGLVNSFIALFKDTSLVSIVALFDLLGQLRAAFADPT 459

Query: 345 WISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSK 385
           W +  T  TG  F G ++++FCF +S YS+ +E  L+   +
Sbjct: 460 WSTPTTLFTGFAFTGLIYFVFCFGMSRYSLSVEHRLNAHRR 500



 Score = 89.4 bits (220), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 63/154 (40%), Positives = 94/154 (61%), Gaps = 5/154 (3%)

Query: 10  YVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAV 69
           +VR  ++    PPV+  G++  + +    +P +ILLT + + LL F++   + ++ +DAV
Sbjct: 11  FVRGEMVPQRPPPVHTPGVLGLVRQRLLNSPTNILLTIVGLLLLYFTVVPTVKFLLVDAV 70

Query: 70  WIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSIL 129
           W GSNRT C     G   P G   ACW F+  ++ QFI+G YP  +RWR  LVF  G++L
Sbjct: 71  WSGSNRTDCLADKAG--HPVG---ACWPFVQAKFSQFIYGFYPTPERWRVDLVFALGALL 125

Query: 130 LTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGG 163
           L P+LIP  P K LN+ L F  FP+ +FF+L+GG
Sbjct: 126 LLPLLIPRAPAKTLNAGLFFIAFPVLAFFLLHGG 159


>gi|51245288|ref|YP_065172.1| amino acid ABC transporter, permease protein [Desulfotalea
           psychrophila LSv54]
 gi|50876325|emb|CAG36165.1| probable amino acid ABC transporter, permease protein [Desulfotalea
           psychrophila LSv54]
          Length = 473

 Score =  245 bits (625), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 124/240 (51%), Positives = 174/240 (72%), Gaps = 3/240 (1%)

Query: 147 LLFGLFPIFSFFVLYG-GLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSN 205
           LL  ++P+ ++F+  G   GL +VET  WGGL +TLV++  G+  +MP+GILLALGR S 
Sbjct: 236 LLCVVYPLIAYFLFVGDAFGLVLVETHFWGGLFLTLVVAGTGMATAMPIGILLALGRCSK 295

Query: 206 IPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIA 265
           + V+R  CI FIEL RGVPL++VLFMAS+M PLFLP+    DKLLRAL+GV+ F +AYIA
Sbjct: 296 MIVIRTLCIGFIELVRGVPLISVLFMASVMFPLFLPENMSFDKLLRALIGVAFFYAAYIA 355

Query: 266 EVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLIS 325
           EV+RGGLQ+I KGQ+EAA +LG +Y +KM +II+PQ ++ VIPG+ N F+ L KD++L++
Sbjct: 356 EVIRGGLQAIPKGQYEAAEALGWTYWKKMSVIILPQTLRMVIPGLANNFLSLLKDTTLVA 415

Query: 326 IINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSK 385
           +I + DLLG+ +   +++ W+         +F G VFWIFCF+IS YS F+EK  H   +
Sbjct: 416 VIGLLDLLGVAKAALADAAWLGFT--KEAYVFAGLVFWIFCFAISRYSNFLEKKYHTNYR 473



 Score = 92.0 bits (227), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 47/125 (37%), Positives = 71/125 (56%), Gaps = 8/125 (6%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
           QP   PV ++G + W++KN F +P + +LT L + LL + I  ++ W  +DA W+G++R 
Sbjct: 11  QPC--PVTEKGPLGWMYKNLFSSPFNTVLTLLGVSLLFWLITPLVRWAIIDATWVGTSRD 68

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            CT +  GG  P     ACW FI  R++ F++G YP  +RWR    F+  +    P LIP
Sbjct: 69  ACTVL--GGCDP----GACWVFIKVRFQLFMYGFYPEVERWRINFAFVLIAFAALPHLIP 122

Query: 137 SFPRK 141
            F  K
Sbjct: 123 DFFAK 127


>gi|39935628|ref|NP_947904.1| polar amino acid ABC transport permease AapM-1 [Rhodopseudomonas
           palustris CGA009]
 gi|39649481|emb|CAE28003.1| polar amino acid ABC transport permease protein aapM-1
           [Rhodopseudomonas palustris CGA009]
          Length = 501

 Score =  245 bits (625), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 118/221 (53%), Positives = 166/221 (75%)

Query: 165 GLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVP 224
           GL +V+T +WGGLLVTLV+S  GI+ SMP+GI LALGR S IP++R   + FIE +RGVP
Sbjct: 280 GLPVVDTRMWGGLLVTLVVSVTGIVASMPIGIALALGRRSTIPLIRIFSVAFIEFWRGVP 339

Query: 225 LVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAAN 284
           L+TV+F A+ MLPLFLP  + +D L+R L+G++ FA AY AEV+RGGL +I +GQ EAA+
Sbjct: 340 LITVMFFATYMLPLFLPGNFTIDNLMRVLIGIALFAGAYNAEVIRGGLNAIPRGQAEAAS 399

Query: 285 SLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSEST 344
           +LGLSY +   LI++PQ ++ VIPG+VN+FI LFKD+SL+SI+ +FDLLG +R  F++ T
Sbjct: 400 ALGLSYWKITGLIVLPQALRHVIPGLVNSFIALFKDTSLVSIVALFDLLGQLRAAFADPT 459

Query: 345 WISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSK 385
           W +  T  TG  F G ++++FCF +S YS+ +E  L+   +
Sbjct: 460 WSTPTTLFTGFAFTGLIYFVFCFGMSRYSLSVEHRLNAHRR 500



 Score = 89.4 bits (220), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 63/154 (40%), Positives = 94/154 (61%), Gaps = 5/154 (3%)

Query: 10  YVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAV 69
           +VR  ++    PPV+  G++  + +    +P +ILLT + + LL F++   + ++ +DAV
Sbjct: 11  FVRGEMVPQRPPPVHTPGVLGLVRQRLLNSPTNILLTIVGLLLLYFTVVPTVKFLLVDAV 70

Query: 70  WIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSIL 129
           W GSNRT C     G   P G   ACW F+  ++ QFI+G YP  +RWR  LVF  G++L
Sbjct: 71  WSGSNRTDCLADKAG--HPVG---ACWPFVQAKFSQFIYGFYPTPERWRVDLVFALGALL 125

Query: 130 LTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGG 163
           L P+LIP  P K LN+ L F  FP+ +FF+L+GG
Sbjct: 126 LLPLLIPRAPAKTLNAGLFFIAFPVLAFFLLHGG 159


>gi|84685380|ref|ZP_01013278.1| glutamate/glutamine/aspartate/asparagine ABC transporter, permease
           protein [Maritimibacter alkaliphilus HTCC2654]
 gi|84666537|gb|EAQ13009.1| glutamate/glutamine/aspartate/asparagine ABC transporter, permease
           protein [Rhodobacterales bacterium HTCC2654]
          Length = 433

 Score =  244 bits (624), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 153/438 (34%), Positives = 241/438 (55%), Gaps = 64/438 (14%)

Query: 6   KEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVF 65
           ++  YVR  +L    PP  + G+I W+  N F    + +LT + +  +   +  II W++
Sbjct: 2   EDLSYVRTDMLPERDPPASEVGVIGWLRMNLFSGWFNSILTVIALAFIYLVLAAIIPWLW 61

Query: 66  LDAVWIGSNRTVCTTV-SQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFL 124
               W   + + C  + ++ G +  G   AC+  I +R++Q +FG YP   RWRPIL F+
Sbjct: 62  -SPTWGAGSLSACREIIAELGKEHGG---ACYGVITERWQQLLFGFYPEELRWRPILTFI 117

Query: 125 TGSILLTPMLI-PSFPRK---------FLNSILLFG------------------------ 150
              + L P+L   +FP K         FL   L++G                        
Sbjct: 118 GLFVALAPVLFNETFPGKMLWFTGAFLFLAPWLMWGGPIWTPLLVAAGPALGFVAYRYLV 177

Query: 151 -------------LFPIFSFFVLYGGL----------GLSIVETSLWGGLLVTLVISFFG 187
                        L P+  +  L G L          G+ +VE+ L+GG ++++ I    
Sbjct: 178 SVIGNLASVIVAVLIPVLFWLFLVGPLSQAIDGVVPLGIEVVESRLFGGFMLSVWIGVVA 237

Query: 188 IIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVD 247
           I IS+ LG++LALGR S++ +++Y  + FIE  RGVPL+T+LF+AS +L +F+P   + D
Sbjct: 238 IAISLVLGVILALGRQSDLLIVKYLSVGFIEFIRGVPLITLLFVASTLLNIFMPPGTNFD 297

Query: 248 KLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVI 307
            +LR ++  + FASAYIAEV+RGGL ++ +GQ+EAA++LGL Y +  RLII+PQ +K  I
Sbjct: 298 IILRVMIMATLFASAYIAEVIRGGLAALPRGQYEAADALGLDYWKAQRLIILPQALKISI 357

Query: 308 PGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCF 367
           PGIV+TFIGLFKD++L+SII + D +G+     +++ W   V    G  FI  +F+I CF
Sbjct: 358 PGIVSTFIGLFKDTTLVSIIGLLDPIGLTGSIRADANWNGIVWELYG--FIALLFFISCF 415

Query: 368 SISLYSVFIEKTLHKGSK 385
           S+S YS+++EK L    +
Sbjct: 416 SMSRYSMWLEKKLRTDHR 433


>gi|209885183|ref|YP_002289040.1| general L-amino acid transport system permease protein AapM
           [Oligotropha carboxidovorans OM5]
 gi|209873379|gb|ACI93175.1| general L-amino acid transport system permease protein AapM
           [Oligotropha carboxidovorans OM5]
          Length = 454

 Score =  244 bits (624), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 126/250 (50%), Positives = 173/250 (69%)

Query: 136 PSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
           P+  R  L+S L F    +    +     GL IV+T  WGGLLVTLV+S  GI+ SMP+G
Sbjct: 205 PNGRRAALSSALTFAGIAVVIVALRLDQGGLPIVDTRQWGGLLVTLVVSVTGIVASMPVG 264

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           I LALGR S IP+LR   + FIE +RGVPL+TVLF A+ MLPLFLP  + +D L+R L+G
Sbjct: 265 IALALGRTSRIPLLRAFSVMFIEFWRGVPLITVLFFATYMLPLFLPGDFTIDALVRVLVG 324

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           ++ FA AY AEV+RGGL +I +GQ EAAN+LGLSY +   LI++PQ ++ VIP +VN+FI
Sbjct: 325 IALFAGAYNAEVIRGGLLAIPRGQREAANALGLSYWKTTGLIVLPQALRHVIPSLVNSFI 384

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD++L+ I+ +FDLLG +R  F++  W +  T  TG  F G ++WI CF++S YS+F
Sbjct: 385 ALFKDTTLVLIVALFDLLGQLRATFADPVWATPTTLFTGFAFTGIIYWIGCFAMSRYSLF 444

Query: 376 IEKTLHKGSK 385
           +E+ L    +
Sbjct: 445 VERRLDPHRR 454



 Score =  103 bits (256), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 64/154 (41%), Positives = 86/154 (55%), Gaps = 5/154 (3%)

Query: 10  YVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAV 69
           +VR  L     PPV   GII  +    F +P +ILLT +   +L   +   I ++F+DAV
Sbjct: 9   FVRGALAPERQPPVVTTGIIGLMRTRLFNSPTNILLTLISAVVLWLLLVPTIRFLFIDAV 68

Query: 70  WIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSIL 129
           W GS+RT C   + G   P G   ACW FI  ++ Q I+G YP  QRWR  L F    +L
Sbjct: 69  WQGSDRTACLAENAG--HPVG---ACWPFIQAKFTQLIYGFYPEDQRWRANLTFALAVLL 123

Query: 130 LTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGG 163
           L P+L+P  P K LN+ L F  FP  +FF+L+GG
Sbjct: 124 LAPLLVPKIPHKALNAALFFIAFPFLAFFLLHGG 157


>gi|27379559|ref|NP_771088.1| amino acid ABC transporter permease protein [Bradyrhizobium
           japonicum USDA 110]
 gi|27352711|dbj|BAC49713.1| amino acid ABC transporter permease protein [Bradyrhizobium
           japonicum USDA 110]
          Length = 506

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 121/222 (54%), Positives = 165/222 (74%)

Query: 165 GLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVP 224
           GL +VETSLWGGLLVTLV+S  GI+ S+P+GI LALGR S IP++R   I FIE +RGVP
Sbjct: 285 GLPVVETSLWGGLLVTLVVSVTGIVTSLPIGIALALGRRSTIPLIRIFSIAFIEFWRGVP 344

Query: 225 LVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAAN 284
           L+TVLF A+ MLPLFLP  + VD L+RAL+G++ F  AY AE +RGGL +I +GQ EAA 
Sbjct: 345 LITVLFFATYMLPLFLPGNFTVDGLVRALIGIALFTGAYQAENVRGGLAAIPRGQGEAAA 404

Query: 285 SLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSEST 344
           +LGLS+ +   LI++PQ ++ VIP +VN+FI LFKD+SL+SI+ +FDLLG +R +FS+  
Sbjct: 405 ALGLSWWKTTSLIVLPQALRHVIPNLVNSFISLFKDTSLVSIVALFDLLGSLRASFSDPK 464

Query: 345 WISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
           W +  T  TG  F G ++++FCF +S YS+F+E  L+   + 
Sbjct: 465 WSTPSTAFTGFAFAGIIYFLFCFGMSRYSLFVEHRLNAHRRN 506



 Score = 75.1 bits (183), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 39/109 (35%), Positives = 57/109 (52%), Gaps = 5/109 (4%)

Query: 10  YVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAV 69
           +VR+ LL     PV   G +  +    F +P +ILLT +   LL F+I   + ++ +DAV
Sbjct: 9   FVRQDLLTERPAPVKTTGFVGLMRTRLFNSPTNILLTIVGALLLWFTIIPSVRFLMVDAV 68

Query: 70  WIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWR 118
           W G +RT C   + G         ACW +I  +  Q I+G YP A+RWR
Sbjct: 69  WAGKDRTACLAENAGFAV-----GACWPYIQAKLPQLIYGFYPEAERWR 112


>gi|163745577|ref|ZP_02152937.1| amino acid ABC transporter, permease protein [Oceanibulbus
           indolifex HEL-45]
 gi|161382395|gb|EDQ06804.1| amino acid ABC transporter, permease protein [Oceanibulbus
           indolifex HEL-45]
          Length = 432

 Score =  243 bits (619), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 153/443 (34%), Positives = 236/443 (53%), Gaps = 69/443 (15%)

Query: 1   MIDSCKE-FPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPG 59
           M D+  E   +VR+  L PS PP    G + W+  N F T  + LLT + +  L   + G
Sbjct: 1   MSDTHAESIAFVRESSLPPSAPPDKVGGPLKWVKDNLFPTWANALLTVVALYFLYLLLSG 60

Query: 60  IIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFG-NYPMAQRWR 118
            + W+ L+ VW  S+ + C  +       DG + AC++ I +R+ Q +FG  YP  Q WR
Sbjct: 61  SLPWL-LNGVWSASSLSECREIL------DGASGACFSVISERWHQLLFGFKYPSDQYWR 113

Query: 119 PILVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSF--------------------- 157
           P L  +   I + P+L    PRK L      GL+P  +F                     
Sbjct: 114 PTLALVLLFIAIAPVLFIDLPRKLL---FFTGLYPFLAFWLIWGGPIWGPIFALLGVIAG 170

Query: 158 FVLYGGLGLSIVETSLWGGLLVTLVISFFG------------------------------ 187
           +V Y  L       +L GG++  +++ + G                              
Sbjct: 171 YVAYSRLVHKSFAMALAGGIVAAVIVWYIGGFIGEALRPASPLLEAIPSRDLGGFMLNMM 230

Query: 188 -----IIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPD 242
                + +S+P+G+ LALGR S++P+++  C+ FIE  RGVPL+T+LF+A++ML  F P 
Sbjct: 231 LGITCVSLSLPIGVALALGRQSHLPIVKGICVVFIEFVRGVPLITLLFVANVMLAYFFPP 290

Query: 243 TWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQV 302
              VD  +R ++ ++ F+SAYIAEV+RGGL ++ KGQ+EAA+SLGL Y Q MRLII+PQ 
Sbjct: 291 GSGVDLFIRVVIMITMFSSAYIAEVIRGGLAALPKGQYEAADSLGLDYAQAMRLIILPQA 350

Query: 303 IKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVF 362
           +K  IPGIVN  +GLFKD++L+S+I++FD++G++R     ST  + V      +F   +F
Sbjct: 351 MKISIPGIVNIAVGLFKDTTLVSVISLFDIIGMIRGPILASTDWNGVYWEL-FMFASLLF 409

Query: 363 WIFCFSISLYSVFIEKTLHKGSK 385
           +I C+ IS YS ++E+ L    +
Sbjct: 410 FIVCYGISQYSQWLERRLATDHR 432


>gi|260432482|ref|ZP_05786453.1| glutamate/glutamine/aspartate/asparagine transport system
           permeaseprotein BztC [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260416310|gb|EEX09569.1| glutamate/glutamine/aspartate/asparagine transport system
           permeaseprotein BztC [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 432

 Score =  243 bits (619), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 145/440 (32%), Positives = 236/440 (53%), Gaps = 68/440 (15%)

Query: 3   DSCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIH 62
            +     +V +  + PS PP  + G++ W+ +N F    + +LT   + L+   +   + 
Sbjct: 4   QTTNSIAFVAEGTIPPSPPPANETGVVKWLRENLFSGVGNSILTIASVLLIYVVLKNTLP 63

Query: 63  WVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFG-NYPMAQRWRPIL 121
           W+F + VW   + + C  +  G         AC+A + +R+ Q I+G  YP+   WRP L
Sbjct: 64  WIF-NGVWNADSLSQCREILGGK------TGACFAVLAERWNQLIYGFKYPVEAYWRPNL 116

Query: 122 VFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVL--------------------- 160
            FL   +   P+L    PRK L   L   ++P  +F+++                     
Sbjct: 117 AFLLMLVAAAPVLFFDLPRKML---LFTAVYPFVAFWLIWGGTVLVPLVALFGCVAAAVV 173

Query: 161 -------------YGGLGLSIV-------------ETSLW---------GGLLVTLVISF 185
                        +GG+ ++++               + W         GG ++ L++  
Sbjct: 174 FQKYGKNSFAAGFFGGIVVALIVWKVGGALISESASENAWLTAVPSRDLGGFMLNLMLGV 233

Query: 186 FGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWD 245
             + +S+PLGI LALGR S++P++++ C+ FIE  RGVPL+T+LF+AS+ML  F P    
Sbjct: 234 TCVSLSLPLGIALALGRQSDMPLIKWVCVIFIEFIRGVPLITLLFVASVMLAYFFPPDST 293

Query: 246 VDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKR 305
           VD  LR ++ ++ F++AYIAEV+RGGL ++ +GQ+EAA+SLGL Y Q MRLII+PQ +K 
Sbjct: 294 VDLFLRVVIMITMFSAAYIAEVIRGGLAALPRGQYEAADSLGLDYAQAMRLIILPQALKI 353

Query: 306 VIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIF 365
            IPGIVN  +GLFKD++L+S+I+MFDL+G++R     ST  + V     L F   +F++ 
Sbjct: 354 SIPGIVNVAVGLFKDTTLVSVISMFDLVGMIRGPILASTEWNGVYWEL-LGFAALLFFVV 412

Query: 366 CFSISLYSVFIEKTLHKGSK 385
           C+ IS YS ++E+ L    +
Sbjct: 413 CYGISQYSQWLERRLATDHR 432


>gi|254460499|ref|ZP_05073915.1| amino acid ABC transporter, permease protein [Rhodobacterales
           bacterium HTCC2083]
 gi|206677088|gb|EDZ41575.1| amino acid ABC transporter, permease protein [Rhodobacteraceae
           bacterium HTCC2083]
          Length = 431

 Score =  243 bits (619), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 158/432 (36%), Positives = 234/432 (54%), Gaps = 67/432 (15%)

Query: 10  YVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAV 69
           +VR  +LQ   PPV   G +AWI KN F    + +LT L I  +   + G   W F + V
Sbjct: 11  FVRDAMLQEQTPPVTAAGPLAWIKKNLFDGWFNTILTLLAIYFIYMIVSGAFPW-FYNGV 69

Query: 70  WIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFG-NYPMAQRWRPILVFLTGSI 128
           W   +   C  + QG          C++ + +R+ Q +FG  YP  + WRP + F     
Sbjct: 70  WTTDSLAECREILQGK------TGGCFSVLTERWPQLLFGFKYPSEEYWRPTVAFFMLFF 123

Query: 129 LLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGG---------LGLSI----------- 168
              P+L    PRK L   ++  +FP  +F++++GG         +GL +           
Sbjct: 124 AAAPVLFNKLPRKLL---IITAIFPFLAFWLIWGGSLMVPIMVAVGLIVGYFVFTKLEYQ 180

Query: 169 -VETSLWGGLLVTLVI-SFFGII---------------------------------ISMP 193
                L GG+L T++I SF GII                                 +S+P
Sbjct: 181 SFAMGLIGGILATVLIWSFMGIITDPLSGFLALESIPSRDMGGFMLNFILGVVCVSLSLP 240

Query: 194 LGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRAL 253
           +GILLALGR S++ ++++ C+ FIE  RGVPL+T+LF+A+++L  FLP   + D +LR +
Sbjct: 241 IGILLALGRQSDMIIIKWICVVFIEFIRGVPLITLLFVANVVLGYFLPPGSNFDLILRVI 300

Query: 254 LGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNT 313
           + ++ F++AYIAEV+RGGL ++ KGQ EAA SLGL Y Q MRLII+PQ +K  IPGIVN 
Sbjct: 301 IMITMFSAAYIAEVVRGGLAALPKGQAEAAGSLGLDYAQSMRLIILPQALKISIPGIVNV 360

Query: 314 FIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYS 373
            +GLFKD+ L+S+I+MFDL+G++R     ST  + V     L  + F F I C+ IS YS
Sbjct: 361 AVGLFKDTVLVSVISMFDLVGMIRGPILASTEWNGVYWELWLAAVLFFFPI-CYGISQYS 419

Query: 374 VFIEKTLHKGSK 385
            ++E+ L  G +
Sbjct: 420 QWLERQLATGHR 431


>gi|331007195|ref|ZP_08330406.1| general amino acid ABC transporter, permease protein [gamma
           proteobacterium IMCC1989]
 gi|330418990|gb|EGG93445.1| general amino acid ABC transporter, permease protein [gamma
           proteobacterium IMCC1989]
          Length = 368

 Score =  242 bits (617), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 137/380 (36%), Positives = 213/380 (56%), Gaps = 18/380 (4%)

Query: 11  VRKRLLQPSLP-PVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAV 69
           +++ + +P+ P P    G +AW+ +N F +  +   T + +  L+  IP +  W F  A 
Sbjct: 3   MKEFIAKPAKPAPSSAVGPVAWMRENLFSSILNTACTVVFVAFLVSIIPALFDWFFWSAN 62

Query: 70  WIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSIL 129
           + G+ +  C          DG   ACW F    ++Q ++G+Y   + WR  +  +  S+ 
Sbjct: 63  FAGATQAACVG--------DG---ACWVFTKAWFQQLMYGSYTDGELWRVNICVI--SLF 109

Query: 130 LTPMLIPSFPRKFLNSIL--LFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFF 186
                    P+ + N I   LF + P     +L G L GL  V T  WGG  + ++++  
Sbjct: 110 AVIYAATKLPKDYRNKIAIPLFLVLPFIWIIILNGKLLGLEHVSTDYWGGFALNVLMAAA 169

Query: 187 GIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDV 246
            II++ PL  L ALGR S +P  R  C+  IE FRGVP++ + FM S+MLPLF P+  +V
Sbjct: 170 SIIVAFPLSFLWALGRRSEMPFARTVCVILIEFFRGVPVLALFFMGSVMLPLFFPEGTNV 229

Query: 247 DKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRV 306
           DKL+R  + +  F S Y+AEV RGG Q+I +GQ+EAA+S+GLSY QK  LII+PQ IK  
Sbjct: 230 DKLIRVWIVLILFMSGYMAEVFRGGFQAIPQGQYEAADSIGLSYWQKNLLIILPQNIKIS 289

Query: 307 IPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFC 366
           +P I+ TFI LFK+++ + II +F++L   +   + S W+   + T G +F+  +FWI C
Sbjct: 290 MPNILATFIMLFKNTTFLLIIGIFEILSTTQAALTNSNWLGGHS-TEGYVFVALLFWICC 348

Query: 367 FSISLYSVFIEKTLHKGSKK 386
           FS+S+ S  IE+ L    + 
Sbjct: 349 FSMSMISNSIERKLETSHRN 368


>gi|148240913|ref|YP_001220414.1| inner membrane amino-acid ABC transporter permease protein
           [Bradyrhizobium sp. BTAi1]
 gi|146411289|gb|ABQ39742.1| Inner membrane amino-acid ABC transporter permease protein
           [Bradyrhizobium sp. BTAi1]
          Length = 360

 Score =  240 bits (613), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 141/359 (39%), Positives = 213/359 (59%), Gaps = 18/359 (5%)

Query: 22  PVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTV 81
           PV  +  +    +  FG+P +  LT     +L  ++P ++ W+ LDAV    +   C   
Sbjct: 12  PVPSQASLRQAARLLFGSPLNAALTLAFGAMLAVALPPMLRWLVLDAVLFNPDPAACRAA 71

Query: 82  SQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPS--FP 139
           S           ACW+FIY +  Q +FG YP+ +RWRP LV L    LL   + P+   P
Sbjct: 72  S----------GACWSFIYVKSGQLLFGIYPVEERWRPALVCLLILALLGWSVRPASWTP 121

Query: 140 RKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLA 199
           R     I    L      +++ GGLGL  V TS WGGL VTL+++   I I+ P+GILLA
Sbjct: 122 RLLGLWISALALI----VWMMGGGLGLEEVPTSAWGGLPVTLILTVVAIGIAFPVGILLA 177

Query: 200 LGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAF 259
           L R S +P +R A +  IE  RG+PL+++LF+ASIMLPLFLP+    DK +RAL+ ++ F
Sbjct: 178 LARRSTMPAVRIAAVVTIESVRGLPLLSILFVASIMLPLFLPEALLPDKFVRALVALTIF 237

Query: 260 ASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFK 319
           A+AY+AEV+RGGLQ+I +GQ+EAA +LGL + +    +I+PQ I+ VIP + NT I + K
Sbjct: 238 AAAYLAEVIRGGLQAIPRGQYEAAAALGLPFWRTQYRVILPQAIRVVIPALANTIIVMIK 297

Query: 320 DSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEK 378
           ++SL+ ++ +FDL+   +   ++  W S    T   +FIG +F+   FS + ++ F+E+
Sbjct: 298 NTSLVLVVGLFDLISSGKAALADPAWPSPAAET--FLFIGGIFFALSFSFARFADFLER 354


>gi|89053120|ref|YP_508571.1| amino acid ABC transporter permease [Jannaschia sp. CCS1]
 gi|88862669|gb|ABD53546.1| L-aspartate ABC transporter membrane protein / L-glutamate ABC
           transporter membrane protein / L-glutamine ABC
           transporter membrane protein / L-asparagine ABC
           transporter membrane protein [Jannaschia sp. CCS1]
          Length = 445

 Score =  239 bits (611), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 148/442 (33%), Positives = 233/442 (52%), Gaps = 62/442 (14%)

Query: 3   DSCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIH 62
           ++     YVR  +L    PPV   G + W+ +N F +  + L+T + I ++   + GI+ 
Sbjct: 7   ETSVHTAYVRTEMLPEQTPPVAVAGPVKWVRENLFSSVPNALMTLVSIYVVYVVLAGILP 66

Query: 63  WVFLDAVWIGSNRTVCTTVSQGGIQPD---GWNAACWAFIYDRYEQFIFGNYPMAQRWRP 119
           W+ ++ +W   + + C  +      P    G   ACWA + DR++Q +FG YP    WR 
Sbjct: 67  WM-INGIWDADSLSECREIRDARFGPSDGHGGGVACWAVLVDRWDQLMFGFYPPELYWRA 125

Query: 120 ILVFLTGSILLTPMLIPSFPRK---------FLNSILLFG-------------------- 150
           IL F      + P+L  + PRK         FL + LL+G                    
Sbjct: 126 ILAFALFLGAIAPVLYDTLPRKLLLLTAAMPFLCAWLLWGGSIWTPLLVAAGFGLGYAVI 185

Query: 151 -----------------LFPIFSFFVLYGGL----------GLSIVETSLWGGLLVTLVI 183
                            + P+  +  L G L          G+  V++  +GG L+  VI
Sbjct: 186 KFGSVALGAMTSTILAIVVPLLYWLFLLGPLVSVMDSILPIGIQAVQSREFGGFLLAFVI 245

Query: 184 SFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDT 243
              GII+SMPLG++LALGR S++ ++    + FIE+ RGVPL+  LF A ++L  FLP  
Sbjct: 246 GASGIILSMPLGVMLALGRQSDLFIINKFSVIFIEVIRGVPLIVWLFTAQLLLGYFLPPG 305

Query: 244 WDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVI 303
            + D ++R ++ V+ F++AYIAEV+RGGL ++ +GQ+E A+SLGL+Y Q M+LI++PQ +
Sbjct: 306 TNFDLMVRVIIMVTLFSAAYIAEVIRGGLAALPRGQYEGADSLGLNYWQSMQLIVLPQAL 365

Query: 304 KRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFW 363
           K  IPGIV++FIGLFKD++L+  I +FD +G      +++ W          IFIG  F+
Sbjct: 366 KISIPGIVSSFIGLFKDTTLVVFIGLFDPIGFSNAIRADTDWNGIYWEL--FIFIGLCFF 423

Query: 364 IFCFSISLYSVFIEKTLHKGSK 385
           I CF +S YS ++E+ L    +
Sbjct: 424 ICCFGMSRYSQWLERKLATDHR 445


>gi|85703853|ref|ZP_01034956.1| glutamate/glutamine/aspartate/asparagine ABC transporter, permease
           protein [Roseovarius sp. 217]
 gi|85671173|gb|EAQ26031.1| glutamate/glutamine/aspartate/asparagine ABC transporter, permease
           protein [Roseovarius sp. 217]
          Length = 429

 Score =  239 bits (610), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 151/435 (34%), Positives = 238/435 (54%), Gaps = 64/435 (14%)

Query: 6   KEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVF 65
            +  +VR  +L  + PP  Q G + W+ +N F +P + LLT L+   ++F I       F
Sbjct: 4   DQLAFVRTHMLPEAPPPTAQTGAVKWLRENLFSSPGNALLT-LVSAYVVFQIVISTAPWF 62

Query: 66  LDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFG-NYPMAQRWRPILVFL 124
           ++ VW   + T C  +       DG    C+A + +R+ Q +FG  YP    WRP L F+
Sbjct: 63  INGVWESPSLTACREIL------DGKMGGCFAVLTERWNQLLFGFKYPSELYWRPGLAFV 116

Query: 125 TGSILLTPMLIPS-FPRK---------FLNSILLFG---LFPIFS--------------- 156
              I   P+L    FPRK         F+   L++G   L P+F+               
Sbjct: 117 LLFIAAAPVLFGKIFPRKMLIFTGLYPFIAYWLIWGGSVLVPVFALLGVLVGAFTYSRVV 176

Query: 157 -----------------FFVLYGG--------LGLSIVETSLWGGLLVTLVISFFGIIIS 191
                            F++L G         + +  V +   GG ++ L++    + +S
Sbjct: 177 TISAGVAVIAAFVAALIFWILSGYVTGPMENVMAIQAVASRDMGGFMINLMLGVVCVSLS 236

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +PLGILLALGR S++P++++ C+ FIE  RGVPL+T+LF+A+++L  FLP   + D +LR
Sbjct: 237 LPLGILLALGRQSSMPIIKWICVVFIEFIRGVPLITLLFVANVVLAYFLPPGTNFDLILR 296

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
            ++ ++ F+SAYIAEV+RGGL ++ +GQ+EA +SLGL Y Q M+LII+PQ +K  IPGIV
Sbjct: 297 VIIMITMFSSAYIAEVIRGGLAALPRGQYEAGDSLGLDYAQSMQLIILPQALKISIPGIV 356

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRVN-FSESTWISSVTPTTGLIFIGFVFWIFCFSIS 370
           N  +GLFKD++L+S+I+MFD++G++R    + S W        G  F   +F+I C+ IS
Sbjct: 357 NVAVGLFKDTTLVSVISMFDIVGMIRGPILASSEWNGVYWELFG--FACVLFFITCYGIS 414

Query: 371 LYSVFIEKTLHKGSK 385
            YS ++E+ L    +
Sbjct: 415 QYSQWLERQLRTDHR 429


>gi|110678763|ref|YP_681770.1| amino acid ABC transporter, permease protein [Roseobacter
           denitrificans OCh 114]
 gi|109454879|gb|ABG31084.1| amino acid ABC transporter, permease protein [Roseobacter
           denitrificans OCh 114]
          Length = 432

 Score =  239 bits (609), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 146/444 (32%), Positives = 237/444 (53%), Gaps = 71/444 (15%)

Query: 1   MIDSCKE-FPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPG 59
           M D+ +    +VR   +    PPV   G + W+ +N F TP + +LT + +  +   + G
Sbjct: 1   MTDTNQHSASFVRTETIPERAPPVTASGPVKWVRENLFATPANSVLTIIALYFIYLLLAG 60

Query: 60  IIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFG-NYPMAQRWR 118
            + W+ L+ VW  S+ + C  V  G +       AC++ + +R  Q +FG  YP    WR
Sbjct: 61  SLPWL-LNGVWTTSSLSECREVLGGAV------GACFSVLTERLNQLLFGFQYPSELYWR 113

Query: 119 PILVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVL------------------ 160
           P L  +   +   P+L    PRK L   +   L+P  +++++                  
Sbjct: 114 PALALVLLFVAGAPVLFFDLPRKLL---IFTALYPFIAYYLIWGGALGVPVLALVGCVAG 170

Query: 161 ----------------YGGLGLSIV--------------ETSLW--------GGLLVTLV 182
                           +GG+  +++              +T++         GG ++ ++
Sbjct: 171 YLVYSRFVAGSFAKGFFGGIAAALIVWNLGGLLIPENANDTAMMTAVPSRDLGGFMLNMM 230

Query: 183 ISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPD 242
           +    + +S+PLGI+LALGR S++P++++ C+ FIE  RGVPL+T+LF+AS+ML  F P 
Sbjct: 231 LGVTCVSLSVPLGIVLALGRQSSMPLIKWICVIFIEFIRGVPLITLLFVASVMLAYFFPP 290

Query: 243 TWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQV 302
              VD  LR ++ ++ F+SAYIAEV+RGGL ++ KGQ+E A+SLGL Y Q  RLII+PQ 
Sbjct: 291 ESTVDLFLRVVIMITMFSSAYIAEVIRGGLAALPKGQYEGADSLGLDYAQATRLIILPQA 350

Query: 303 IKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSEST-WISSVTPTTGLIFIGFV 361
           +K  IPGIVN  +GLFKD++L+S+I+MFDL+G++R     ST W        G  F   +
Sbjct: 351 LKISIPGIVNVAVGLFKDTTLVSVISMFDLVGMIRGPILASTDWAGVYWELYG--FAALL 408

Query: 362 FWIFCFSISLYSVFIEKTLHKGSK 385
           F++ C+ IS YS ++E+ L    +
Sbjct: 409 FFVVCYGISQYSQWLERRLATDHR 432


>gi|56695435|ref|YP_165783.1| glutamate/glutamine/aspartate/asparagine ABC transporter, permease
           protein [Ruegeria pomeroyi DSS-3]
 gi|56677172|gb|AAV93838.1| glutamate/glutamine/aspartate/asparagine ABC transporter, permease
           protein [Ruegeria pomeroyi DSS-3]
          Length = 437

 Score =  238 bits (608), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 153/442 (34%), Positives = 238/442 (53%), Gaps = 68/442 (15%)

Query: 6   KEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVF 65
            +  +VR  +L    PP    G + W   N F    + +LT   +  +   +  ++ W+F
Sbjct: 2   SDIGFVRTEMLPEREPPASTVGALGWARANLFSNWFNSVLTLASLYAVFAILAAVLPWIF 61

Query: 66  LDAVWIGSNRTVCTTV--SQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVF 123
               W G++ + C  +  + G +   G + ACW  I +R+ Q +FG YP    WRPIL F
Sbjct: 62  -SPTWNGTSLSNCREILTAAGSVGDHGTSGACWGVIRERWIQLLFGFYPSELYWRPILAF 120

Query: 124 LTGSILLTPMLIPSFPRKFLNSILLF-GLFPIFSFFVLYGGL------------------ 164
           +   + L P+L   F  K  + +L+F GL+P    ++L+GG                   
Sbjct: 121 ILLGVALAPVL---FSDKMPSKMLIFSGLYPFIFPWLLWGGTIWGPIAALLGFVLGWVIY 177

Query: 165 -GLSIVETSLWGGLLVT-------LVIS----------------------FFGIIISMPL 194
             +S   +SL G LL         LV++                      F G ++S+ +
Sbjct: 178 SAVSKTMSSLIGILLGAAAALVWWLVLAGFFVGVFDSVLAIGIEAVESRKFGGFMLSITI 237

Query: 195 GI-----------LLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDT 243
           G+           +LALGR S++ +++Y C+ FIE  RGVPL+T+LF+AS +L +F+P  
Sbjct: 238 GVVAIACSLPLGIVLALGRQSDLLIVKYICVGFIEFIRGVPLITLLFVASTLLNIFMPPG 297

Query: 244 WDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVI 303
            + D +LR L+ V+ FA+AY+AEV+RGGL ++ KGQ+E A+SLGL+Y Q  RLIIMPQ +
Sbjct: 298 TNFDIILRVLIMVTLFAAAYMAEVIRGGLAALPKGQYEGADSLGLNYWQAQRLIIMPQAL 357

Query: 304 KRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFW 363
           K  IPGIV+TFIG+FKD+ L+SII + D LG+     +++ W   V    G  FI  +F+
Sbjct: 358 KISIPGIVSTFIGVFKDTVLVSIIGLLDPLGLSNAIRADANWNGIVWEIYG--FIALIFF 415

Query: 364 IFCFSISLYSVFIEKTLHKGSK 385
           +FCF +S YS+++E+ LH G +
Sbjct: 416 VFCFGMSRYSMYLERKLHTGHR 437


>gi|220914744|ref|YP_002490052.1| polar amino acid ABC transporter, inner membrane subunit
           [Methylobacterium nodulans ORS 2060]
 gi|219952495|gb|ACL62885.1| polar amino acid ABC transporter, inner membrane subunit
           [Methylobacterium nodulans ORS 2060]
          Length = 394

 Score =  238 bits (607), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 139/364 (38%), Positives = 214/364 (58%), Gaps = 12/364 (3%)

Query: 27  GIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGI 86
           G + W   N F +    ++T +++ LL       ++W  L AVW   N    T       
Sbjct: 39  GPLGWARTNLFSSIPSTIVTLVLLILLARWATEFVNWAILHAVWSVPN--TATGPDTAAC 96

Query: 87  QPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSI 146
           +      ACWA I ++Y   +FG Y   ++WRP +V     +L   + + S  R+F    
Sbjct: 97  RDAKGIGACWAVISEKYRFILFGRYLYEEQWRPAIVI----VLFIGLYVVSAMRQFWRKE 152

Query: 147 LLFGLFPIFSFF--VLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRN 203
           L+       +    +++GG+ GL+ V    WGGL +TL+++ FG+  + PL IL+ALGR 
Sbjct: 153 LILIWITTLTVVGVLMWGGVFGLTYVPQDSWGGLPITLILATFGLACAFPLSILVALGRR 212

Query: 204 S-NIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASA 262
           + N+P +R  C  ++EL RGVPL+TVLFMAS+M PLF+P   + DKLLRA + V  FA+A
Sbjct: 213 ATNLPAIRVLCTVYVELIRGVPLITVLFMASVMFPLFMPAGLNPDKLLRAQVAVILFAAA 272

Query: 263 YIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSS 322
           Y+AEV+RGGLQ++ KGQ+EAA++LGL Y  K   II+PQ ++ VIP +VNTFIG FKD+S
Sbjct: 273 YLAEVVRGGLQTLPKGQYEAADALGLGYWHKTAFIILPQALRLVIPPLVNTFIGFFKDTS 332

Query: 323 LISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHK 382
           L+ II +FDLL   +V  ++  W    T     + +  +++ FC+ ++ YS  +E+   +
Sbjct: 333 LVLIIGLFDLLTAGKVAMADLVWQPYSTEV--YLVLAAIYFAFCYVMARYSRGLEQGFSR 390

Query: 383 GSKK 386
            +K+
Sbjct: 391 STKR 394


>gi|224371698|ref|YP_002605862.1| ABC-type branched-chain amino acid transport-system, permease
           component [Desulfobacterium autotrophicum HRM2]
 gi|223694415|gb|ACN17698.1| ABC-type branched-chain amino acid transport-system, permease
           component [Desulfobacterium autotrophicum HRM2]
          Length = 384

 Score =  238 bits (607), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 138/366 (37%), Positives = 216/366 (59%), Gaps = 16/366 (4%)

Query: 17  QPSLP-PVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNR 75
            P+LP P+   G+I W+ +N F +P + +LT   + LL    P +I W  LDA +  S  
Sbjct: 27  SPALPAPLESVGVIGWLKQNLFSSPLNAMLTLAALALLWKIFPPLISWAILDANF--SLS 84

Query: 76  TVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLI 135
            +      G I+  G   ACW FI+ ++   + G YP    WRP++ F+  + +     +
Sbjct: 85  ALPQGADPGTIERTG---ACWTFIFVKFRVLMTGLYPEQLLWRPVMAFVIFAAVCAVTAL 141

Query: 136 PSFPRKFLNSILLFGLFPIFSFFV---LYGGLGLSIVETSLWGGLLVTLVISFFGIIISM 192
                + L   ++ G++      +   + GG+GL++V+ SLWGGL+++  ++  GII+S+
Sbjct: 142 -----RLLGVRMIMGMWLFLPLPLYFLINGGMGLTVVDQSLWGGLMLSTGLAAIGIIMSI 196

Query: 193 PLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRA 252
           PLGILLALGR S   V+R   I  IE  RGVPL+T+LFMAS+MLP+FLP   +++ LLR 
Sbjct: 197 PLGILLALGRRSEWVVIRSLSIGMIESIRGVPLITILFMASVMLPIFLPREMNINNLLRV 256

Query: 253 LLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVN 312
            +G+  F++AYIAEV+RGGLQ+I +GQ EAA SLGL        +++PQ ++ V+P ++ 
Sbjct: 257 QIGIILFSAAYIAEVVRGGLQAIPQGQIEAATSLGLPGWVVTAFVVLPQALRHVVPSLIG 316

Query: 313 TFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLY 372
             + LFKD+SL+ I+ + D LG+++ +  +  W+         +F   V+WI CFS+S Y
Sbjct: 317 RCVALFKDTSLVIIVGLLDFLGMIKASAQDPDWLG--YDAEAYVFCALVYWIICFSMSRY 374

Query: 373 SVFIEK 378
              IE 
Sbjct: 375 GRSIEH 380


>gi|171058821|ref|YP_001791170.1| polar amino acid ABC transporter inner membrane subunit [Leptothrix
           cholodnii SP-6]
 gi|170776266|gb|ACB34405.1| polar amino acid ABC transporter, inner membrane subunit
           [Leptothrix cholodnii SP-6]
          Length = 366

 Score =  237 bits (605), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 128/360 (35%), Positives = 208/360 (57%), Gaps = 20/360 (5%)

Query: 31  WIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDG 90
           W  +N F        T L+I    +++P +  W    AVW G N   C      G     
Sbjct: 23  WAQRNLFAGVPSSFATLLLIASFAWALPQLWIWGVSHAVWSG-NAEACQAARGSG----- 76

Query: 91  WNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILL-- 148
              ACW  I +++   IFG YP   +WRP++  L     +  ML+ S  R+     L+  
Sbjct: 77  ---ACWGVITEKHRLVIFGRYPYDAQWRPLIATLA----MFTMLVISCVRRCWRPWLVPA 129

Query: 149 -FGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIP 207
             G+  +F F ++ GG GL+ V T  WGGL +T+ ++   I+++ P+ + +ALGR S +P
Sbjct: 130 WAGVLAVF-FVLMGGGFGLAKVGTDQWGGLPLTVTLATLSIVLAFPIAVAVALGRRSKLP 188

Query: 208 VLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEV 267
            +R  C  ++EL RGVPL++VLFMAS M PL +P     D LLR L+G++ F++AY+AE+
Sbjct: 189 AIRSLCTLYVELIRGVPLISVLFMASFMFPLLMPSGTSPDVLLRVLVGITLFSAAYMAEI 248

Query: 268 LRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISII 327
           +R GLQ+I  GQ EAA S+GL + Q  RL+++PQ +  V+P ++N FI +FKD+SLI+++
Sbjct: 249 VRAGLQAIPAGQLEAAASVGLGWWQTQRLVVLPQALAAVVPSLMNNFIAIFKDTSLITVV 308

Query: 328 NMFDLLGIVRVNFS-ESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
           ++++L G + +  S +  W        G +FI  ++++ CF++S YS+++E  L +   +
Sbjct: 309 SLYELTGSLGLALSGDPVW--RPFKIEGYLFITAIYFVICFAMSRYSLWVEAQLGRSRNR 366


>gi|163733774|ref|ZP_02141216.1| amino acid ABC transporter, permease protein [Roseobacter litoralis
           Och 149]
 gi|161392885|gb|EDQ17212.1| amino acid ABC transporter, permease protein [Roseobacter litoralis
           Och 149]
          Length = 432

 Score =  237 bits (605), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 149/448 (33%), Positives = 240/448 (53%), Gaps = 79/448 (17%)

Query: 1   MIDSCKE-FPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPG 59
           M D+ +    +VR   +    PP+   G + W+ +N F TP + +LT +    +   + G
Sbjct: 1   MTDTSQHSASFVRTETIPERAPPLAASGPVKWMRENLFATPANSVLTIVAAYFIYLILAG 60

Query: 60  IIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFG-NYPMAQRWR 118
            + W+ L+ VW   + + C  V  G +       AC++ + +R+ Q +FG  YP    WR
Sbjct: 61  TLPWL-LNGVWSTDSLSECRDVLDGAV------GACFSVLTERWNQLLFGFQYPSELYWR 113

Query: 119 P----ILVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLY-GGLGLSIV---- 169
           P    IL+F+ G+    P+L    PRK L   +   L+P  ++++++ G LG+ ++    
Sbjct: 114 PGLALILLFIAGA----PVLFFDLPRKLL---IFTALYPFIAYYLIWGGALGVPVLALVG 166

Query: 170 -------------------------------------------ETSLW--------GGLL 178
                                                      ET++         GG +
Sbjct: 167 CVAGYLVYRRFVTGNFAIGFFGGIVAAVFVWILGGLLIPENANETAMMTAVPSRDLGGFM 226

Query: 179 VTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPL 238
           + +++    + +S+PLGI+LALGR S++P++++ C+ FIE  RGVPL+T+LF+AS+ML  
Sbjct: 227 LNMMLGVTCVSLSVPLGIVLALGRQSSMPLIKWICVIFIEFIRGVPLITLLFVASVMLAY 286

Query: 239 FLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLII 298
           F P    VD  LR ++ ++ F+SAYIAEV+RGGL ++ KGQ+E A+SLGL Y Q  RLII
Sbjct: 287 FFPPESTVDLFLRVVIMITMFSSAYIAEVIRGGLAALPKGQYEGADSLGLDYTQATRLII 346

Query: 299 MPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSEST-WISSVTPTTGLIF 357
           +PQ +K  IPGIVN  +GLFKD++L+S+I+MFDL+G++R     ST W        G  F
Sbjct: 347 LPQALKISIPGIVNVAVGLFKDTTLVSVISMFDLVGMIRGPILASTDWGGVYWELYG--F 404

Query: 358 IGFVFWIFCFSISLYSVFIEKTLHKGSK 385
              +F++ C+ IS YS ++E+ L    +
Sbjct: 405 AALLFFVVCYGISQYSQWLERRLATDHR 432


>gi|159042876|ref|YP_001531670.1| glutamate/glutamine/aspartate/asparagine ABC transport system
           permease [Dinoroseobacter shibae DFL 12]
 gi|157910636|gb|ABV92069.1| glutamate/glutamine/aspartate/asparagine ABC transport system
           permease [Dinoroseobacter shibae DFL 12]
          Length = 432

 Score =  237 bits (604), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 156/442 (35%), Positives = 231/442 (52%), Gaps = 67/442 (15%)

Query: 1   MIDSCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGI 60
           M D+     +VR   + PS PPV + GI+ W+  N F +    +LT L    + +    +
Sbjct: 1   MSDTHASAAFVRTEEIPPSPPPVSEVGIVNWLRSNLFYSIPSSILTLLTAAFIYWLSSIL 60

Query: 61  IHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPI 120
           + W+F + VW  ++   C  +  G I        C+A I +R+ Q IFGNYP  + WR +
Sbjct: 61  MPWMF-NGVWDANSIRDCREILDGAI------GGCFAVIAERWPQLIFGNYPNEEYWRAV 113

Query: 121 LVFLTGSILLTPMLIPSFP----------------------------------------- 139
           L F+   + L P+L    P                                         
Sbjct: 114 LAFVGLFVALAPVLFFKLPRKMLWFTGLFPFIAYWLIWGGSAWVSVMALVGVVVGYVAFK 173

Query: 140 ----RKFLNSILLFGLFPIFSFFVLYG-----------GLGLSIVETSLWGGLLVTLVIS 184
               R F  +I+   LF    F++               L L  VE+   GG ++  ++ 
Sbjct: 174 ALEERSFFGAIVA-ALFATLLFWIFISPLAVNALSSVVALSLPQVESRFIGGFMINFILG 232

Query: 185 FFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTW 244
             GI +S+PLGI LALGR SN+P+++  C+ FIE  RGVPL+T+LF+AS+ML  FLP   
Sbjct: 233 TSGIALSLPLGIALALGRQSNLPIIKGVCVVFIEFIRGVPLITLLFVASVMLAYFLPPGT 292

Query: 245 DVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIK 304
             D +LR ++ ++ FASAYIAE +RGGL ++ +GQ+EA +SLGL Y Q MRLII+PQ +K
Sbjct: 293 SFDLVLRVIIMITLFASAYIAEAIRGGLAALPRGQYEAGDSLGLDYWQSMRLIILPQALK 352

Query: 305 RVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVN-FSESTWISSVTPTTGLIFIGFVFW 363
             IP IVN  IGLFKD++L+SII+MFD+LG+++    S + W        G  F G +F+
Sbjct: 353 ISIPSIVNIAIGLFKDTTLVSIISMFDMLGMIQGPILSSTEWFGVYWELLG--FAGVLFF 410

Query: 364 IFCFSISLYSVFIEKTLHKGSK 385
           +FC+ IS YS ++E+ L    +
Sbjct: 411 VFCYGISQYSQWLERQLATEHR 432


>gi|317407541|gb|EFV87491.1| ABC-type amino acid transport system [Achromobacter xylosoxidans
           C54]
          Length = 321

 Score =  236 bits (603), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 128/329 (38%), Positives = 200/329 (60%), Gaps = 17/329 (5%)

Query: 60  IIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRP 119
           +++W  LDAVW G+   VC   S           ACWAF+ ++  Q +FG YP  ++WRP
Sbjct: 8   LLNWAVLDAVWPGATGDVCRQAS----------GACWAFLGEKMRQILFGIYPPGEQWRP 57

Query: 120 ILVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGG--LGLSIVETSLWGGL 177
            +V L    +L   +    PR++     +  +  + +   L  G  LGL+ V TS WGGL
Sbjct: 58  TVVCL---FILAMTVFSLSPRQWRARTAVIWIAGLLAGLALMQGGMLGLARVPTSSWGGL 114

Query: 178 LVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLP 237
            +TL+++   +   +PLG+LLALGR  ++P  R+  I  IEL RG+PLV++LFMASI+LP
Sbjct: 115 PITLLLAVCALGAGLPLGVLLALGRRGSLPTARFISIGVIELIRGLPLVSLLFMASIVLP 174

Query: 238 LFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLI 297
           + LP    +D LLRA + ++ F++AY+AEV+RGGLQ+I  GQ EA+ +LGLS+ Q  RL+
Sbjct: 175 IMLPAGMTIDSLLRAGIALTVFSAAYLAEVIRGGLQAIPPGQAEASRALGLSWWQMTRLV 234

Query: 298 IMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIF 357
           ++PQ +++VI  + NT I + K++SL+ I+ +FDLL   R   ++  W +    T   +F
Sbjct: 235 VLPQALRKVIAPLTNTAIVMIKNTSLVLIVGLFDLLSSGRAALTDPAWPTPYVET--YLF 292

Query: 358 IGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
           I  +++  CF +S YS+++E    KG  +
Sbjct: 293 IASIYFCICFGLSRYSMWLEHRYKKGELR 321


>gi|254488499|ref|ZP_05101704.1| amino acid ABC transporter, permease protein [Roseobacter sp.
           GAI101]
 gi|214045368|gb|EEB86006.1| amino acid ABC transporter, permease protein [Roseobacter sp.
           GAI101]
          Length = 431

 Score =  236 bits (602), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 150/435 (34%), Positives = 233/435 (53%), Gaps = 63/435 (14%)

Query: 5   CKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWV 64
            +   +VR  +L  + PP   +G + W+  + F +    +LT   +  +   + G + W+
Sbjct: 6   AQTVTFVRDTMLPQAAPPSTAQGPVKWMRDSLFSSIPYTILTIAALYAIFVLLSGFLPWL 65

Query: 65  FLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFG-NYPMAQRWRPILVF 123
            L  VW  SN   C  V       DG    C++ + +R+ Q +FG  YP    WRP L F
Sbjct: 66  -LGGVWTTSNIRECREVL------DGARGGCFSVLAERWNQLLFGIAYPQDGYWRPTLAF 118

Query: 124 LTGSILLTPMLIPSFPRK---------FLNSILLFG---LFP------------------ 153
           +   + ++P+L  + PRK         F+   L++G   L P                  
Sbjct: 119 ILLFVAVSPVLFAAVPRKLLIVTLLYPFVAFWLIWGGSLLVPLAALISLCVGYLVYSKLV 178

Query: 154 ---------------IFSFFV-------LYGGLGLSIVETSLWGGLLVTLVISFFGIIIS 191
                          +F +F+       L G L L  V +   GG ++ +++    + +S
Sbjct: 179 KTSFAAGLAAGVATAVFIWFIAGFITPGLSGVLALEEVASRNMGGFMLNMILGVICVSLS 238

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +PLGILLALGR S++P+++  C+ FIE  RGVPL+T+LF+A+++L  FLP   + D +LR
Sbjct: 239 LPLGILLALGRQSSLPIIKLICVVFIEFIRGVPLITLLFVANVVLAYFLPPGTNFDLILR 298

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
            ++ ++ FASAYIAEV+RGGL ++ +GQ+E A SLGL Y Q MRLII+PQ +K  IPGIV
Sbjct: 299 VIIMITMFASAYIAEVIRGGLAALPRGQYEGAESLGLDYAQSMRLIILPQALKISIPGIV 358

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRVNFSEST-WISSVTPTTGLIFIGFVFWIFCFSIS 370
           N  +GLFKD++L+SII+MFDL+G++R     ST W        G  F   +F++ C+ IS
Sbjct: 359 NVAVGLFKDTTLVSIISMFDLVGMIRGPILASTDWNGVYWELWG--FAAALFFVVCYGIS 416

Query: 371 LYSVFIEKTLHKGSK 385
            YS ++E+ L    +
Sbjct: 417 QYSQWLERQLQTDHR 431


>gi|83950491|ref|ZP_00959224.1| glutamate/glutamine/aspartate/asparagine ABC transporter, permease
           protein [Roseovarius nubinhibens ISM]
 gi|83838390|gb|EAP77686.1| glutamate/glutamine/aspartate/asparagine ABC transporter, permease
           protein [Roseovarius nubinhibens ISM]
          Length = 442

 Score =  234 bits (597), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 144/440 (32%), Positives = 234/440 (53%), Gaps = 61/440 (13%)

Query: 3   DSCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIH 62
           ++ +   +VR  +L    PP    G + W+ KN F +  + +LT + +  + + + G++ 
Sbjct: 7   EAARAIAFVRTDMLPEQEPPATTIGFVGWLRKNLFSSVANSILTVIALLFIAYVMSGLLP 66

Query: 63  WVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILV 122
           W+F  +VW   +   C  +       D    ACW  + +R+ Q ++G YP    WR  L 
Sbjct: 67  WLF-QSVWNAGSLNECREI-MNATWGDTHGHACWGVVKERWLQLLYGFYPDHLYWRVNLA 124

Query: 123 FLTGSILLTPMLI-PSFPRK---------FLNSILLFG---------------------- 150
           F+   + + P+L     PRK         F+   LL+G                      
Sbjct: 125 FVLTLVAMAPVLFSEQLPRKMLIVTALYPFVMPWLLWGGSIWGPIAAALGFVIGYYAYKI 184

Query: 151 ---------------LFPIFSFFVLYG----------GLGLSIVETSLWGGLLVTLVISF 185
                          L P+  +F L G           +G+  V++  +GG ++ +++  
Sbjct: 185 LEPIAGSLVAIIAAVLLPVIWWFGLSGLITGALTDLMPIGIEAVQSRKFGGFMLAILLGI 244

Query: 186 FGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWD 245
             I  S+P+GI+LALGR S++ +++  C+ FIE  RGVPL+T+LF+AS++L LFLP   +
Sbjct: 245 VAIGCSLPIGIVLALGRQSDLLLVKAICVGFIEFIRGVPLITLLFVASLLLNLFLPPGTN 304

Query: 246 VDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKR 305
            D +LR ++ ++ FA+AY+AEV+RGGL ++ KGQ+E A+SLGL+Y Q  RLIIMPQ +K 
Sbjct: 305 FDIILRVMIMMTLFAAAYMAEVIRGGLAALPKGQYEGADSLGLNYWQAQRLIIMPQALKI 364

Query: 306 VIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIF 365
            IPGIV+TFIG+FKD++L+SII +FD++G+     +++ W          I   F   I 
Sbjct: 365 SIPGIVSTFIGIFKDTTLVSIIGLFDVIGLSNAIRADTAWNGIYWELFAFIAFLFF--IV 422

Query: 366 CFSISLYSVFIEKTLHKGSK 385
           CFS+S YS+++E+ L  G  
Sbjct: 423 CFSMSRYSMYLERKLQTGHN 442


>gi|126724901|ref|ZP_01740744.1| Amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine [Rhodobacterales bacterium
           HTCC2150]
 gi|126706065|gb|EBA05155.1| Amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine [Rhodobacterales bacterium
           HTCC2150]
          Length = 431

 Score =  233 bits (595), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 153/441 (34%), Positives = 227/441 (51%), Gaps = 66/441 (14%)

Query: 1   MIDSCKEFPYVRKRLLQPSLPP-VYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPG 59
           M+DS K   +VR     PSLPP     G + W+ +N F TP + +LT L +  +   +  
Sbjct: 1   MVDSTKSVAFVRTED-APSLPPPSSAAGPVKWLRENLFATPANAILTVLSLIAIYLLLRD 59

Query: 60  IIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFG-NYPMAQRWR 118
            + W+ L+ VW   +   C  V QG          C+A + +R+ Q +FG  YP    WR
Sbjct: 60  FLPWL-LNGVWNSDSLAGCREVLQGA------TGGCFAVLTERWNQLLFGFTYPTDLYWR 112

Query: 119 PILVFLTGSILLTPMLIPSFPRKFLNSILLFGLF------------PIFSF------FVL 160
           P + F    +   P+L    PRK L    LF               PI S       +++
Sbjct: 113 PTVAFALFFLAAAPVLFFDLPRKLLIFTALFPFIAYYLIWGGSIWTPILSLVGIIVGYIV 172

Query: 161 YGGLGLSIVETSLWGGLLVTLVISFFG--------------------------------- 187
           Y  L +S      +G +L  +++   G                                 
Sbjct: 173 YSRLVVSSFAAGFFGAILAAVIVWIVGGSFVPDGFAVEGSMRSVPSRDLGGFMLNMMLGV 232

Query: 188 --IIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWD 245
             + +S+P+GI LALGR S++P++++ C+ FIE  RGVPL+T+LF+AS+ML  F P    
Sbjct: 233 TCVSLSVPIGIALALGRQSSMPLIKFVCVIFIEFIRGVPLITLLFVASVMLAYFFPPEAT 292

Query: 246 VDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKR 305
           VD  LR ++ ++ F++AYIAEV+RGGL ++ KGQ+EA +SLGL Y Q MRLII+PQ +K 
Sbjct: 293 VDLFLRVVIMITLFSAAYIAEVVRGGLAALPKGQYEAGDSLGLDYPQAMRLIILPQALKI 352

Query: 306 VIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSES-TWISSVTPTTGLIFIGFVFWI 364
            IPGIVN  +GLFKD+ L+S+I+MFDL+G++R     S  W        G  F   +F+I
Sbjct: 353 SIPGIVNIAVGLFKDTVLVSVISMFDLIGMIRGPIPASPDWNGVYWELFG--FASVLFFI 410

Query: 365 FCFSISLYSVFIEKTLHKGSK 385
            C+ IS YS ++E+ L    +
Sbjct: 411 CCYGISQYSQWLERRLATDHR 431


>gi|309791170|ref|ZP_07685702.1| polar amino acid ABC transporter, inner membrane subunit
           [Oscillochloris trichoides DG6]
 gi|308226732|gb|EFO80428.1| polar amino acid ABC transporter, inner membrane subunit
           [Oscillochloris trichoides DG6]
          Length = 393

 Score =  233 bits (595), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 119/237 (50%), Positives = 173/237 (72%), Gaps = 3/237 (1%)

Query: 151 LFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLR 210
           L+PI +  ++ GG+GL IVET+LWGGLL+T+++S  GII+S PLG+LLALGR SN+P+++
Sbjct: 158 LYPI-AILIIRGGVGLPIVETNLWGGLLLTMILSSSGIILSFPLGVLLALGRRSNLPIIK 216

Query: 211 YACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRG 270
             C+ +IEL RGVPLVTVLFMA +MLPLFLPD   +D +LRA++ V+ F++AY+AE +RG
Sbjct: 217 GFCVAYIELIRGVPLVTVLFMAQLMLPLFLPDQVRIDSVLRAMVAVTLFSAAYLAENVRG 276

Query: 271 GLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMF 330
           GLQS+ +GQ EAA +LGL+ +Q   LI +PQ ++ VIP +V  FI LFKD+SL+ I+ + 
Sbjct: 277 GLQSLPRGQTEAARALGLNPVQTTLLITLPQALRAVIPVLVGQFISLFKDTSLVVIVGLI 336

Query: 331 DLLGIVRVNFSESTW--ISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSK 385
           DLLGI R  +S++ W   +       L+ +  ++WIF F++S  S  IE+ +  G +
Sbjct: 337 DLLGIARTIYSQAEWKDFTGGVWRETLLVVALIYWIFSFTMSRTSKKIEEKMSVGYR 393


>gi|87120915|ref|ZP_01076807.1| ABC-type amino acid transport system, permease component
           [Marinomonas sp. MED121]
 gi|86163753|gb|EAQ65026.1| ABC-type amino acid transport system, permease component
           [Marinomonas sp. MED121]
          Length = 371

 Score =  233 bits (593), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 129/363 (35%), Positives = 209/363 (57%), Gaps = 14/363 (3%)

Query: 22  PVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTV 81
           P  +  ++    + +F    +  LT  +I   +  +P ++ W   DAV+IGS +  C   
Sbjct: 21  PQNKMTLLQKARQRYFSNLLNSFLTLSVIIAFILILPPLLQWAIFDAVFIGSTQEACEVA 80

Query: 82  SQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRK 141
           +           ACW  I  R++ F++G YP  + WR  LVF      L  ++      K
Sbjct: 81  A----------GACWLPIAARFDLFVYGFYPETETWRVNLVFAASFFTLVVLVWRRISMK 130

Query: 142 FLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPLGILLAL 200
            L  + +    P   F +LYGG+ GL  V ++ +GGL++T+ +   G I+S+PLGI LAL
Sbjct: 131 -LKLVYIVAFLPALIFVLLYGGVFGLDSVSSNKFGGLIITIFLGLIGSILSLPLGIFLAL 189

Query: 201 GRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFA 260
           GR S  PV+R  C++ IELFR +P++T LFM +++L LFLP+  +VDK++R +  +   +
Sbjct: 190 GRRSTRPVIRIFCVSVIELFRAMPMITWLFMGALVLQLFLPNGMEVDKMIRVVFILVLVS 249

Query: 261 SAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKD 320
           +A  AE++R GLQ+I  GQFEA+ +LG+ Y + M ++IMPQV+K  IP ++N+FIG+FKD
Sbjct: 250 AASKAEIIRAGLQAIPVGQFEASAALGVGYWRTMSMVIMPQVLKVSIPAMLNSFIGMFKD 309

Query: 321 SSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTL 380
           +SL++II + D L +     +   W          IF+  ++++  F+IS +S+ +EK L
Sbjct: 310 TSLVAIIGLLDFLSVGMATMNSDEW--GKYGIEVYIFVAMIYFVILFTISRFSLTLEKQL 367

Query: 381 HKG 383
             G
Sbjct: 368 ETG 370


>gi|297518226|ref|ZP_06936612.1| putative transport system permease protein [Escherichia coli OP50]
          Length = 227

 Score =  231 bits (590), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 118/225 (52%), Positives = 160/225 (71%), Gaps = 3/225 (1%)

Query: 160 LYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIE 218
           +YGG   L  VET  WGGL +TL+I+  GI  ++P GILLALGR S++P++R   + FIE
Sbjct: 1   MYGGFFALERVETRQWGGLTLTLIIASVGIAGALPWGILLALGRRSHMPIVRILSVIFIE 60

Query: 219 LFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKG 278
            +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV  F SAY+AEV+RGGLQ++ KG
Sbjct: 61  FWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVGVILFQSAYVAEVVRGGLQALPKG 120

Query: 279 QFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRV 338
           Q+EAA SL L Y +   L+I+PQ +K VIPG+VNT I LFKD+SL+ II +FDL   V+ 
Sbjct: 121 QYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTIIALFKDTSLVIIIGLFDLFSSVQQ 180

Query: 339 NFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKG 383
              +  W+     T G +F   ++WIFCFS+S YS  +EK  + G
Sbjct: 181 ATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQHLEKRFNTG 223


>gi|254475047|ref|ZP_05088433.1| amino acid ABC transporter, permease protein [Ruegeria sp. R11]
 gi|214029290|gb|EEB70125.1| amino acid ABC transporter, permease protein [Ruegeria sp. R11]
          Length = 440

 Score =  231 bits (589), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 153/438 (34%), Positives = 238/438 (54%), Gaps = 70/438 (15%)

Query: 10  YVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAV 69
           +VR+  + P+ PP  + G+  W+ +N F +  + +LT + + L+   + G + W+ L+ V
Sbjct: 11  FVRETEIPPAPPPGRETGVYKWMRENLFSSIPNSILTIVALALIYSLLSGTLPWL-LNGV 69

Query: 70  WIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFG---------NYPMAQRWRPI 120
           W  S+   C  V       DG   AC++ + +R+ Q ++G           P  Q WRP 
Sbjct: 70  WNTSSLQECREVL------DGQVGACFSVLTERWNQLLYGFKYPIDPAYESPFMQYWRPN 123

Query: 121 LVFLTGSILLTPMLIPSFPRK------------------------------FLNSILLFG 150
           L  L   I L P+L    PRK                              F+ + ++F 
Sbjct: 124 LALLLLLIALAPVLFFDLPRKLLAFTAVYPFIAFWLIWGGSILVPIVALLGFVAAGVVFQ 183

Query: 151 LFPIFSFFV-LYGGLGLSIV--------------ETSLW--------GGLLVTLVISFFG 187
            +   SF V  +GG+  +IV              E ++         GG ++ +++    
Sbjct: 184 KYGKGSFAVGFFGGILAAIVVWNVGGFLIPEGASENAMLEAVPSRDLGGFMLNMMLGVTC 243

Query: 188 IIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVD 247
           + +S+PLGI LALGR S +P++++ C+ FIE  RGVPL+T+LF+AS+ML  F P    VD
Sbjct: 244 VSLSVPLGIALALGRQSTMPLIKWICVVFIEFVRGVPLITLLFVASVMLSYFFPPDATVD 303

Query: 248 KLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVI 307
             LR ++ ++ F+SAYIAEV+RGGL ++ KGQ+EAA+SLGL Y Q MRLII+PQ +K  I
Sbjct: 304 LFLRVVIMITLFSSAYIAEVIRGGLAALPKGQYEAADSLGLDYPQAMRLIILPQALKISI 363

Query: 308 PGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCF 367
           PGIVN  +GLFKD++L+S+I+MFDL+G++R     ST  + V     L F  F+F++ C+
Sbjct: 364 PGIVNVAVGLFKDTTLVSVISMFDLVGMIRGPILASTEWNGVYWEL-LGFAAFLFFVVCY 422

Query: 368 SISLYSVFIEKTLHKGSK 385
            IS YS ++E+ L    +
Sbjct: 423 GISQYSQWLERRLATDHR 440


>gi|126737044|ref|ZP_01752779.1| ABC glutamate/glutamine/aspartate/asparagine transporter, inner
           membrane subunit BztC [Roseobacter sp. SK209-2-6]
 gi|126721629|gb|EBA18332.1| ABC glutamate/glutamine/aspartate/asparagine transporter, inner
           membrane subunit BztC [Roseobacter sp. SK209-2-6]
          Length = 432

 Score =  229 bits (584), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 146/437 (33%), Positives = 232/437 (53%), Gaps = 62/437 (14%)

Query: 3   DSCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIH 62
            +     +V +  +  S PP  + G+  W  +N F    + +LT + + L+   +   + 
Sbjct: 4   KTTNSIAFVAEGTIPESPPPARETGVYKWARENLFSNIPNSILTLVALALIYSVLSNTLP 63

Query: 63  WVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFG-NYPMAQRWRPIL 121
           W+ L+ +W  S+   C  V  G +       AC++ + +R+ Q ++G  YP    WRP L
Sbjct: 64  WL-LNGIWTTSSLAECREVLDGKV------GACFSVLSERWNQLLYGFKYPTEAYWRPNL 116

Query: 122 VFLTGSILLTPMLIPSFPRKFLNSILLFG------------LFPIFSFF------VLYGG 163
             +   I L P+L    PR+ L   +++             L P+ +F       V++  
Sbjct: 117 ALVLLLIALAPVLFFDLPRQLLGFTVVYPFIAFWLIWGGSILVPVIAFLGFVAAAVVFQR 176

Query: 164 LG-----------------------------------LSIVETSLWGGLLVTLVISFFGI 188
            G                                   LS V +   GG ++ +++    +
Sbjct: 177 FGKGSFAAGFFGALVAALVVWKVGGFLIPEGASENAMLSSVPSRDLGGFMLNMMLGVTCV 236

Query: 189 IISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDK 248
            +S+PLGI LALGR S++P++++ C+ FIE  RGVPL+T+LF+AS+ML  F P    VD 
Sbjct: 237 SLSVPLGIALALGRQSSMPLIKWICVIFIEFVRGVPLITLLFVASVMLSYFFPPDATVDL 296

Query: 249 LLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIP 308
            LR ++ ++ F++AYIAEV+RGGL ++  GQ+EAA+SLGL Y Q MRLII+PQ +K  IP
Sbjct: 297 FLRVVIMITLFSAAYIAEVIRGGLAALPTGQYEAADSLGLDYPQAMRLIILPQALKISIP 356

Query: 309 GIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFS 368
           GIVN  +GLFKD++L+S+I+MFDL+G++R     ST  + V     L F  F+F+I C+ 
Sbjct: 357 GIVNVAVGLFKDTTLVSVISMFDLVGMIRGPILASTEWNGVYWEL-LGFAAFLFFIVCYG 415

Query: 369 ISLYSVFIEKTLHKGSK 385
           IS YS ++E+ L  G +
Sbjct: 416 ISQYSQWLERRLATGHR 432


>gi|119897620|ref|YP_932833.1| putative amino acid permease [Azoarcus sp. BH72]
 gi|119670033|emb|CAL93946.1| putative amino acid permease [Azoarcus sp. BH72]
          Length = 362

 Score =  226 bits (577), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 130/359 (36%), Positives = 202/359 (56%), Gaps = 22/359 (6%)

Query: 29  IAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQP 88
           +A +    F +P   L T LI+  LL+    +  W  +DAVW+ ++   C   +      
Sbjct: 9   LAGLRGRCFDSPWSALATVLILAALLWLGQRVAGWAVIDAVWV-ADAARCEAAT------ 61

Query: 89  DGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILV--FLTGSILLTPMLIPSFPRKFLNS- 145
                ACW  I +++   +FG YP   +WRP+L    L  +I+ T     S PR   N  
Sbjct: 62  ----GACWGVIAEKHRAILFGRYPFDAQWRPLLATAILLVAIVATLRAAGSRPRPDGNRR 117

Query: 146 ---ILLFGLFPIFSFFVLYGG--LGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLAL 200
              + L  +  I  F VL GG   GL+ V T LWGGL +TL+++  GI  + PL I+LAL
Sbjct: 118 WRRVALAWVVTIALFPVLMGGGVAGLAPVPTELWGGLPLTLMLAVGGIATAFPLAIVLAL 177

Query: 201 GRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFA 260
           GR+  +P +R     ++EL R VPLV  LF+AS ++PL LP  W VD L R  + ++ FA
Sbjct: 178 GRSGPLPAMRAVSSVYVELIRSVPLVPALFLASFLVPLLLPADWQVDVLFRVQVAITLFA 237

Query: 261 SAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKD 320
           +AY+AE +RG L ++  GQ +AA +LGL + Q  R I++PQ ++   P I N+FI LFKD
Sbjct: 238 AAYLAEAIRGALLALPDGQRQAAAALGLGWWQTQRHILLPQALRNATPSIANSFINLFKD 297

Query: 321 SSLISIINMFDLLGIVRVNFS-ESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEK 378
           +SL+ ++++++L G + +  + ++ W S      G +FIG ++W  CF++S  S  +E+
Sbjct: 298 TSLVVVVSLYELTGALEIALAGDAEWRS--YQLEGYVFIGAIYWTGCFALSRASRRLEQ 354


>gi|255262639|ref|ZP_05341981.1| glutamate/glutamine/aspartate/asparagine transport system
           permeaseprotein BztC [Thalassiobium sp. R2A62]
 gi|255104974|gb|EET47648.1| glutamate/glutamine/aspartate/asparagine transport system
           permeaseprotein BztC [Thalassiobium sp. R2A62]
          Length = 432

 Score =  225 bits (574), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 147/434 (33%), Positives = 226/434 (52%), Gaps = 62/434 (14%)

Query: 6   KEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVF 65
           +   +VR   + P+ PP    G + WI  N F TP + +LT + + ++   + G + WVF
Sbjct: 7   QSVAFVRTEDVPPAPPPANATGPVKWIKDNLFATPANSVLTVIALLVIYMVLSGTLPWVF 66

Query: 66  LDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFG-NYPMAQRWRPILVFL 124
            + +W   +  VC  +       +G + AC+A + +R+ Q +FG  YP    WRP L F 
Sbjct: 67  -NGIWDSPSLAVCREML------NGESGACFAVLTERWNQLLFGFKYPSDLYWRPALAFA 119

Query: 125 TGSILLTPMLIPSFPRK----------------------------------------FLN 144
              +   P+L    PRK                                        F+ 
Sbjct: 120 LLFVAAAPVLFFDLPRKILIFTGLYPFIAYYLIWGGSIFTPLLALAGFVAGGYVYQRFVK 179

Query: 145 SILLFGLFPIFSFFVLYGGLG-------------LSIVETSLWGGLLVTLVISFFGIIIS 191
                G F   +  VL   +G             +  V++   GG ++ +++    + +S
Sbjct: 180 GSFAVGFFGAIAAAVLVWTIGGFIIPSSEITEGAMQSVQSRDLGGFMLNMMLGVTCVSLS 239

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +P+GI LALGR S++P+++Y C+ FIE  RGVPL+T+LF+AS+ML  F P    VD  LR
Sbjct: 240 LPIGIALALGRQSSMPIIKYICVVFIEFIRGVPLITLLFVASVMLSYFFPPEATVDLFLR 299

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
            ++ ++ F++AYIAEV+RGGL ++ KGQ+EAA+SLGL Y Q MRLII+PQ +K  IPGIV
Sbjct: 300 VVIMITIFSAAYIAEVVRGGLAALPKGQYEAADSLGLDYTQAMRLIILPQALKISIPGIV 359

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISL 371
           N  +GLFKD++L+S+I+MFD++G++R     ST  + V            F I C+ IS 
Sbjct: 360 NVSVGLFKDTTLVSVISMFDMVGMIRGPILASTEWNGVYWELFAFAALLFF-IVCYGISQ 418

Query: 372 YSVFIEKTLHKGSK 385
           YS ++E+ L    K
Sbjct: 419 YSQWLERRLATDHK 432


>gi|288959840|ref|YP_003450180.1| general L-amino acid transport system permease protein
           [Azospirillum sp. B510]
 gi|288912148|dbj|BAI73636.1| general L-amino acid transport system permease protein
           [Azospirillum sp. B510]
          Length = 357

 Score =  225 bits (573), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 137/366 (37%), Positives = 211/366 (57%), Gaps = 23/366 (6%)

Query: 19  SLP-PVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG-SNRT 76
           SLP P ++R     +    FGTP +  +T   + LL +++P ++ W  LDAVW+G ++R 
Sbjct: 13  SLPEPRWRR-----LWSGLFGTPLNAAVTLGCLALLGWTVPPLLRWTLLDAVWVGPADR- 66

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            C   +           ACWAFI ++    +FG Y + ++WRP         L     +P
Sbjct: 67  -CADAA----------GACWAFIGEKLRYILFGFYDLDRQWRPAAAGAILLALAGVSGMP 115

Query: 137 SFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGI 196
            F R+   ++ L+      +  +L GG G   V T  W GL V+L+++  G++ + PL +
Sbjct: 116 LFWRR--ATLGLWLFGLAAALLLLTGGPGGPAVPTERWSGLPVSLLLAVVGLVGAFPLAV 173

Query: 197 LLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGV 256
           LLAL R S +  +R   + FIE+ RGVPL+ VL++A+++LPL LP    +DKLLRA + +
Sbjct: 174 LLALARRSAMGGVRTLAVLFIEVTRGVPLIAVLYVATLLLPLMLPAGAAIDKLLRAQIAI 233

Query: 257 SAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIG 316
             F SAY+AE++R GLQSI  GQ+EAA +LGL Y Q MRL+I+PQ ++ VIP IV   IG
Sbjct: 234 ILFVSAYLAEIIRAGLQSIPAGQYEAAQALGLGYWQSMRLVILPQALRTVIPSIVTLAIG 293

Query: 317 LFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFI 376
           LF+D++LI +I +FDLL   R    +  W+       G  F+  ++   C + S YS+++
Sbjct: 294 LFQDTTLIIVIGLFDLLNTARTAAKDPAWLGFYDEAFG--FVALIYLTVCVAASRYSLWL 351

Query: 377 EKTLHK 382
           E+ L +
Sbjct: 352 ERRLQR 357


>gi|163739483|ref|ZP_02146893.1| amino acid ABC transporter, permease protein [Phaeobacter
           gallaeciensis BS107]
 gi|161387236|gb|EDQ11595.1| amino acid ABC transporter, permease protein [Phaeobacter
           gallaeciensis BS107]
          Length = 432

 Score =  224 bits (572), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 155/430 (36%), Positives = 237/430 (55%), Gaps = 62/430 (14%)

Query: 5   CKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWV 64
            +   +VR+  + P+ PP  + G+  WI +N F +  + +LT   + L+   +   + W+
Sbjct: 6   AQTVAFVRETQIPPAPPPGRETGVYKWIRENLFSSVPNSILTLAALALIYALLSSTLPWL 65

Query: 65  FLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFG-NYPMAQRWRPILVF 123
            L+ VW  ++   C  V  G +       AC++ + +R+ Q ++G  YP  + WRP L  
Sbjct: 66  -LNGVWTTNSLAECREVLDGKL------GACFSVLTERWNQLLYGFKYPGTEYWRPNLAL 118

Query: 124 LTGSILLTPMLIPSFPRK---------FLNSILLFG---LFPIFSF--FVLYG------- 162
           +   + L P+L    PRK         FL   L++G   L PI +   FV  G       
Sbjct: 119 VLLLVALAPVLFFDLPRKLLAFTAIYPFLAFWLIWGGSILVPIVALLGFVAAGFVFQKFG 178

Query: 163 ----GLG----------------------------LSIVETSLWGGLLVTLVISFFGIII 190
                LG                            LS V +   GG ++ +++    + +
Sbjct: 179 KGSFALGFFGAIVAAVVVWNIGGFLIPEGASDNAMLSAVPSRDLGGFMLNMMLGVTCVSL 238

Query: 191 SMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLL 250
           S+PLGI LALGR SN+P++++ C+ FIE  RGVPL+T+LF+AS+ML  F P    VD  L
Sbjct: 239 SVPLGIALALGRQSNMPLIKWICVVFIEFVRGVPLITLLFVASVMLSYFFPPDATVDLFL 298

Query: 251 RALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGI 310
           R ++ ++ F++AYIAEV+RGGL ++ KGQ+EAA+SLGL Y Q MRLII+PQ +K  IPGI
Sbjct: 299 RVVIMITLFSAAYIAEVIRGGLAALPKGQYEAADSLGLDYPQAMRLIILPQALKISIPGI 358

Query: 311 VNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSIS 370
           VN  +GLFKD++L+S+I+MFDL+G++R     ST  + V     L F  F+F+I C+ IS
Sbjct: 359 VNVAVGLFKDTTLVSVISMFDLVGMIRGPILASTEWNGVYWEL-LGFAAFLFFIVCYGIS 417

Query: 371 LYSVFIEKTL 380
            YS ++E+ L
Sbjct: 418 QYSQWLERRL 427


>gi|259416339|ref|ZP_05740259.1| glutamate/glutamine/aspartate/asparagine transport system
           permeaseprotein BztC [Silicibacter sp. TrichCH4B]
 gi|259347778|gb|EEW59555.1| glutamate/glutamine/aspartate/asparagine transport system
           permeaseprotein BztC [Silicibacter sp. TrichCH4B]
          Length = 442

 Score =  224 bits (571), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 151/445 (33%), Positives = 237/445 (53%), Gaps = 69/445 (15%)

Query: 6   KEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVF 65
            +  +VR  +L P  PP  + G++ W   N F    + +LT + +  ++  + G+I W +
Sbjct: 2   SDISFVRTEMLPPKDPPASEVGVVGWARANLFSGWFNSILTVVSLYFVIKILIGLIGWAW 61

Query: 66  LDAVWIGSNRTVCTTVSQGGIQPDGWNA-ACWAFIYDRYEQFIFGNYPMAQ-------RW 117
           +   W  ++   C  + +  +   G NA ACW  I +R+ Q +FG YP          RW
Sbjct: 62  VP-TWSATSLPECRVIFE-ELGRSGHNAGACWGVIAERWPQLLFGFYPNGYEEGTADLRW 119

Query: 118 RPILVFLTGSILLTPMLIPS-FPRK---------FLNSILLFG---LFPIFSF------F 158
           RP+L F+   + L P+L     P K         FL   LL+G     P+ +       +
Sbjct: 120 RPVLAFVLLFVALAPVLFSDKVPAKLIYFTAVYPFLMPWLLWGGTVWMPVSAALGFVLGY 179

Query: 159 VLYGGLGLSIVE------------------TSLWGGLLVTLV---------ISFFGIIIS 191
           V+Y  L  S  E                   SL+   L ++V           F G ++S
Sbjct: 180 VVYKALAQSASELIGLIVGVVAAFVWWLFVASLFSSALASVVPLALEPVESRQFGGFMLS 239

Query: 192 MPLG-----------ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFL 240
           + +G           I+LALGR S++ +++  C+ FIE  RGVPL+T+LF+AS +L +F+
Sbjct: 240 ITIGVVAIGLSLPIGIVLALGRQSDLLIVKTLCVGFIEFIRGVPLITLLFVASTLLNIFM 299

Query: 241 PDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMP 300
           P   + D ++R  + V+ FASAY+AEV+RGGL ++ KGQ+E A+SLGL+Y Q  RLIIMP
Sbjct: 300 PPGTNFDIIMRVFIMVTLFASAYMAEVIRGGLAALPKGQYEGADSLGLNYWQAQRLIIMP 359

Query: 301 QVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGF 360
           Q +K  IPGIV+TFIG+FKD++L+S+I +FD L +     +++ W   V    G  FI  
Sbjct: 360 QALKISIPGIVSTFIGVFKDTTLVSVIGLFDPLNLTNAIRADADWNGLVWELYG--FIAL 417

Query: 361 VFWIFCFSISLYSVFIEKTLHKGSK 385
           +F++FCF +S YS+++E+ L  G +
Sbjct: 418 LFFVFCFGMSRYSMYLERKLQTGHR 442


>gi|86135805|ref|ZP_01054384.1| glutamate/glutamine/aspartate/asparagine ABC transporter, permease
           protein [Roseobacter sp. MED193]
 gi|85826679|gb|EAQ46875.1| glutamate/glutamine/aspartate/asparagine ABC transporter, permease
           protein [Roseobacter sp. MED193]
          Length = 432

 Score =  223 bits (568), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 151/430 (35%), Positives = 232/430 (53%), Gaps = 62/430 (14%)

Query: 10  YVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAV 69
           +V   ++  S PP    G   W+  N F +  + +LT   + LL   +   + W+ L+ V
Sbjct: 11  FVATSVIPESPPPAGDTGAYKWVRDNLFSSIPNSILTLAALALLYSLLSNTLPWI-LNGV 69

Query: 70  WIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFG-NYPMAQRWRPILVFLTGSI 128
           W  S+   C  V  G       + AC++ + +R+ Q ++G  YP  Q WRP L  +   I
Sbjct: 70  WTTSSLAECREVLNGK------SGACFSVLSERWNQLLYGFKYPTDQYWRPNLALVLLLI 123

Query: 129 LLTPMLIPSFPRK---------FLNSILLFG---LFPIFSFF------VLYGGLG----- 165
            L P+L    PRK         FL   L++G   + PI +        V++  LG     
Sbjct: 124 ALAPVLFFDLPRKLLAFTVIYPFLAFWLIWGGTIMVPIVALIGFAVAAVVFQKLGKGSFA 183

Query: 166 ------------------------------LSIVETSLWGGLLVTLVISFFGIIISMPLG 195
                                         LS V +   GG ++ +++    + +S+PLG
Sbjct: 184 AGFFGAIVAALVIWKVGGMLIPEGASESAMLSSVPSRDLGGFMLNMMLGVTCVSLSVPLG 243

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           I LALGR S++P++++ C+ FIE  RGVPL+T+LF+AS+ML  F P    VD  LR ++ 
Sbjct: 244 IALALGRQSSMPLIKWICVVFIEFVRGVPLITLLFVASVMLSYFFPPDATVDLFLRVVIM 303

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           ++ F++AYIAEV+RGGL ++ KGQ+EAA+SLGL Y Q MRLII+PQ +K  IPGIVN  +
Sbjct: 304 ITLFSAAYIAEVIRGGLAALPKGQYEAADSLGLDYPQAMRLIILPQALKISIPGIVNVAV 363

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
           GLFKD++L+S+I+MFD++G++R     ST  + V     L F   +F++ C+ IS YS +
Sbjct: 364 GLFKDTTLVSVISMFDMVGMIRGPILASTEWNGVYWEL-LGFAAALFFVVCYGISQYSQW 422

Query: 376 IEKTLHKGSK 385
           +E+ L  G +
Sbjct: 423 LERRLATGHR 432


>gi|319940742|ref|ZP_08015083.1| polar amino acid ABC transporter [Sutterella wadsworthensis
           3_1_45B]
 gi|319805802|gb|EFW02576.1| polar amino acid ABC transporter [Sutterella wadsworthensis
           3_1_45B]
          Length = 366

 Score =  223 bits (567), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 129/358 (36%), Positives = 209/358 (58%), Gaps = 17/358 (4%)

Query: 32  IHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGW 91
           + +N F +P   +L+ ++  ++L  +  +  W  ++AVW   N   C   S         
Sbjct: 17  LRENCFYSPAASVLSVVLGLIILAVVGYVFDWGIVNAVW-DPNPAACREAS--------- 66

Query: 92  NAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFG- 150
             ACW F+ +++   IFG +P   +WRP L  L    +L    IP+   +    +LL+G 
Sbjct: 67  -GACWGFVAEKWRLIIFGRFPYELQWRPGLATLIIVGMLVVSAIPACWTRQGVRMLLWGW 125

Query: 151 LFPIFSFFVLY--GGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPV 208
           +   F+FF+L   G   L  + T +WGGL +T++I+ FG+  S PLGILLA+GR S +P+
Sbjct: 126 VAAFFAFFILMLGGVFNLEPIGTDMWGGLPLTVIITLFGMAASSPLGILLAIGRRSRMPI 185

Query: 209 LRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVL 268
           +      +IEL RGVPL+TVLF+A+ + PL LP+    D   R  +G++ F +AY+AE +
Sbjct: 186 VSALSTGYIELVRGVPLITVLFVATFVFPLLLPEWLQCDAFWRVAIGIALFQAAYMAETV 245

Query: 269 RGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIIN 328
           RGGLQ+IS+GQ+ AA SLG +  Q  + +I+PQ +  +IP  VN+ +  F D+SL+++++
Sbjct: 246 RGGLQTISQGQYAAARSLGFTERQCYQYVILPQALVAIIPAFVNSLLSCFMDTSLVTVVS 305

Query: 329 MFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
           M+DL G +++   ++ W +      G +FI  V++I  F IS YS ++E  L KG+K 
Sbjct: 306 MYDLTGSLKLALGDAVWRAYF--IEGYVFIALVYFISSFIISRYSQWLELRL-KGAKA 360


>gi|303256339|ref|ZP_07342355.1| general amino acid ABC transporter, permease protein
           [Burkholderiales bacterium 1_1_47]
 gi|330999034|ref|ZP_08322759.1| general L-amino acid transport system permease protein AapM
           [Parasutterella excrementihominis YIT 11859]
 gi|302861068|gb|EFL84143.1| general amino acid ABC transporter, permease protein
           [Burkholderiales bacterium 1_1_47]
 gi|329575776|gb|EGG57302.1| general L-amino acid transport system permease protein AapM
           [Parasutterella excrementihominis YIT 11859]
          Length = 366

 Score =  223 bits (567), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 120/301 (39%), Positives = 191/301 (63%), Gaps = 11/301 (3%)

Query: 92  NAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNS---ILL 148
           + ACW F+ +++   +FG +P  ++WR      TG ++L  ++I +FP+ +  +   IL 
Sbjct: 62  DGACWGFVAEKWRLILFGRFPYDEQWRAAAA--TGGVILM-LVISAFPQLWNRTGCKILT 118

Query: 149 FG-LFPIFSFFVLY--GGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSN 205
            G +  + +FFVL   G  GLS ++   WGGL +T++++ FG+  S PLGILLALGR S 
Sbjct: 119 AGWILALGAFFVLMLGGCFGLSKIDPDYWGGLPLTIILTLFGMTASTPLGILLALGRRSK 178

Query: 206 IPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIA 265
           +  +R  CI +IEL RGVPL+TVLF+AS + PL LP  + +D   R ++G+  F +AY+A
Sbjct: 179 MSAIRMLCIGYIELVRGVPLITVLFVASFIFPLILPPGFRIDAFWRIVIGIVLFQTAYMA 238

Query: 266 EVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLIS 325
           E +RGGLQ+I KGQ+EAA SLGLS  Q    +I+PQ +  VIP  VN  +  F D+SL++
Sbjct: 239 ETIRGGLQTIPKGQYEAAASLGLSKYQIYTSVILPQALVTVIPAFVNNLLSTFMDTSLVT 298

Query: 326 IINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSK 385
           I++M+DL G +R+   +  W +      G +FI  ++++F   +S YS+++EK + +  +
Sbjct: 299 IVSMYDLTGSLRLALGDPNWRNFF--LEGYLFIAIIYFVFSLIMSRYSIWLEKRIQRSKE 356

Query: 386 K 386
           +
Sbjct: 357 Q 357


>gi|148555537|ref|YP_001263119.1| polar amino acid ABC transporter inner membrane subunit
           [Sphingomonas wittichii RW1]
 gi|148500727|gb|ABQ68981.1| polar amino acid ABC transporter, inner membrane subunit
           [Sphingomonas wittichii RW1]
          Length = 362

 Score =  221 bits (564), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 126/349 (36%), Positives = 197/349 (56%), Gaps = 21/349 (6%)

Query: 41  KDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIY 100
            ++L TA+I+   + ++P ++ W     VW G     C               ACWAF+ 
Sbjct: 31  ANLLTTAIIVLFAIRTVPHLLSWAVTHGVWSGDG-AACREAG-----------ACWAFLR 78

Query: 101 DRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPR-KFLNSILLFGLFPIFSFFV 159
            +    +FG YP A+RWRPILV L    +L    + S PR  +  + L F  F I +  +
Sbjct: 79  AKMPFILFGIYPEAERWRPILVVL----ILGAATLWSLPRAHWTRATLAFWGFAIVASLL 134

Query: 160 LYGG--LGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFI 217
           L  G  LGLS V TS WGGL +T++++ F + +  P GI+LAL R S++PV R+     I
Sbjct: 135 LMAGGRLGLSPVPTSAWGGLPITMLLTIFSLALGFPFGIVLALARRSDMPVYRWTATALI 194

Query: 218 ELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISK 277
           E+ R +PLVT+LF+AS+M PL LP     D L RAL+     +SAYIAEV+RGGLQ +  
Sbjct: 195 EVMRAMPLVTLLFVASVMAPLLLPAGVTADNLTRALVAFVLSSSAYIAEVVRGGLQGVPP 254

Query: 278 GQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVR 337
           GQ E+A +LGL     +  II+PQ I++ +  + +T + + K+SSL+ ++ +FDLL   R
Sbjct: 255 GQRESARALGLGRSTVLLSIILPQAIRKALAPLTSTVVVIIKNSSLVLVVGLFDLLSAGR 314

Query: 338 VNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
           V+ ++  W +    T   + I  ++++ C+  + Y++ +E+T   G  +
Sbjct: 315 VSLNDPAWPTPYAET--YLVIALIYFVICYGFARYALHLERTTQGGEGR 361


>gi|163740276|ref|ZP_02147670.1| ABC glutamate/glutamine/aspartate/asparagine transporter, inner
           membrane subunit BztC [Phaeobacter gallaeciensis 2.10]
 gi|161386134|gb|EDQ10509.1| ABC glutamate/glutamine/aspartate/asparagine transporter, inner
           membrane subunit BztC [Phaeobacter gallaeciensis 2.10]
          Length = 432

 Score =  221 bits (562), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 147/430 (34%), Positives = 231/430 (53%), Gaps = 62/430 (14%)

Query: 5   CKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWV 64
            +   +VR+  + P+ PP  + G+  W+ +N F +  + +LT   + L+   +   + W+
Sbjct: 6   AQTVAFVRETQIPPAPPPGRETGVYKWVRENLFSSVPNSILTLAALALIYALLSSTLPWL 65

Query: 65  FLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFG-NYPMAQRW------ 117
            L+ VW  ++   C  V  G +       AC++ + +R+ Q ++G  YP  + W      
Sbjct: 66  -LNGVWTTNSLAECREVLDGKL------GACFSVLTERWNQLLYGFKYPGTEYWRPNLAL 118

Query: 118 ----------------RPILVFLT------------GSILLTPMLIPSFP------RKFL 143
                           R +L F              GSIL+  + +  F       +KF 
Sbjct: 119 VLLLVALAPVLFFDLPRKLLAFTAVYPFIAFWLIWGGSILVPIVALLGFVAAGFVFQKFG 178

Query: 144 NSILLFGLFPIFSFFVLYGGLG-------------LSIVETSLWGGLLVTLVISFFGIII 190
                 G F      V+   +G             LS V +   GG ++ +++    + +
Sbjct: 179 KGSFALGFFGAIVAAVVVWNIGGFLIPEGASDNAMLSAVPSRDLGGFMLNMMLGVTCVSL 238

Query: 191 SMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLL 250
           S+PLGI LALGR SN+P++++ C+ FIE  RGVPL+T+LF+AS+ML  F P    VD  L
Sbjct: 239 SVPLGIALALGRQSNMPLIKWICVVFIEFVRGVPLITLLFVASVMLSYFFPPDATVDLFL 298

Query: 251 RALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGI 310
           R ++ ++ F++AYIAEV+RGGL ++ KGQ+EAA+SLGL Y Q MRLII+PQ +K  IPGI
Sbjct: 299 RVVIMITLFSAAYIAEVIRGGLAALPKGQYEAADSLGLDYPQAMRLIILPQALKISIPGI 358

Query: 311 VNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSIS 370
           VN  +GLFKD++L+S+I+MFDL+G++R     ST  + V     L F  F+F+I C+ IS
Sbjct: 359 VNVAVGLFKDTTLVSVISMFDLVGMIRGPILASTEWNGVYWEL-LGFAAFLFFIVCYGIS 417

Query: 371 LYSVFIEKTL 380
            YS ++E+ L
Sbjct: 418 QYSQWLERRL 427


>gi|110347223|ref|YP_666041.1| polar amino acid ABC transporter, inner membrane subunit
           [Mesorhizobium sp. BNC1]
 gi|110283334|gb|ABG61394.1| amino acid ABC transporter membrane protein 2, PAAT family
           [Chelativorans sp. BNC1]
          Length = 362

 Score =  221 bits (562), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 138/352 (39%), Positives = 215/352 (61%), Gaps = 19/352 (5%)

Query: 36  FFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAAC 95
           FFGTP +  LT +++ L+      ++ W  L A    +    C           G   AC
Sbjct: 27  FFGTPLNAALTVVLLWLMARFGWLLLDWAVLKAAIFPAEPETCV----------GKTGAC 76

Query: 96  WAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSI-LLFGLFPI 154
           W+F+  +  Q +FG YP  +RWR  LV +   +++T ++  + P  +  S+ L++    +
Sbjct: 77  WSFVIAKSGQILFGIYPPTERWRAGLVCV---LIITTLVASARPSAWRPSLGLVWVAMMV 133

Query: 155 FSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACI 214
              +++ GG GL+ V TS WGGL VTL+++ F I +  P  ILLALGR SN+PV+R   +
Sbjct: 134 VVLWLMGGGFGLAAVPTSSWGGLPVTLILTVFAIGLGFPAAILLALGRRSNLPVVRTLSV 193

Query: 215 TFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQS 274
            FIE  RG+PL+++L +ASI+LPLFLP+    DK +RAL+ ++ FA+AY+AEVLRGGLQS
Sbjct: 194 LFIETIRGLPLLSLLLVASILLPLFLPEALLPDKFVRALIALTIFAAAYLAEVLRGGLQS 253

Query: 275 ISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLG 334
           I  GQ EAA +LGL Y +  RLII+PQ I+ VIP + NT I + K++SL+ ++ +FDL+ 
Sbjct: 254 IPSGQSEAAEALGLGYWKTQRLIILPQAIRIVIPALTNTIIVMIKNTSLVLVVGLFDLIS 313

Query: 335 IVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
             +   S+  W +  T T   +FIG +++   FS + ++ F+E++   G++K
Sbjct: 314 SGKAALSDPAWPAPSTET--FLFIGLIYFALAFSFARFADFLERS---GAEK 360


>gi|163793104|ref|ZP_02187080.1| amino acid ABC transporter, permease protein [alpha proteobacterium
           BAL199]
 gi|159181750|gb|EDP66262.1| amino acid ABC transporter, permease protein [alpha proteobacterium
           BAL199]
          Length = 449

 Score =  220 bits (561), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 111/229 (48%), Positives = 163/229 (71%), Gaps = 2/229 (0%)

Query: 158 FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFI 217
           F+      L+ V+T+ WGGL +TLVIS  GI  ++P G++LALGR S +PV+R  C  FI
Sbjct: 222 FIFQSTWNLAPVQTTNWGGLFLTLVISGIGISTALPSGVILALGRRSKMPVIRVFCTAFI 281

Query: 218 ELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISK 277
           ELFR VPL+T+LFMA  M+PLFLP T + DKL+  ++ V  FA+AY+AE++RGGLQ+I+ 
Sbjct: 282 ELFRSVPLITILFMAVTMMPLFLPVTLNPDKLVLVIVAVCIFAAAYMAEIVRGGLQAINT 341

Query: 278 GQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVR 337
           GQ+EAA ++GL+Y + M LI+MPQ +K +IP IV  FIGL KD++L+SII ++D+L +VR
Sbjct: 342 GQYEAARAVGLNYWKMMTLIVMPQALKLMIPNIVGNFIGLLKDTTLVSIIGLYDILLMVR 401

Query: 338 VNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
            +  +  W+     T  ++F  FVF++ CF++S YS  +E+T+  G  +
Sbjct: 402 ASGQDPKWLG--MHTEPMLFAAFVFFVICFAMSKYSQHLERTIGGGYGR 448



 Score = 67.4 bits (163), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 41/138 (29%), Positives = 67/138 (48%), Gaps = 12/138 (8%)

Query: 27  GIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGI 86
           G++ W+ KN FG P D ++T +   LL +   G+  +  ++AVW   +   C  V+QG  
Sbjct: 25  GVVGWLRKNLFGGPFDSVMTIIGAGLLAYFAYGLFQYTIVNAVWEADSYRECLDVTQGA- 83

Query: 87  QPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSI 146
                  ACWA +      +++G YP A++WR  L    G I+L   L P +  K    I
Sbjct: 84  ------GACWAGVDKWMNNYLYGRYPDAEQWRVNL----GGIILAVWLAPFWFEKVTQKI 133

Query: 147 LLFGLFPIFSFFVLYGGL 164
            + G+  + ++  L G L
Sbjct: 134 AV-GVSAVLTYPFLAGAL 150


>gi|282899901|ref|ZP_06307862.1| Amino acid ABC transporter, permease protein, 3- TM region protein,
           His/Glu/Gln/Arg/opine [Cylindrospermopsis raciborskii
           CS-505]
 gi|281195171|gb|EFA70107.1| Amino acid ABC transporter, permease protein, 3- TM region protein,
           His/Glu/Gln/Arg/opine [Cylindrospermopsis raciborskii
           CS-505]
          Length = 340

 Score =  220 bits (561), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 142/375 (37%), Positives = 211/375 (56%), Gaps = 69/375 (18%)

Query: 31  WIHKNFFGTPKDILLTALIICLL-LFSI-PGIIHWVFLDAVWIGSNRTVCTTVSQGGIQP 88
           W+ KN F    + +LT  I+C++ LFS+  G++ W+F                       
Sbjct: 6   WLRKNLFNNWYNGVLT--IVCVIGLFSLGRGVLFWIF----------------------- 40

Query: 89  DGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSI-------------------- 128
              N A W  +      F+ G +P +  WR  L  +  SI                    
Sbjct: 41  ---NQAKWQVVTVNIHLFLVGRFPRSLYWRIWLALVINSIVGLITWHGLMQKYHLPKNQL 97

Query: 129 ------LLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLV 182
                 L+ P+L P +   F+ +I L G           GG GL  V T+LW GLL+TL+
Sbjct: 98  LQKAYQLIRPLLAPIWLLTFIITIWLLG-----------GGFGLQSVPTNLWNGLLLTLL 146

Query: 183 ISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPD 242
           ++F  I +S PLG+LLALGRNS +PV+R+  I +IEL RG+PL+ +LF+A +MLPLFLP 
Sbjct: 147 MAFVSIALSFPLGVLLALGRNSELPVIRWFSILYIELVRGLPLIGILFIAQVMLPLFLPA 206

Query: 243 TWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQV 302
            W +D+L+R + G+  F++AY+AE +RGGLQSI KGQFEAA +LGL+    + L+++PQ 
Sbjct: 207 DWRLDRLVRGVAGLVLFSAAYMAENVRGGLQSIPKGQFEAARALGLNTFLLLILVVLPQA 266

Query: 303 IKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVF 362
           ++ VIP IV  FIGLFKD+SL+S++ + +L GI R   ++  ++         IFIG V+
Sbjct: 267 LRAVIPTIVGQFIGLFKDTSLLSLVGLVELTGIARSILAQPQFLGRYMEVY--IFIGAVY 324

Query: 363 WIFCFSISLYSVFIE 377
           W+FC+S+SL +  +E
Sbjct: 325 WLFCYSMSLAARRLE 339


>gi|126731769|ref|ZP_01747573.1| probable ABC transporter permease protein [Sagittula stellata E-37]
 gi|126707596|gb|EBA06658.1| probable ABC transporter permease protein [Sagittula stellata E-37]
          Length = 364

 Score =  219 bits (559), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 129/359 (35%), Positives = 211/359 (58%), Gaps = 24/359 (6%)

Query: 31  WIHKNFFGT-PKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPD 89
           W+ KN F + P+ IL   +  CL  F+   +++W  LDAV+   +  VC   +       
Sbjct: 22  WMKKNLFNSIPQGILTVFVAACLARFAW-FVLNWGVLDAVFYTDDPDVCRAAA------- 73

Query: 90  GWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPR----KFLNS 145
               ACWA I +++   +FG YP  ++WR +++    +I L  +++   PR    KFL  
Sbjct: 74  ---GACWAVIVEKHRPMLFGLYPYDEQWRLVIMM---AIYLVTVVVSLMPRFWNLKFLVP 127

Query: 146 ILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNS 204
           + +F +  IF+  +L+GG+ G+  V ++ WGGL +T+++    ++I MP+ +LLALGR S
Sbjct: 128 LWIFSVVSIFT--LLFGGVFGMPFVPSTDWGGLPLTMILFSGTVLIGMPVAVLLALGRRS 185

Query: 205 NIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYI 264
            +PV +   + FIE  RGVPL+T+LF+A  + PLFLP   +V+KLLR  +G++ F + Y 
Sbjct: 186 PLPVAKGVSVVFIEALRGVPLITILFVAVNVFPLFLPAGVEVNKLLRITVGIAVFFACYQ 245

Query: 265 AEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLI 324
           AEV+RGGLQ+I  GQ+EAA+SL L+Y Q  R II+PQ ++  +P I N  I   K++S +
Sbjct: 246 AEVIRGGLQAIPTGQYEAADSLNLTYWQTTRRIILPQALRISLPAITNHIIAAMKNTSFV 305

Query: 325 SIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKG 383
            II +FD+L        +  W          +F+  ++  F +++SLY+  +EK +++G
Sbjct: 306 IIIGLFDILTATTAVMQDPLWRRYY--VEAYLFVAAIYLFFGYALSLYARQVEKWINQG 362


>gi|222102265|ref|YP_002546855.1| ABC-type amino acid transport system, permease component
           [Agrobacterium radiobacter K84]
 gi|221728382|gb|ACM31391.1| ABC-type amino acid transport system, permease component
           [Agrobacterium radiobacter K84]
          Length = 356

 Score =  217 bits (553), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 125/367 (34%), Positives = 209/367 (56%), Gaps = 20/367 (5%)

Query: 25  QRGIIAW----IHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTT 80
           Q G+  W    + K       + ++T   + +L++ +  ++ W    A+W G+    C+ 
Sbjct: 5   QIGLSKWRRRPVTKGLLDNRSNTIITICSLAILVWMVTPLLRWAGRAAIWSGTGSD-CSV 63

Query: 81  VSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPR 140
              G         ACWAFI  ++   IFG YP A +WRP L      +LL+   I + PR
Sbjct: 64  EGAG---------ACWAFIAAKFRFIIFGFYPPALQWRPALAMFCICVLLS---ISANPR 111

Query: 141 KFLNSILLFGLFPIFSFFVLYGGLGLSI-VETSLWGGLLVTLVISFFGIIISMPLGILLA 199
            + + +L+     I   ++L  G+ ++  + T+ WGGL +TL++S  G+  + P+ +LLA
Sbjct: 112 YWGSKLLISWPVVILLLWLLMAGILVAPPIPTNQWGGLPITLIVSVIGLATAFPIALLLA 171

Query: 200 LGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAF 259
           L R S++ +LR   + FIE  RG+PL+ VL++A +++P+ LP    +DKLLRA +G++ F
Sbjct: 172 LARRSSMGILRTLAVAFIECLRGIPLIAVLYIAMLIIPMALPSEATLDKLLRAQIGITLF 231

Query: 260 ASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFK 319
            SAY+AEV+R GLQSI  GQ EAA SLG  Y +  +L+++PQ ++ VIP IVN  IG+  
Sbjct: 232 VSAYLAEVIRAGLQSIPAGQLEAAYSLGFGYWRTTQLVVLPQALRAVIPAIVNLSIGILL 291

Query: 320 DSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKT 379
           ++SL+++I + DLL   ++  ++  W+     T   +F G +++   F  S YS+++E+ 
Sbjct: 292 NTSLLAVIGISDLLNTGKIAATDPVWLGFY--TEAFVFTGAIYFAISFVASRYSLWLERR 349

Query: 380 LHKGSKK 386
           L  G   
Sbjct: 350 LAAGRNH 356


>gi|308126408|ref|ZP_07663750.1| general L-amino acid transport system permease protein AapM [Vibrio
           parahaemolyticus AQ4037]
 gi|308108543|gb|EFO46083.1| general L-amino acid transport system permease protein AapM [Vibrio
           parahaemolyticus AQ4037]
          Length = 262

 Score =  216 bits (549), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 109/253 (43%), Positives = 164/253 (64%), Gaps = 13/253 (5%)

Query: 17  QPSLPPVYQR-GIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNR 75
           QP LPP     G++ W+ KN F  P + ++T ++  ++  ++  I+ W F++A WIGS R
Sbjct: 7   QPDLPPPSNTVGVVGWLRKNLFNGPVNSIVTLILAYIVFNALWHIVDWAFINADWIGSTR 66

Query: 76  TVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLI 135
             C+              ACW FI  R+EQF++G YP A+ WRP L ++T +I    +  
Sbjct: 67  DDCSR-----------EGACWVFISVRWEQFMYGFYPEAELWRPRLFYITLAIFTVLLAY 115

Query: 136 PSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPL 194
              P++    +    ++P     +LYGG+ GL +VET  WGGLLVTL+I+  GI++S+P+
Sbjct: 116 EKTPKRLWIWLFFVNIYPFIVAALLYGGVFGLEVVETHKWGGLLVTLIIALVGIVVSLPI 175

Query: 195 GILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALL 254
           G+ LALGR S++P++R  C  +IE++RGVPL+TVLFMAS+MLPLFL +  + DKL+RAL+
Sbjct: 176 GVALALGRRSDMPIIRSICTIYIEVWRGVPLITVLFMASVMLPLFLAEGSETDKLIRALI 235

Query: 255 GVSAFASAYIAEV 267
           GV  F++AY+AEV
Sbjct: 236 GVVMFSAAYMAEV 248


>gi|126736640|ref|ZP_01752380.1| amino acid ABC transporter, permease protein [Roseobacter sp. CCS2]
 gi|126713953|gb|EBA10824.1| amino acid ABC transporter, permease protein [Roseobacter sp. CCS2]
          Length = 432

 Score =  216 bits (549), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 137/418 (32%), Positives = 224/418 (53%), Gaps = 68/418 (16%)

Query: 25  QRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQG 84
           + G++ W+ +N F +    +LT + + ++   +  +  W+  + +W   +   C T    
Sbjct: 26  ETGMVKWMQQNLFSSIPSSILTLVSLYVIYLLVAFVAPWM-ANGIWNTDSLAECRTAL-- 82

Query: 85  GIQPDGWNAACWAFIYDRYEQFIFG-NYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFL 143
               DG   AC++ I +R+ Q +FG +YP    WRP L F+   +   P++    PRK L
Sbjct: 83  ----DGATGACFSVISERWNQLLFGFSYPTEFYWRPGLAFILLFVAAAPVMFFDLPRKML 138

Query: 144 NSILLFGLFPIFSFFVLYGG------LGLSIV---------------ETSLWGGLLVTLV 182
              +  GL+P  +F++++GG        L+ V                   +GG++   +
Sbjct: 139 ---IFTGLYPFIAFWLIWGGTIYTPLFALAGVVVGYLVYSRYVKDSFAMGFFGGVIAAFI 195

Query: 183 ISFFG---------------------------------IIISMPL--GILLALGRNSNIP 207
             F G                                 + +S+ L  GI+LALGR S++P
Sbjct: 196 TWFIGGYIVDAIAPAEPFLEAVASRNMGGFMLNMILGVVCVSLSLPLGIVLALGRQSDMP 255

Query: 208 VLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEV 267
           ++++ C+ FIE  RGVPL+T+LF+A+++L  FLP     D +LR ++ ++ F++AYIAEV
Sbjct: 256 IIKWICVVFIEFIRGVPLITLLFVANVVLAFFLPPGTTFDLILRVIIMITMFSAAYIAEV 315

Query: 268 LRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISII 327
           +RGGL ++ KGQ+EAA+SLGL Y Q MRLII+PQ +K  IPGIVN  +GLFKD+ L+S+I
Sbjct: 316 IRGGLAALPKGQYEAADSLGLDYAQAMRLIILPQALKISIPGIVNVAVGLFKDTVLVSVI 375

Query: 328 NMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSK 385
           +MFDLLG++R     ST  + V      +    +F++ C+ IS YS ++E+ L    +
Sbjct: 376 SMFDLLGMIRGPILSSTEWNGVYWEL-FMAASVLFFVVCYGISQYSQWLERRLATDHR 432


>gi|99080137|ref|YP_612291.1| amino acid ABC transporter permease [Ruegeria sp. TM1040]
 gi|99036417|gb|ABF63029.1| Amino acid ABC transporter permease protein 3-TM region
           His/Glu/Gln/Arg/opine [Ruegeria sp. TM1040]
          Length = 442

 Score =  214 bits (546), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 146/448 (32%), Positives = 236/448 (52%), Gaps = 75/448 (16%)

Query: 6   KEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVF 65
            +  +VR  +L P  PP  + G++ W+  N F    + +LT + +  ++  + G+I W +
Sbjct: 2   SDISFVRTEMLPPKEPPASEVGVLGWMRANLFSNWFNSVLTLVSLYFVIQILIGLITWAW 61

Query: 66  LDAVWIGSNRTVCTTVSQGGIQPDGWNA-ACWAFIYDRYEQFIFGNYPMAQ-------RW 117
           +   W   +   C  + +  +   G NA ACW  I +R+ Q +FG YP          RW
Sbjct: 62  VP-TWSAGSLPECRVIFE-ELGRTGHNAGACWGVIAERWPQLLFGFYPNGSEPGTADLRW 119

Query: 118 RPILVFLTGSILLTPMLIPSFPRKFLNSILLF-GLFPIFSFFVLYGG------------- 163
           RP+L FL   + L P+L   F  K    ++ F   +P    ++L+GG             
Sbjct: 120 RPVLAFLLLFVALAPVL---FADKVPAKLIYFSAAYPFLMPWLLWGGTVWTPVMIAAGFV 176

Query: 164 ----------------LGL--SIVETSLWGGLLVTLVIS-----------------FFGI 188
                           +GL   +V   +W   + + + S                 F G 
Sbjct: 177 VGYFVYKAVSQATSELIGLISGVVGAVVWWLFVASFIASVLAGIVPLALESVESRQFGGF 236

Query: 189 IISMPLGI-----------LLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLP 237
           ++S+ +G+           +LALGR S++ +++  C+ FIE  RGVPL+T+LF+AS +L 
Sbjct: 237 MLSILIGVVAIGLSLPIGIVLALGRQSDLLIVKTLCVGFIEFIRGVPLITLLFVASTLLN 296

Query: 238 LFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLI 297
           +F+P   + D ++R  + V+ FASAY+AEV+RGGL ++ KGQ+E A+SLGL+Y Q  RLI
Sbjct: 297 IFMPPGTNFDIIMRVFIMVTLFASAYMAEVIRGGLAALPKGQYEGADSLGLNYWQAQRLI 356

Query: 298 IMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIF 357
           IMPQ +K  IPGIV+TFIG+FKD++L+S+I +FD L +     +++ W   V    G  F
Sbjct: 357 IMPQALKISIPGIVSTFIGVFKDTTLVSVIGLFDPLNLTNAIRADANWNGLVWELYG--F 414

Query: 358 IGFVFWIFCFSISLYSVFIEKTLHKGSK 385
           I  +F++FCF +S YS+++E+ L  G +
Sbjct: 415 IALLFFVFCFGMSRYSMYLERKLQTGHR 442


>gi|152998088|ref|YP_001342923.1| polar amino acid ABC transporter inner membrane subunit
           [Marinomonas sp. MWYL1]
 gi|150839012|gb|ABR72988.1| polar amino acid ABC transporter, inner membrane subunit
           [Marinomonas sp. MWYL1]
          Length = 372

 Score =  214 bits (544), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 119/366 (32%), Positives = 205/366 (56%), Gaps = 16/366 (4%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
           + ++P  + R ++ WI +N F T  D ++T  +I LL   +P  + W+F  A + G+NR 
Sbjct: 20  KKAIPFSFSR-VMVWIKRNLFNTWLDSVVTLALIALLCLLLPKALDWLFFSATFSGTNRA 78

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            C              AACW  I    + +I+G +P +++WR    F  G      +   
Sbjct: 79  DCAP-----------GAACWIPIRQYMDYYIYGPFPESEQWRVNSAFAVGLFAFPLLFSQ 127

Query: 137 SFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGI 196
             P+K++ + +L     +  + +L GG     + TS  GGL +T  +    + +S+P+ I
Sbjct: 128 RIPQKWIVAYILVLP--VVLWLLLKGGFIFEDISTSALGGLTLTFFLGIIAMCLSLPVSI 185

Query: 197 LLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGV 256
           LLALGR S +P+LR+AC  +IE+ R VP++T LFMAS++L LFLP    +D L R L  +
Sbjct: 186 LLALGRQSQLPILRWACTGYIEIIRSVPVITFLFMASLVLQLFLPSGVSIDVLFRVLFVL 245

Query: 257 SAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIG 316
              ++ Y AE++RG +Q++ KGQ EA+ ++G  Y + M  ++MPQ ++  +P ++  FIG
Sbjct: 246 IFVSAVYKAEIIRGAIQAVPKGQIEASYAMGCGYWKTMAYVVMPQALRNSVPALITNFIG 305

Query: 317 LFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFI 376
           LFK+++L+ I+ + +++G +   F  + W+       G I I   F+I CFSI+ Y  ++
Sbjct: 306 LFKETTLVMILGLLEVMGAINATFHNAEWLG--LHAEGPIVISAFFFIACFSIAQYGAYL 363

Query: 377 EKTLHK 382
           E+ + +
Sbjct: 364 ERRIKR 369


>gi|160899041|ref|YP_001564623.1| polar amino acid ABC transporter inner membrane protein [Delftia
           acidovorans SPH-1]
 gi|160364625|gb|ABX36238.1| polar amino acid ABC transporter, inner membrane subunit [Delftia
           acidovorans SPH-1]
          Length = 360

 Score =  213 bits (542), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 114/321 (35%), Positives = 187/321 (58%), Gaps = 18/321 (5%)

Query: 60  IIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRP 119
           ++ W  LDA    +N   C   +           ACW  + D+Y     G YPMA++WRP
Sbjct: 51  LLAWGLLDAE-TAANPNTCRAAA----------GACWGVVRDKYRLVFLGRYPMAEQWRP 99

Query: 120 ILVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGG--LGLSIVETSLWGGL 177
           +   L   +LL  + + + PR F  + +   L  +  F VL  G   GL+ V + LWGGL
Sbjct: 100 VAASL---LLLGSVGVAALPRFFGRAGMAMLLAGLTGFGVLMAGGVAGLAPVPSDLWGGL 156

Query: 178 LVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLP 237
            +TL ++    +  +PLGILLALGR S++P++R  C  FIE  RGVPL+T+LF  + +LP
Sbjct: 157 PLTLFLAVIACLAGVPLGILLALGRRSSLPLIRILCTGFIEAVRGVPLITLLFFGAFVLP 216

Query: 238 LFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLI 297
           + +P  W VD ++R  + ++AF++AY+AEV RGGLQ++ +GQ  AA ++G + +Q +R +
Sbjct: 217 MLVPAQWRVDPMVRIAVCLAAFSAAYLAEVFRGGLQAVPQGQVMAAQAMGFTRVQVLRHV 276

Query: 298 IMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIF 357
           ++PQ ++  I   V+ FIG  KD+SL++I+N++D+ G +++  S+  WI+        + 
Sbjct: 277 VLPQALRVTIAPTVSNFIGAVKDTSLVAIVNIYDITGSLKMAMSDPHWIAYFVEM--YMV 334

Query: 358 IGFVFWIFCFSISLYSVFIEK 378
           +  V+ +    I+ Y  F+E 
Sbjct: 335 VCTVYLLIGLGIARYGRFLES 355


>gi|156741440|ref|YP_001431569.1| polar amino acid ABC transporter inner membrane subunit
           [Roseiflexus castenholzii DSM 13941]
 gi|156232768|gb|ABU57551.1| polar amino acid ABC transporter, inner membrane subunit
           [Roseiflexus castenholzii DSM 13941]
          Length = 403

 Score =  209 bits (533), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 147/391 (37%), Positives = 219/391 (56%), Gaps = 33/391 (8%)

Query: 21  PPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVW-IGSNRTVCT 79
           PP  +  ++ W+HKN F T  + LLT +++ L  F + GI+ W    A W + S      
Sbjct: 17  PPTERYSVVRWMHKNLFSTWYNTLLTIIMLALTAFLVRGILEWALTQARWEVISANLRLF 76

Query: 80  TVSQGGIQPDGWNAACWAF----------IYDRYEQ---FIFGNYP------MAQRWRPI 120
            V Q  +       AC A           I+ R ++     FG  P       +     +
Sbjct: 77  LVGQYPVTALWRIWACVALLAFLIGMSWGIWGRTQRGGAIAFGALPFILAITTSDETSRV 136

Query: 121 LVFLTGSILLTPMLIPSFPRKFLNSILLFG---LFPIFSFFVLYGGLG-----LSIVETS 172
            + +TG   +    +       L  + + G    FPI   FVL  G G     L  V T+
Sbjct: 137 ALLITGIAGVVGYTLSWRWSGALRRVSIIGWILYFPIL--FVLVSGFGAADSVLPPVPTN 194

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
           LWGGLL+TL+++  GI++S PLG+LLALGR S +PV+ + C+ +IEL RGVP ++VLFMA
Sbjct: 195 LWGGLLLTLLLTVVGIVLSFPLGVLLALGRQSKLPVIHWLCVIYIELIRGVPFISVLFMA 254

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
            +MLPLFLP    +D+++RA+ GV  F++AY+AE +RGGLQSI +GQ+EAA +LGLS  +
Sbjct: 255 QLMLPLFLPGV-TIDRVVRAMAGVIIFSAAYLAENVRGGLQSIPRGQYEAARALGLSAWK 313

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPT 352
              LII+PQ ++ VIP +V  FI LFKD+SL+ I+ + DL+GI R   ++  ++      
Sbjct: 314 MTLLIILPQALRAVIPILVGQFIALFKDTSLVVIVGLLDLMGIARTVLAQPDFLGLQAEV 373

Query: 353 TGLIFIGFVFWIFCFSISLYSVFIEKTLHKG 383
               F+ FV+ +FC+ +S +S  +E  LH G
Sbjct: 374 --YTFVAFVYGVFCYLMSAFSQRLEAQLHTG 402


>gi|261823406|ref|YP_003261512.1| polar amino acid ABC transporter inner membrane protein
           [Pectobacterium wasabiae WPP163]
 gi|261607419|gb|ACX89905.1| polar amino acid ABC transporter, inner membrane subunit
           [Pectobacterium wasabiae WPP163]
          Length = 369

 Score =  209 bits (532), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 132/363 (36%), Positives = 207/363 (57%), Gaps = 20/363 (5%)

Query: 22  PVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTV 81
           P   R  + W+H++ F +    +LT L++ L+      ++HW  LDAVW  ++  VC   
Sbjct: 12  PSRLRTPLLWMHRHLFSSMPQTILTLLLVVLMWIIGNKLLHWGILDAVWYTTDPDVCRAA 71

Query: 82  SQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRK 141
           +           ACWA I +++   +FG YP  + WR +L      + L   L+P    +
Sbjct: 72  A----------GACWAVIVEKHRPILFGLYPYDEHWRLVLAMGIWFLALGLSLMP----R 117

Query: 142 FLNSILLFGLFPIFSFFV---LYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPLGIL 197
           F +S +L  L+ I    +   + GGL GLS V +S WGGL +T+++    ++I MP+ IL
Sbjct: 118 FWHSRILLPLWIIAVVAIAILMSGGLFGLSYVPSSEWGGLPLTILLFSGTVVIGMPVSIL 177

Query: 198 LALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVS 257
           LALGR S +P LR   + FIE  RGVPL+T+LF+A  + PLFLP   +++KLLR ++G++
Sbjct: 178 LALGRRSPLPFLRGLSVVFIEGLRGVPLITILFVAVNVFPLFLPAGMEINKLLRIIIGIA 237

Query: 258 AFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGL 317
            F + Y AEV+RGGLQS+ +GQ+EAA +L LSY      II+PQ ++  +P + N  I  
Sbjct: 238 LFFACYQAEVIRGGLQSVPRGQYEAAMALNLSYWHTTTKIILPQALRICLPAMTNHIIAA 297

Query: 318 FKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIE 377
            K++S + II +FD+L        +  W      T   IFI  ++ +F F +S Y++++E
Sbjct: 298 MKNTSFVIIIGLFDILTATSSVMQDPLWRRYYIET--YIFISAIYLLFGFLLSRYALWVE 355

Query: 378 KTL 380
           K +
Sbjct: 356 KRI 358


>gi|282897628|ref|ZP_06305628.1| Amino acid ABC transporter, permease protein, 3- TM region protein,
           His/Glu/Gln/Arg/opine [Raphidiopsis brookii D9]
 gi|281197551|gb|EFA72447.1| Amino acid ABC transporter, permease protein, 3- TM region protein,
           His/Glu/Gln/Arg/opine [Raphidiopsis brookii D9]
          Length = 343

 Score =  207 bits (526), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 142/354 (40%), Positives = 216/354 (61%), Gaps = 27/354 (7%)

Query: 31  WIHKNFFGTPKDILLTALIICLL-LFSI-PGIIHWVFLDAVWIGSNRTVCTTVSQGGIQP 88
           W+ KN F    + +LT  I+C++ LFS+  GI+ W+F  A W      +    S   I P
Sbjct: 9   WLRKNLFNNWYNGVLT--IVCVIVLFSLGKGILFWIFNQAKWEVVTANIHFIFSWQ-IPP 65

Query: 89  DGWNAACWAF---IYDRYEQFIF--GNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFL 143
               A   +F    Y R +  ++    Y + +      +      L+ P+L P +   F 
Sbjct: 66  GFILANLASFGNQFYYRVDNLVWVDAKYHLPEN----QLLQKAYQLIVPLLAPIWFLTF- 120

Query: 144 NSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRN 203
                     I + ++L GGLGL  V T+LW GLL+TL+++F  I++S PLG+LLALGRN
Sbjct: 121 ----------IITIWLLGGGLGLQSVPTNLWNGLLLTLLMAFVSIVLSFPLGVLLALGRN 170

Query: 204 SNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAY 263
           S +PV+R+  I +IEL RG+PL+ +LF+A +MLPLFLPD W +D+L+R + G+  F++AY
Sbjct: 171 SELPVIRWFSILYIELVRGLPLIGILFIAQVMLPLFLPDNWRLDRLVRGVAGLVLFSAAY 230

Query: 264 IAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSL 323
           +AE +RGGLQSI +GQFEAA +LGL+    + L+I+PQ ++ VIP IV  FIGLFKD+SL
Sbjct: 231 MAENVRGGLQSIPRGQFEAARALGLNTFLLLILVILPQALRAVIPTIVGQFIGLFKDTSL 290

Query: 324 ISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIE 377
           +S++ + +L GI R   ++  ++         IFIG ++W+FC+S+SL +  +E
Sbjct: 291 LSLVGLVELTGIARSILAQPQFLGRYMEVY--IFIGVIYWVFCYSMSLIARELE 342


>gi|319793874|ref|YP_004155514.1| polar amino acid ABC transporter, inner membrane subunit
           [Variovorax paradoxus EPS]
 gi|315596337|gb|ADU37403.1| polar amino acid ABC transporter, inner membrane subunit
           [Variovorax paradoxus EPS]
          Length = 352

 Score =  206 bits (525), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 126/357 (35%), Positives = 208/357 (58%), Gaps = 17/357 (4%)

Query: 26  RGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGG 85
           +G IAW     +G+P   L T L+I +L +    I  W  + AV   ++   C  V  G 
Sbjct: 6   QGPIAW-RSELWGSPLRALATVLLIAVLAWIGFHIFEWAVVHAV-FRADAEACRAVQHG- 62

Query: 86  IQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNS 145
                   ACW  + +++   +FG +P  ++WRP +  +   +L    ++ ++PR +   
Sbjct: 63  --------ACWGVVAEKWRPMLFGRFPYEEQWRPAIAVV---VLSAVTVLSAWPRSWRWW 111

Query: 146 IL-LFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRN 203
           ++ L+ +  +    ++ GG +GLS V TS WGGL +T+ ++  G+ ++ PL +LLALGR 
Sbjct: 112 LVPLWVVALVLFVLLMRGGVMGLSHVPTSRWGGLPLTIGLAVVGLALAFPLALLLALGRR 171

Query: 204 SNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAY 263
           S  PV+R    ++IEL RGVPL++VLFMAS +LPL  P  W  D L+R L G++ F +AY
Sbjct: 172 SGWPVVRTLSASYIELVRGVPLISVLFMASFLLPLLWPAGWQPDVLVRVLAGLTLFVAAY 231

Query: 264 IAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSL 323
           +AE++RGGLQ++ +GQ E A +LG       R I++PQ ++ V+P + N+ +G  KD+SL
Sbjct: 232 LAEIIRGGLQAVPRGQTEVAMALGFGRWPVQRDIVLPQALRLVVPALTNSVVGTLKDTSL 291

Query: 324 ISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTL 380
           ++++ +F+L G + +       I       G +FI  V+W+ CF +S YSV++E+ L
Sbjct: 292 VTVVGLFELTGALGLALGGDP-IWRPFYLEGYLFIAAVYWVLCFGLSRYSVWLERRL 347


>gi|75906961|ref|YP_321257.1| amino acid ABC transporter permease [Anabaena variabilis ATCC
           29413]
 gi|75700686|gb|ABA20362.1| neutral amino acid ABC transporter membrane protein / L-glutamate
           ABC transporter membrane protein / L-aspartate ABC
           transporter membrane protein [Anabaena variabilis ATCC
           29413]
          Length = 381

 Score =  206 bits (524), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 138/381 (36%), Positives = 216/381 (56%), Gaps = 30/381 (7%)

Query: 29  IAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQP 88
           + W+ KN F T  + LLT +   LLL+ + GI+ W    A W      +   +     Q 
Sbjct: 4   LTWLRKNLFSTWYNSLLTVICSALLLWLVQGIVIWATTKAQWAVVQVNLRLFLVGRFPQT 63

Query: 89  DGWNAACWAFIYDRYEQFIFGNYPMAQR--WRPI--LVFLTGSILLTPML---------- 134
           + W       I         G +   Q+  WR +    F+ G +L+   L          
Sbjct: 64  EYWRVWIVLAIASTLGAVTAGVFFNQQKLTWRKVGLFAFIVGLLLVLFPLDLSSRLWLLL 123

Query: 135 -----IPSF--PRKFLN------SILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTL 181
                IP F    K  N      S++    FPI   +++ GG GL  V ++LW GLL+TL
Sbjct: 124 TAILLIPGFILGSKLTNLVAPWLSLIWLLSFPII-LWLIGGGFGLRPVSSNLWNGLLLTL 182

Query: 182 VISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLP 241
           +++   I++S P+G+LLALGR SN+PV+R+  I +IE+ RGVPL+ +LF+A +MLPLF  
Sbjct: 183 LMAAISIVLSFPIGVLLALGRTSNLPVVRWFSILYIEIIRGVPLIGILFLAQVMLPLFFA 242

Query: 242 DTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQ 301
               +D++LRA+ G+  F++AY+AE +RGGLQ++S+GQ EAA +LGL+    + LI++PQ
Sbjct: 243 ADVRLDRVLRAIAGLVLFSAAYMAENVRGGLQAVSRGQVEAAKALGLNTFFVVLLIVLPQ 302

Query: 302 VIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFV 361
            ++ VIP +V  FIGLFKD+SL+S++ + +L GI R   ++  +I         +FIG +
Sbjct: 303 ALRAVIPAVVGQFIGLFKDTSLLSLVGLVELTGIARSILAQPQFIGRYAEVY--LFIGLI 360

Query: 362 FWIFCFSISLYSVFIEKTLHK 382
           +W+FC+S+SL S  +E+ L+ 
Sbjct: 361 YWLFCYSMSLASRRLERQLNN 381


>gi|254454563|ref|ZP_05068000.1| polar amino acid ABC transport permease protein AapM-1
           [Octadecabacter antarcticus 238]
 gi|198268969|gb|EDY93239.1| polar amino acid ABC transport permease protein AapM-1
           [Octadecabacter antarcticus 238]
          Length = 775

 Score =  205 bits (521), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 109/237 (45%), Positives = 161/237 (67%), Gaps = 12/237 (5%)

Query: 154 IFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYAC 213
           I   +V  G +GL  +++   GG ++ L+I   GI++S+PLGILLALGR S++ ++   C
Sbjct: 546 IADTYVELGRVGLRPIDSRDIGGFMLALIIGIAGIVLSLPLGILLALGRQSHLFIVNKIC 605

Query: 214 ITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQ 273
           +TFIE+ RGVPL+  LF  S++L  FLP   + D LLR ++ V+ FA+AYIAEV+RGGL 
Sbjct: 606 VTFIEVIRGVPLIVWLFTGSLLLNYFLPPGTNFDLLLRVIIMVTLFAAAYIAEVIRGGLA 665

Query: 274 SISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLL 333
           +++ GQ+E A+SLGLSY Q MRLI++PQ +K  IPGIVNTFIGLFKD++L+  I + D +
Sbjct: 666 ALATGQYEGADSLGLSYWQSMRLIVLPQAMKISIPGIVNTFIGLFKDTTLVVFIGLSDPI 725

Query: 334 GIVRVNFSESTWISSVTPTTGL-----IFIGFVFWIFCFSISLYSVFIEKTLHKGSK 385
           G   +  +++ W        G+     +FIG +F+IFCFS+  YS+ +EK L +  +
Sbjct: 726 GFSNLIRADTDW-------NGIYWELFVFIGALFFIFCFSMGRYSLHLEKKLQREHR 775



 Score = 75.9 bits (185), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 51/157 (32%), Positives = 77/157 (49%), Gaps = 20/157 (12%)

Query: 15  LLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSN 74
           ++   +PPV + G I WI  N F    +ILLT + + ++  ++  ++ W F   VW   +
Sbjct: 1   MIDEQVPPVAEAGAIKWIRTNLFSGWLNILLTVVSLYVVYLALSLVLPWAF-GGVWNAGS 59

Query: 75  RTVCTTV-------SQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGS 127
            T C  V       S GG        ACWA I DR+ Q +FG YP    WRPIL F    
Sbjct: 60  LTECREVLSSFYKSSHGG--------ACWAVIEDRWLQIMFGFYPPELYWRPILAFALFF 111

Query: 128 ILLTPMLIPSFPRKFLNSILLFGL-FPIFSFFVLYGG 163
           + L P+L   F  K    ++ F L +P  + ++++GG
Sbjct: 112 VALAPVL---FADKVPGQLIWFSLAYPFIATWLIWGG 145


>gi|163742836|ref|ZP_02150220.1| amino acid ABC transporter, permease protein [Phaeobacter
           gallaeciensis 2.10]
 gi|161383800|gb|EDQ08185.1| amino acid ABC transporter, permease protein [Phaeobacter
           gallaeciensis 2.10]
          Length = 446

 Score =  205 bits (521), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 104/218 (47%), Positives = 154/218 (70%), Gaps = 2/218 (0%)

Query: 169 VETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTV 228
           V+T+LWGGL +T VI+  GI +S+P+GILLAL R S +P ++   ++FIEL R VPL+TV
Sbjct: 229 VKTNLWGGLFLTFVIAGIGITVSLPMGILLALARRSELPAVKVLAVSFIELVRSVPLITV 288

Query: 229 LFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGL 288
           LFMA  M+PLFLP   +++KL++A++GV  F SAY+AE +RGGLQ ++ GQ EAA SLGL
Sbjct: 289 LFMAVTMVPLFLPQGVELNKLVQAIVGVCLFFSAYMAETVRGGLQVVAVGQTEAAKSLGL 348

Query: 289 SYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISS 348
            Y + M L+++PQ +K +IP IV+ FI LFKD++L+SII ++D+L +++     S+WI  
Sbjct: 349 GYWKTMYLVVLPQALKAMIPNIVSNFIALFKDTTLVSIIGLYDMLLMLKAIGRNSSWIG- 407

Query: 349 VTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
                 LIF   +++I CF++S YS  +E  +  G+  
Sbjct: 408 -LHHEPLIFGAAIYFIICFAMSKYSQHLENVVGGGASN 444



 Score = 63.9 bits (154), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 47/175 (26%), Positives = 80/175 (45%), Gaps = 9/175 (5%)

Query: 21  PPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTT 80
           PP    G I W+ +N F +     +T + + ++  ++ G+ HW   DAVW  S+R  C  
Sbjct: 16  PPSETVGPIHWMRENLFYSWLSTAITLIGLYVIYTTVTGLYHWGVADAVWEASSRRECLD 75

Query: 81  VSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPR 140
            S     P G   ACWA I   Y   I+G YP  ++WR  L F      + P+ +     
Sbjct: 76  QS-----PHG---ACWAGISAWYNSIIYGRYPDEEQWRINLAFGLLIFWMLPIWLEKVQA 127

Query: 141 KFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
           +    I    +FP  + ++  GG     ++ +L G  +VTL+ ++   ++ +  G
Sbjct: 128 RAWFGISAVLIFPFLAGYLFAGGARGWFMQFALLGA-IVTLICNWLHAVLCVLTG 181


>gi|119489534|ref|ZP_01622295.1| Amino acid ABC transporter, permease protein, 3-TM
           region,His/Glu/Gln/Arg/opine [Lyngbya sp. PCC 8106]
 gi|119454613|gb|EAW35760.1| Amino acid ABC transporter, permease protein, 3-TM
           region,His/Glu/Gln/Arg/opine [Lyngbya sp. PCC 8106]
          Length = 404

 Score =  204 bits (520), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 99/228 (43%), Positives = 165/228 (72%), Gaps = 2/228 (0%)

Query: 154 IFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYAC 213
           I S +++ GGLGL  V T+LWGGL++TL++S   I++  P+G++LALGR S++P++R+  
Sbjct: 175 IISVWLIGGGLGLESVSTNLWGGLMLTLLMSIISILLCFPIGVMLALGRQSSLPIIRFLS 234

Query: 214 ITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQ 273
           I +IE+ RG+PL+T+LFM  +++PLFLP+    D++LRA++G++ F+SAY+AE +RGGLQ
Sbjct: 235 IAYIEVIRGLPLITILFMGQVLVPLFLPEGMRPDRILRAIVGLTMFSSAYLAENVRGGLQ 294

Query: 274 SISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLL 333
           +I +GQ EAA +LGLS    + L+++PQ +K  IP IV  FI LF+D++L++I+ + +LL
Sbjct: 295 AIPRGQIEAAKALGLSTPLTLGLVVLPQALKISIPSIVGQFISLFQDTTLLAIVGLVELL 354

Query: 334 GIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
           G+ R   +   ++   +     +FIG ++W+FC+ +S  S  +E+ L+
Sbjct: 355 GMSRSILANPKFLGRYSEV--YLFIGILYWLFCYLMSQASRKLEQQLN 400


>gi|158334197|ref|YP_001515369.1| polar amino acid ABC transporter, permease protein [Acaryochloris
           marina MBIC11017]
 gi|158304438|gb|ABW26055.1| polar amino acid ABC transporter, permease protein [Acaryochloris
           marina MBIC11017]
          Length = 397

 Score =  204 bits (519), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 136/393 (34%), Positives = 217/393 (55%), Gaps = 40/393 (10%)

Query: 22  PVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVW--IGSNR---- 75
           P+    ++ W+ +N F T  + LLT + + ++     G+  W+F  A W  + +N     
Sbjct: 8   PLSTSSLLIWLRRNLFSTWYNGLLTVISLWIIYLGGRGLFRWMFSQAQWTVLQANLRLFF 67

Query: 76  -------------------TVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQR 116
                              +  T+++ G +Q   WN                G  P+   
Sbjct: 68  VGRFPIDQIWRVWLILVLVSAVTSLTIGVVQ---WNRIL-PISMGLLTAISLGIVPLVGG 123

Query: 117 WRPILVFLT--GSILLTPMLIPSFPRKFLNSILLFGLFPIFSF-------FVLYGGLGLS 167
             P LV++   GS+ +  +L   + +  L+  LL    P   F       ++L GGLG+S
Sbjct: 124 QGPELVWVAAIGSVAVLNLLGGPWLKTHLSPRLLSRGLPAVWFLTAFIILWLLMGGLGIS 183

Query: 168 IVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVT 227
            + T++W G L+T+V +   I +S PLG+LLALGR S +PV+R   + +IE+ RG+PL+ 
Sbjct: 184 TIGTNVWQGFLLTVVAAVVSIALSFPLGVLLALGRRSPLPVIRTLSVLYIEVIRGLPLIG 243

Query: 228 VLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLG 287
           VLF+A +MLPL LP    +D + RA+ G++ F++AY+AE +RGGLQSI +GQFEAA +LG
Sbjct: 244 VLFVAGVMLPLILPSQVQLDAVFRAICGLTLFSAAYLAENVRGGLQSIPQGQFEAAKALG 303

Query: 288 LSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWIS 347
           L+ +  + L+++PQ ++ VIP IV  FIGLFKD+SL+SII + +L G+ R   S+  +I 
Sbjct: 304 LNPMLVLGLVVLPQALRSVIPAIVGQFIGLFKDTSLLSIIGLVELTGVSRSVLSQPRFIG 363

Query: 348 SVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTL 380
                   +FIG ++W+FC+ +SL S  +E  L
Sbjct: 364 RHGEVY--LFIGLLYWLFCYLMSLGSRRLEHQL 394


>gi|254438844|ref|ZP_05052338.1| ABC transporter, permease protein [Octadecabacter antarcticus 307]
 gi|198254290|gb|EDY78604.1| ABC transporter, permease protein [Octadecabacter antarcticus 307]
          Length = 790

 Score =  204 bits (519), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 107/233 (45%), Positives = 160/233 (68%), Gaps = 12/233 (5%)

Query: 158 FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFI 217
           +   G +GL  V++   GG ++ L+I   GI++S+PLGILLALGR SN+ +++  C+TFI
Sbjct: 565 YAELGRVGLRPVDSRQIGGFMLALIIGIAGIVLSLPLGILLALGRQSNLFIVKKICVTFI 624

Query: 218 ELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISK 277
           E+ RGVPL+  LF  S++L  FLP   + D LLR ++ V+ FA+AYIAEV+RGGL +++ 
Sbjct: 625 EVIRGVPLIVWLFTGSLLLNYFLPPGTNFDLLLRVIIMVTLFAAAYIAEVIRGGLAALAT 684

Query: 278 GQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVR 337
           GQ+E A+SLGLSY Q M+LI++PQ +K  IPGIVNTFIGLFKD+ L+  I + D +G   
Sbjct: 685 GQYEGADSLGLSYWQSMQLIVLPQAMKISIPGIVNTFIGLFKDTVLVVFIGLSDPIGFSN 744

Query: 338 VNFSESTWISSVTPTTGL-----IFIGFVFWIFCFSISLYSVFIEKTLHKGSK 385
           +  +++ W        G+     +FIG +F++FCFS+  YS+++EK L +  +
Sbjct: 745 LIRADTDW-------NGIYWELFVFIGALFFLFCFSMGRYSLYLEKKLQREHR 790



 Score = 84.0 bits (206), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 51/167 (30%), Positives = 82/167 (49%), Gaps = 20/167 (11%)

Query: 5   CKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWV 64
            +   YVR +++    PP+ + G+I W+ +N F    +ILLT L + ++  ++  ++ W 
Sbjct: 6   AQTVSYVRDKMIDEQAPPIAETGVIKWVRENLFSGWLNILLTVLSLFVVYLALSLVLPWA 65

Query: 65  FLDAVWIGSNRTVCTTV-------SQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRW 117
           F   VW   + T C  V       S GG        ACWA I DR+ Q +FG YP    W
Sbjct: 66  F-GGVWNAGSLTECREVLFSFYKSSHGG--------ACWAVIEDRWLQIMFGFYPPELYW 116

Query: 118 RPILVFLTGSILLTPMLIPSFPRKFLNSILLFGL-FPIFSFFVLYGG 163
           RP+L F    + L P+L   F  K    ++ F   +P  + ++++GG
Sbjct: 117 RPVLAFALFFVALAPVL---FAEKVPGQMIWFSFAYPFIATWLIWGG 160


>gi|239815920|ref|YP_002944830.1| polar amino acid ABC transporter inner membrane subunit [Variovorax
           paradoxus S110]
 gi|239802497|gb|ACS19564.1| polar amino acid ABC transporter, inner membrane subunit
           [Variovorax paradoxus S110]
          Length = 352

 Score =  204 bits (518), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 127/363 (34%), Positives = 212/363 (58%), Gaps = 19/363 (5%)

Query: 26  RGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGG 85
           +G IAW     +G+P   L T L++ LL +     + W  L AV    +   C  V  G 
Sbjct: 6   QGPIAW-RSELWGSPPRALATVLLLALLAWGGYHAVEWGVLHAV-FRPDAEACRAVQHG- 62

Query: 86  IQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKF-LN 144
                   ACW  + +++   +FG +P  ++WRP +     ++L    ++ ++PR +   
Sbjct: 63  --------ACWGVVAEKWRPMLFGRFPYEEQWRPAIAV---AVLSAVTVMSAWPRSWRWW 111

Query: 145 SILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRN 203
             LL+ +  +    ++ GG+ GL+ V TS WGGL +T+ ++  G+ ++ PL +LLALGR 
Sbjct: 112 LALLWVVALVLFVLLMRGGVAGLAPVPTSRWGGLPLTIGLAVVGLALAFPLALLLALGRR 171

Query: 204 SNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAY 263
           S  PV+R    ++IEL RGVPL++VLFMAS +LPL  P  W  D L+R L G++ F +AY
Sbjct: 172 SGWPVVRTLSASYIELVRGVPLISVLFMASFLLPLLWPAGWQPDVLVRVLAGLTLFVAAY 231

Query: 264 IAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSL 323
           +AE++RGGLQ++ +GQ E A +LG       R I++PQ ++ V+P + N+ +G  KD+SL
Sbjct: 232 LAEIIRGGLQAVPRGQTEVAMALGFGRWPVQRDIVLPQALRLVVPALTNSVVGTLKDTSL 291

Query: 324 ISIINMFDLLGIVRVNF-SESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHK 382
           ++++ +F+L G + +    + TW        G +F+  V+W+ CF +S YSV++E+ L +
Sbjct: 292 VTVVGLFELTGALGLALGGDPTWRPFY--LEGYLFVAAVYWVLCFGLSRYSVWLERRLGE 349

Query: 383 GSK 385
           G++
Sbjct: 350 GAR 352


>gi|291569088|dbj|BAI91360.1| putative ABC transporter permease protein [Arthrospira platensis
           NIES-39]
          Length = 405

 Score =  203 bits (516), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 100/217 (46%), Positives = 156/217 (71%), Gaps = 2/217 (0%)

Query: 169 VETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTV 228
           V T LWGGL++TL++S   I++  PLG+LLALGR S++PV+R   I +IE+ RG+PL+T+
Sbjct: 191 VSTDLWGGLMLTLLMSVISILLCFPLGVLLALGRQSDLPVIRGLSIAYIEVIRGLPLITI 250

Query: 229 LFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGL 288
           LFM  I+LPLFLP+    D++LRA++G++ F+SAY+AE +RGGLQ+I +GQ+EAA +LG+
Sbjct: 251 LFMGQILLPLFLPEGMRPDRILRAIVGLTMFSSAYLAENVRGGLQAIPRGQYEAAKALGI 310

Query: 289 SYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISS 348
           +    M LII+PQ +K  IP IV  FI LF+D++L++I+ + +LLGI R   +   ++  
Sbjct: 311 NAPLTMALIILPQALKISIPSIVGQFISLFQDTTLLAIVGLVELLGISRSILANPRFLGR 370

Query: 349 VTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSK 385
                  +F+G ++W+FC+ +SL S  +EK L+  ++
Sbjct: 371 YAEVY--LFVGILYWLFCYLMSLASRKLEKQLNTENR 405


>gi|284052501|ref|ZP_06382711.1| polar amino acid ABC transporter, inner membrane subunit
           [Arthrospira platensis str. Paraca]
          Length = 405

 Score =  203 bits (516), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 100/217 (46%), Positives = 156/217 (71%), Gaps = 2/217 (0%)

Query: 169 VETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTV 228
           V T LWGGL++TL++S   I++  PLG+LLALGR S++PV+R   I +IE+ RG+PL+T+
Sbjct: 191 VSTDLWGGLMLTLLMSVISILLCFPLGVLLALGRQSDLPVIRGLSIAYIEVIRGLPLITI 250

Query: 229 LFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGL 288
           LFM  I+LPLFLP+    D++LRA++G++ F+SAY+AE +RGGLQ+I +GQ+EAA +LG+
Sbjct: 251 LFMGQILLPLFLPEGMRPDRILRAIVGLTMFSSAYLAENVRGGLQAIPRGQYEAAKALGI 310

Query: 289 SYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISS 348
           +    M LII+PQ +K  IP IV  FI LF+D++L++I+ + +LLGI R   +   ++  
Sbjct: 311 NAPLTMALIILPQALKISIPSIVGQFISLFQDTTLLAIVGLVELLGISRSILANPRFLGR 370

Query: 349 VTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSK 385
                  +F+G ++W+FC+ +SL S  +EK L+  ++
Sbjct: 371 YAEVY--LFVGILYWLFCYLMSLASRKLEKQLNTENR 405


>gi|192291279|ref|YP_001991884.1| polar amino acid ABC transporter inner membrane subunit
           [Rhodopseudomonas palustris TIE-1]
 gi|192285028|gb|ACF01409.1| polar amino acid ABC transporter, inner membrane subunit
           [Rhodopseudomonas palustris TIE-1]
          Length = 362

 Score =  203 bits (516), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 117/352 (33%), Positives = 208/352 (59%), Gaps = 17/352 (4%)

Query: 36  FFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAAC 95
            FG  +  L+T  ++ L+L+    ++ W+ LDA W GS+       ++GG        AC
Sbjct: 27  LFGGWRRALVTFAVLALILWLGVPLLQWLLLDATWQGSS---AECAARGG--------AC 75

Query: 96  WAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIF 155
           WAF+  +   F+F  YP    WRP++V     +L+  +L  + PR +   +++     I 
Sbjct: 76  WAFVAAKLRFFLFAFYPADGLWRPVVVC---GLLIVLLLASAMPRLWGARLVVAWPVVIG 132

Query: 156 SFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACI 214
               L  GL G ++V ++ WGGL +TL++       S+P+ +LL+L R S + ++R+  I
Sbjct: 133 LCLALMSGLPGGAVVSSNQWGGLPITLLVWVICFATSVPIAVLLSLARRSRMRIVRWLAI 192

Query: 215 TFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQS 274
            +IEL R +P+V +L+ A+++LP+ LP +  +DKL RA++ ++ F +AY+AEV+RGGLQ+
Sbjct: 193 GYIELMRAIPMVAILYFATLILPMALPGSVPLDKLPRAIVMLALFWTAYVAEVVRGGLQA 252

Query: 275 ISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLG 334
           + +GQ EAA +LGL Y + MRLI++PQ ++ V+PG+VN  IG    +SL+++I + D++G
Sbjct: 253 VPRGQEEAALALGLGYWRSMRLIVLPQALRAVVPGLVNLGIGFLLATSLLAVIGIMDIIG 312

Query: 335 IVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
             +   ++  W+         + +  V+++  +S S YS+++E+ L   S +
Sbjct: 313 AAKAAAADPEWLGYY--KEAFLVVALVYFVMGYSGSRYSLWLERRLGTFSGR 362


>gi|300865206|ref|ZP_07110024.1| polar amino acid ABC transporter, inner membrane subunit
           [Oscillatoria sp. PCC 6506]
 gi|300336797|emb|CBN55174.1| polar amino acid ABC transporter, inner membrane subunit
           [Oscillatoria sp. PCC 6506]
          Length = 398

 Score =  202 bits (515), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 140/400 (35%), Positives = 217/400 (54%), Gaps = 38/400 (9%)

Query: 18  PSLPPVYQRGI-IAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
           P LPPV +      W  KN F +  + LLT + + ++   + G   WV   A W    R 
Sbjct: 5   PLLPPVSESPTPWNWARKNLFSSWYNSLLTVICLTIIFQFLKGFAIWVTTKAQW----RV 60

Query: 77  VCTTVSQ--GGIQPDGWNAACWAF--IYDRYEQFIFGNYP-MAQRWRPILVFLTGSILLT 131
           +   +     G  P   +   W    I        +GN+      W   L+ + G+ +  
Sbjct: 61  IEANLPLFFAGRFPRELHWRLWIIVGIITLLGGLTWGNFNRQVSLWNHPLLIVLGASITA 120

Query: 132 PMLIP--------------------SFPRKFLNSILLF-GLFPIFSF----FVLYGGLGL 166
            +L P                    SF R+    ++ +  L  +FSF    +++ GGLGL
Sbjct: 121 ALLFPTDLTSRLWLLGNIIIAAASYSFGRQINPQVMRWLPLSWVFSFPVILWLIKGGLGL 180

Query: 167 SIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLV 226
             V T+ WGGL++TL  +   I +S PLG+LLALGR S++PV++Y  I +IE+ RG+PL+
Sbjct: 181 KEVPTNDWGGLMLTLFAAVVSIALSFPLGVLLALGRQSSLPVVKYFSILYIEIVRGLPLI 240

Query: 227 TVLFMASIMLPLFLP-DTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANS 285
            +LF+  +ML  FLP     +D+L+RA+  ++ F++AY+AE +RGGLQS+ +GQ EAA S
Sbjct: 241 GILFLGQVMLQFFLPPGAPKLDRLVRAIAALTLFSAAYLAENVRGGLQSVPRGQIEAARS 300

Query: 286 LGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTW 345
           LGL+    + LI++PQ ++ VIP IV  FIGLFKD+SL+S+  + +L+GI R   +   +
Sbjct: 301 LGLNTPLVILLIVLPQALRAVIPAIVGQFIGLFKDTSLLSLFGILELVGISRTVLANPAY 360

Query: 346 ISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSK 385
                     +FIG ++W+FC+S+SL S  +E+TL  G K
Sbjct: 361 SGRYAEV--YVFIGVIYWVFCYSMSLASRKLEQTLGVGQK 398


>gi|103487894|ref|YP_617455.1| amino acid ABC transporter permease [Sphingopyxis alaskensis
           RB2256]
 gi|98977971|gb|ABF54122.1| Amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine [Sphingopyxis alaskensis RB2256]
          Length = 730

 Score =  202 bits (515), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 120/352 (34%), Positives = 188/352 (53%), Gaps = 14/352 (3%)

Query: 30  AWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPD 89
           +W+ +N F   +  +LT  I+ +    +   + W+  +A + G     C   S       
Sbjct: 390 SWMRRNLFRGGRQSILTIAILAMTAAFVGKGLSWLLFEATFAGGAAD-CRLAS------- 441

Query: 90  GWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLF 149
               ACW F+ +     +FG YP A++WR           L    +P F R  L  +   
Sbjct: 442 ---GACWPFLRENARLILFGTYPEAEQWRSAAAATALLSCLAFSFVPRFWRSRLG-LAWL 497

Query: 150 GLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVL 209
           G   +    +  G  GLS V    W GL VTL+++   ++ + PL ILLA GR S    +
Sbjct: 498 GAIAVAVLLLRGGFAGLSYVPMEKWSGLPVTLLLASLAVVGAFPLAILLAFGRRSTRRGI 557

Query: 210 RYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLR 269
           R+  + FIEL RG PL+ VLF+A+++ PLF+P    +D L R  L +  F +AY+AEV+R
Sbjct: 558 RWPSVVFIELVRGTPLIGVLFLAAVLFPLFVPSYLSIDSLPRVQLALIFFTAAYMAEVIR 617

Query: 270 GGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINM 329
           GGL ++  GQ EAA++LGL+  Q  R I++PQ +K  +PG+VNT I   K+++L+ I+ +
Sbjct: 618 GGLLAVPVGQAEAAHALGLTKWQARRHILLPQALKVSVPGLVNTSISEVKNTTLVLIVGV 677

Query: 330 FDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
           FDLL   R+++ E+ W          +F G +F++ CFS+S  S+ IE+ L 
Sbjct: 678 FDLLQTTRLSYVEAQWRPYF--AEAYLFTGTIFFLLCFSLSRLSMKIERKLD 727



 Score = 62.0 bits (149), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 53/88 (60%)

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           +S +ASAY+AE+ RG + ++  GQ EAA +LGLS  Q M  I++PQ ++  IP + +  +
Sbjct: 241 LSVYASAYLAEIFRGAILAVPAGQSEAAKALGLSPAQTMGRIVIPQALRIAIPPMTSWHL 300

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSES 343
              K+SSL   I   + + +V    S++
Sbjct: 301 NTIKNSSLGVAIGYPEFVSVVDTVISQT 328


>gi|146278535|ref|YP_001168694.1| polar amino acid ABC transporter, inner membrane subunit
           [Rhodobacter sphaeroides ATCC 17025]
 gi|145556776|gb|ABP71389.1| polar amino acid ABC transporter, inner membrane subunit
           [Rhodobacter sphaeroides ATCC 17025]
          Length = 392

 Score =  202 bits (515), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 136/390 (34%), Positives = 204/390 (52%), Gaps = 72/390 (18%)

Query: 60  IIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNA----ACWAFIYDRYEQFIFGNYPMAQ 115
           I+ W+ + +VW   N   C       I  + W A    ACWA I +R+ QF++G YP   
Sbjct: 11  IVPWL-MRSVWEADNIAQCRQ-----IVAERWGAGATGACWAVIRERWPQFLYGFYPQHL 64

Query: 116 RWRPILVFLTGSILLTPMLIPSFPRK---------FLNSILLFG---------------- 150
            WRP L      + L P+L  + PR+         F+   LL+G                
Sbjct: 65  YWRPTLALALLFVALAPVLFSALPRRLMWFSLAYPFVAFWLLWGGSVFLPIMVAAGFVIG 124

Query: 151 --------------------LFPIFSFFVLYGGLG--------------LSIVETSLWGG 176
                               L PI  +  L G L               L  V +  +GG
Sbjct: 125 WAAYALLHRFGTIAAVAGAVLIPILWWLFLAGDLSRDLAGLLGRSAPLWLEPVRSDKFGG 184

Query: 177 LLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIML 236
            ++ + I   GI +S+PLGI+LALGR S++ +++   ++FIE  RGVPL+T+LF AS++L
Sbjct: 185 FVLAITIGVSGIALSLPLGIMLALGRRSDMFLIKALSVSFIEFIRGVPLITLLFTASLLL 244

Query: 237 PLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRL 296
             FLP     D +LR ++ V+ FA+AYIAEV+RGGL ++ +GQ+EAA++LGL Y +  RL
Sbjct: 245 NYFLPPGTTFDIILRVIIMVTLFAAAYIAEVIRGGLAALPRGQYEAADALGLDYWRAQRL 304

Query: 297 IIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFD-LLGIVRVNFSESTWISSVTPTTGL 355
           II+PQ +K  IPGIV+TFIGLFKD++L+  + + D L GI     + + W          
Sbjct: 305 IILPQALKISIPGIVSTFIGLFKDTTLVVFVGLLDPLKGITDAVRASTDWKGIYWEP--Y 362

Query: 356 IFIGFVFWIFCFSISLYSVFIEKTLHKGSK 385
           IF+G +F+ F F++S YS+++E+ L    +
Sbjct: 363 IFVGLIFFAFNFAMSRYSMYLERRLKTDHR 392


>gi|209528046|ref|ZP_03276526.1| polar amino acid ABC transporter, inner membrane subunit
           [Arthrospira maxima CS-328]
 gi|209491532|gb|EDZ91907.1| polar amino acid ABC transporter, inner membrane subunit
           [Arthrospira maxima CS-328]
          Length = 405

 Score =  202 bits (513), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 141/397 (35%), Positives = 218/397 (54%), Gaps = 56/397 (14%)

Query: 31  WIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVW--IGSNRTVCTTVSQGGIQP 88
           W+  N F T  + L+T  I   LL+ + G + W  L A W  I +N  +      G    
Sbjct: 23  WLRDNLFNTWYNGLVTIAIASFLLWMLVGFVSWARLVAQWEVIPANLHLFMV---GRFPS 79

Query: 89  DGW-------------NAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLI 135
           D +             +   W F+  R       N         I++FL+   +L  +L 
Sbjct: 80  DQYWRLWLLLGIVSILSGLTWGFLARRQTILFSQN---------IVIFLSVVAMLMALLP 130

Query: 136 PSFPRKFLNSILLF-------------------GLFPIFSFFVL--------YGGLGLSI 168
            +   + +   LLF                   G +  FS+FVL         GGLGL  
Sbjct: 131 TAISYRIIAIALLFVFVFSSWGGRQIGSRKPLLGKWLPFSWFVLLIISLWLIGGGLGLRG 190

Query: 169 VETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTV 228
           V T LWGGL++TL++S   I++  P+G+LLALGR S++PV+R   I +IE+ RG+PL+T+
Sbjct: 191 VSTDLWGGLMLTLLMSVISILLCFPIGVLLALGRQSDLPVIRGLSIAYIEIIRGLPLITI 250

Query: 229 LFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGL 288
           LFM  I+LPLFLP+    D++LRA++G++ F+SAY+AE +RGGLQ+I +GQ+EAA +LGL
Sbjct: 251 LFMGQILLPLFLPEGMRPDRILRAIVGLTMFSSAYLAENVRGGLQAIPRGQYEAAKALGL 310

Query: 289 SYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISS 348
           +    M LII+PQ +K  IP IV  FI LF+D++L++I+ + +LLGI R   +   ++  
Sbjct: 311 NPALTMVLIILPQALKISIPSIVGQFISLFQDTTLLAIVGLVELLGISRSILANPQFLGR 370

Query: 349 VTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSK 385
                  +F+G ++W+FC+ +SL S  +EK L+  ++
Sbjct: 371 YAEVY--LFLGVLYWLFCYLMSLASRKLEKQLNTENR 405


>gi|84515669|ref|ZP_01003030.1| ABC glutamate/glutamine/aspartate/asparagine transporter, inner
           membrane subunit BztC [Loktanella vestfoldensis SKA53]
 gi|84510111|gb|EAQ06567.1| ABC glutamate/glutamine/aspartate/asparagine transporter, inner
           membrane subunit BztC [Loktanella vestfoldensis SKA53]
          Length = 497

 Score =  202 bits (513), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 119/279 (42%), Positives = 177/279 (63%), Gaps = 10/279 (3%)

Query: 113 MAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGL------GL 166
           MA R+    V   G ++++ ++        L +I + GLFP+     L G L      GL
Sbjct: 223 MAGRYASAFVGSLGGLIVSLVVFAIIFMNPLGAIGVDGLFPLLP--QLRGALDGVMPWGL 280

Query: 167 SIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLV 226
               +  +GG ++ ++I   GI++S+PLGI LALGR S++P++++ C++FIE+ RGVPL+
Sbjct: 281 PYTASENFGGFMLAIIIGTSGIVLSLPLGIALALGRQSSMPLIKWVCVSFIEVIRGVPLI 340

Query: 227 TVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSL 286
             LF AS +L  FLP     D LLR ++ V+ FASAY+AEV+RGGL ++ KGQ+EAA+SL
Sbjct: 341 VWLFTASTLLNYFLPPGTTFDLLLRVIIMVTLFASAYLAEVVRGGLAALPKGQYEAADSL 400

Query: 287 GLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWI 346
           GL Y + MRLII+PQ +K  IPGIVNTFIGLFKD++L+  I + D LG+     + S W 
Sbjct: 401 GLDYWKSMRLIILPQALKISIPGIVNTFIGLFKDTTLVVFIGLRDPLGLTNAIRATSEWN 460

Query: 347 SSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSK 385
                    IF+G +F++FCF +S YS+++E+ L    +
Sbjct: 461 GIYWEL--YIFVGGLFFMFCFFMSRYSMYLERRLRTDHR 497


>gi|253690351|ref|YP_003019541.1| polar amino acid ABC transporter, inner membrane subunit
           [Pectobacterium carotovorum subsp. carotovorum PC1]
 gi|251756929|gb|ACT15005.1| polar amino acid ABC transporter, inner membrane subunit
           [Pectobacterium carotovorum subsp. carotovorum PC1]
          Length = 369

 Score =  201 bits (512), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 125/367 (34%), Positives = 201/367 (54%), Gaps = 18/367 (4%)

Query: 22  PVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTV 81
           P   R  + W+ ++ F +    +LT L+  L+      ++HW  LDAVW  ++  +C   
Sbjct: 12  PSQLRTPLLWLRRHLFSSVPQTVLTLLLAVLMWNVGNKLLHWGILDAVWYTADPDICRAA 71

Query: 82  SQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRK 141
           +           ACWA I +++   +FG YP  + WR +L      I    + +   PR 
Sbjct: 72  A----------GACWAVIVEKHRPILFGLYPYDEHWRLVLAM---GIWFLALGLSLMPRF 118

Query: 142 FLNSILL-FGLFPIFSFFVLYGG--LGLSIVETSLWGGLLVTLVISFFGIIISMPLGILL 198
           + + ILL   L  + S  +L  G   GLS V +S WGGL +T+++    ++I MP+ +LL
Sbjct: 119 WHSRILLPLWLVAVVSIAILMSGGVFGLSDVPSSEWGGLPLTILLFSGTVVIGMPVSVLL 178

Query: 199 ALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSA 258
           ALGR S +P LR   + FIE  RGVPL+T+LF+A  + PLFLP   +++KLLR ++G++ 
Sbjct: 179 ALGRRSPLPFLRGLSVIFIEGLRGVPLITILFVAVNVFPLFLPAGMEINKLLRIIIGIAL 238

Query: 259 FASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLF 318
           F + Y AEV+RGGLQS+ +GQ+EAA +L L Y      I++PQ ++  +P + N  I   
Sbjct: 239 FFACYQAEVIRGGLQSVPRGQYEAAMALNLGYWHTTTKIVLPQALRICLPAMTNHIIAAM 298

Query: 319 KDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEK 378
           K++S + II +FD+L        +  W      T   +FI  ++ +F F +S Y++++EK
Sbjct: 299 KNTSFVIIIGLFDILTATSSVMQDPLWRRYYIET--YLFISAIYLLFGFLLSRYALWVEK 356

Query: 379 TLHKGSK 385
            +     
Sbjct: 357 RIDASRN 363


>gi|219847285|ref|YP_002461718.1| polar amino acid ABC transporter inner membrane subunit
           [Chloroflexus aggregans DSM 9485]
 gi|219541544|gb|ACL23282.1| polar amino acid ABC transporter, inner membrane subunit
           [Chloroflexus aggregans DSM 9485]
          Length = 410

 Score =  201 bits (510), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 112/229 (48%), Positives = 160/229 (69%), Gaps = 6/229 (2%)

Query: 158 FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFI 217
            +L GGLGL IVET LWGGL++TL+++  GI++S PLG+LLALGR S++PV+R  C+ +I
Sbjct: 181 LILRGGLGLPIVETKLWGGLMLTLLLAISGIVLSFPLGVLLALGRRSSLPVIRTFCVLYI 240

Query: 218 ELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISK 277
           EL RGVPLVTVLFM +++LPLFLP    +D L+RA + V+ F++AY+AE +RGGLQ+I +
Sbjct: 241 ELIRGVPLVTVLFMGALLLPLFLPGGESIDALVRATVAVTLFSAAYLAENVRGGLQAIPR 300

Query: 278 GQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVR 337
           GQ EAA +LGL+ +Q   LI +PQ ++ V+P +V  FI LFKD+SL+ II + DLLG  +
Sbjct: 301 GQVEAARALGLNVVQTTLLITLPQALRAVVPVLVGQFIALFKDTSLVVIIGLVDLLGAAQ 360

Query: 338 VNFSESTWISSVTP----TTGLIFIGFVFWIFCFSISLYSVFIEKTLHK 382
               +  W+   TP        + I  V+W+F F++S  S  IE  + +
Sbjct: 361 NIVGQPQWLG--TPGGVWRETFLVIAAVYWLFSFTMSRVSKRIEDQIAR 407


>gi|152994193|ref|YP_001339028.1| polar amino acid ABC transporter inner membrane subunit
           [Marinomonas sp. MWYL1]
 gi|150835117|gb|ABR69093.1| polar amino acid ABC transporter, inner membrane subunit
           [Marinomonas sp. MWYL1]
          Length = 452

 Score =  200 bits (509), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 110/256 (42%), Positives = 162/256 (63%), Gaps = 7/256 (2%)

Query: 130 LTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVE-----TSLWGGLLVTLVIS 184
           L  + +P   R     I L G   ++    L    GLS V         WGGL +T +I+
Sbjct: 195 LNELFVPLVSRLVERRIHLLGFVAVWLLVALVIASGLSQVSLEPVPIERWGGLFLTFIIA 254

Query: 185 FFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTW 244
            F I +++P+G++LALGR S +PV+ +  +T IEL R VPL+TVLFMA  +LP+FLP   
Sbjct: 255 GFAITMAIPVGVILALGRRSKLPVIHWLSMTVIELVRSVPLITVLFMAVTLLPIFLPADM 314

Query: 245 DVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIK 304
           + +KL + L+ V  FA AY+AE +RGGLQ+I KGQ+EAA +LGL YL  M LII+PQ ++
Sbjct: 315 EFNKLTQVLVAVCLFAGAYMAENIRGGLQAIPKGQYEAAATLGLGYLHTMVLIILPQALR 374

Query: 305 RVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWI 364
            +IP I+ +FI L KD++L+SII +FD++ + R   ++  W+     T  L+ I  +F+I
Sbjct: 375 MMIPNIMTSFISLLKDTTLVSIIGLFDIMLMARNIANDKDWVG--MHTEPLVMISVLFFI 432

Query: 365 FCFSISLYSVFIEKTL 380
            C+S+S YS+ +EK L
Sbjct: 433 LCYSMSQYSLNLEKRL 448



 Score = 68.9 bits (167), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 60/203 (29%), Positives = 98/203 (48%), Gaps = 17/203 (8%)

Query: 4   SCKEFPYVRKRLLQPSLPP-VYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIH 62
           + K  P +++ +  P  PP   +RGI+  I    F +  + LLT  +  +L + +  ++ 
Sbjct: 5   NVKNQPVLKQFVPTPPRPPHKSERGILGTIRHRCFNSIGNSLLTLCVATVLFYLVKHVLD 64

Query: 63  WVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILV 122
           W   +AV+I  NR  C  +S     PDG   ACWA +   +   I+G +P+ ++WR  + 
Sbjct: 65  WAVFNAVFIADNRRQCMDIS-----PDG---ACWAGVISWFNGLIYGRFPVDEQWRVNIG 116

Query: 123 FLTGSILLTPMLIPSFPRKFLNSILL--FGLFPIFSFFVLYGGLGLSIVETSLWGGLLVT 180
            L G + L P++    P +  N ILL   GL+P    ++  GG      E  L  G +  
Sbjct: 117 VLLGLVWLLPLMSKRIPLR--NFILLSWIGLYPFVGGYLFLGGRFGE--ELGLVHGAMTC 172

Query: 181 LVISFFGIIISMPLGILLALGRN 203
           L ++F  II +    IL ALG+ 
Sbjct: 173 LALAFLAIIYAN--WILSALGKK 193


>gi|197104924|ref|YP_002130301.1| ABC-type amino acid transport system, permease component
           [Phenylobacterium zucineum HLK1]
 gi|196478344|gb|ACG77872.1| ABC-type amino acid transport system, permease component
           [Phenylobacterium zucineum HLK1]
          Length = 358

 Score =  200 bits (509), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 136/360 (37%), Positives = 211/360 (58%), Gaps = 18/360 (5%)

Query: 21  PPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPG-IIHWVFLDAVWIGSNRTVCT 79
           PP   RG  A +    FG+P +++LT L +    +S+   ++ W  LDA  + +    C 
Sbjct: 9   PPRAARGP-AVLAARLFGSPLNVVLT-LAVAWAAWSLAAPLVRWAVLDAAVLPAEPAACR 66

Query: 80  TVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFP 139
            +S           ACW+F+  +  Q +FG YP+ +RWRP LV      LL   L P+  
Sbjct: 67  DIS----------GACWSFVVAKSGQILFGIYPIEERWRPTLVCAVLLGLLAYSLRPAAW 116

Query: 140 RKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPLGILL 198
           R  L ++    L  +    +++GG  GLS V T++WGGL VTL+++   I  + PL ILL
Sbjct: 117 RPHLAALWAAALPGVL--LLMFGGFAGLSYVATTMWGGLPVTLILTVTAIGGAFPLAILL 174

Query: 199 ALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSA 258
           ALGR +++PV+R  C+ FIE+ R +PL+++LF+ASIMLPL LP+    DK  RA++ +  
Sbjct: 175 ALGRRADLPVIRTLCVLFIEVTRAMPLLSLLFIASIMLPLLLPEPLLPDKFFRAMIALLL 234

Query: 259 FASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLF 318
           FA+AY+AEV+RGGLQ++  GQ EAA +LGL Y +  R +++PQ +  VIP + NT I + 
Sbjct: 235 FAAAYLAEVIRGGLQALPPGQAEAARALGLGYWRTQRFVVLPQALALVIPSLTNTIIVMI 294

Query: 319 KDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEK 378
           K++SL+ ++ +FDL+   R   ++  W S    T   IFI  V++  CF    ++  +E+
Sbjct: 295 KNTSLVLVVGLFDLISSGRAALADPEWSSPAMET--YIFIASVYFALCFGFGRFARALER 352


>gi|39935696|ref|NP_947972.1| polar amino acid ABC transport system protein AapM-2
           [Rhodopseudomonas palustris CGA009]
 gi|39649549|emb|CAE28071.1| polar amino acid ABC transport system protein, aapM-2
           [Rhodopseudomonas palustris CGA009]
          Length = 360

 Score =  200 bits (509), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 121/361 (33%), Positives = 209/361 (57%), Gaps = 19/361 (5%)

Query: 23  VYQRGIIAWIHK--NFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTT 80
           + QR    W       FG  +  L+T  +  L+L+    ++ W+ LDA W GS+      
Sbjct: 10  ISQRRSFGWPKSVVALFGGWRRALVTFAVWALILWLGVPLLRWLLLDATWQGSS---AEC 66

Query: 81  VSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPR 140
            ++GG        ACWAF+  +   F+F  YP    WRP+ V     +L+  +L  + PR
Sbjct: 67  AARGG--------ACWAFVAAKLRFFLFAFYPAEWLWRPVAVC---GLLIALLLASAMPR 115

Query: 141 KFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPLGILLA 199
            +   +++     I     L  GL G ++V ++ WGGL +TL++       S+P+ +LL+
Sbjct: 116 LWGARLVVAWPVVIGLCLALMSGLPGGAVVSSNQWGGLPITLLVWVICFATSVPIAVLLS 175

Query: 200 LGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAF 259
           L R S + ++R+  I +IEL R +P+V +L+ A+++LP+ LP +  +DKL RA++ ++ F
Sbjct: 176 LARRSRMRIVRWLAIGYIELMRAIPMVAILYFATLILPMALPGSVPLDKLPRAIVMLALF 235

Query: 260 ASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFK 319
            +AY+AEV+RGGLQ++ +GQ EAA +LGL Y + MRLI++PQ ++ V+PG+VN  IG   
Sbjct: 236 WTAYVAEVVRGGLQAVPRGQEEAALALGLGYWRSMRLIVLPQALRAVVPGLVNLGIGFLL 295

Query: 320 DSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKT 379
            +SL+++I + D+LG  +   ++  W+         + +  V+++ C+S S YS+++E+ 
Sbjct: 296 ATSLLAVIGIMDILGAAKAAAADPEWLGYY--KEAFLVVALVYFVMCYSGSRYSLWLERR 353

Query: 380 L 380
           L
Sbjct: 354 L 354


>gi|227325812|ref|ZP_03829836.1| Polar amino acid ABC transporter, inner membrane subunit precursor
           [Pectobacterium carotovorum subsp. carotovorum WPP14]
          Length = 369

 Score =  200 bits (508), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 125/368 (33%), Positives = 202/368 (54%), Gaps = 20/368 (5%)

Query: 22  PVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTV 81
           P   R  + W+ ++ F +    +LT L+  L+      ++HW  LDAVW  ++  +C   
Sbjct: 12  PSRLRTPLLWLRRHLFSSVPQTVLTLLLAVLMWNVGNKLLHWGILDAVWYTTDPDICRVA 71

Query: 82  SQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRK 141
           +           ACWA I +++   +FG YP  + WR +L      + L   L+P    +
Sbjct: 72  A----------GACWAVIVEKHRPILFGLYPYDEHWRLVLAMGIWFLALGLSLMP----R 117

Query: 142 FLNSILLFGLF--PIFSFFVLYGG--LGLSIVETSLWGGLLVTLVISFFGIIISMPLGIL 197
           F +S +L  L+   +    +L  G   GLS V +S WGGL +T+++    ++I MP+ +L
Sbjct: 118 FWHSRILLPLWIVAVVGIAILMSGGVFGLSYVPSSEWGGLPLTILLFSGTVVIGMPVSVL 177

Query: 198 LALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVS 257
           LALGR S +P LR   + FIE  RGVPL+T+LF+A  + PLFLP   +++KLLR ++G++
Sbjct: 178 LALGRRSPLPFLRGLSVIFIEGLRGVPLITILFVAVNVFPLFLPAGMEINKLLRIIIGIA 237

Query: 258 AFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGL 317
            F + Y AEV+RGGLQS+ +GQ+EAA +L L Y      II+PQ ++  +P + N  I  
Sbjct: 238 LFFACYQAEVIRGGLQSVPRGQYEAAMALNLGYWHTTTKIILPQALRICLPAMTNHIIAA 297

Query: 318 FKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIE 377
            K++S + II +FD+L        +  W      T   +FI  ++ +F F +S Y++++E
Sbjct: 298 MKNTSFVIIIGLFDILTATSSVMQDPLWRRYYIET--YLFISAIYLLFGFLLSRYALWVE 355

Query: 378 KTLHKGSK 385
           K +     
Sbjct: 356 KRIDASRN 363


>gi|17231658|ref|NP_488206.1| permease protein of amino acid ABC transporter [Nostoc sp. PCC
           7120]
 gi|17133301|dbj|BAB75865.1| permease protein of amino acid ABC transporter [Nostoc sp. PCC
           7120]
          Length = 381

 Score =  200 bits (508), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 105/231 (45%), Positives = 165/231 (71%), Gaps = 3/231 (1%)

Query: 152 FPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRY 211
           FPI   +++ GG GL  V ++LW GLL+TL+++   I++S P+G+LLALGR SN+PV+R+
Sbjct: 154 FPII-LWLIGGGFGLRPVSSNLWNGLLLTLLMAAISIVLSFPIGVLLALGRTSNLPVVRW 212

Query: 212 ACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGG 271
             I +IE+ RGVPL+ +LF+A +MLPLF      +D++LRA+ G+  F++AY+AE +RGG
Sbjct: 213 FSILYIEIVRGVPLIGILFLAQVMLPLFFAADVRLDRVLRAIAGLVLFSAAYMAENVRGG 272

Query: 272 LQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFD 331
           LQ++S+GQ EAA +LGL+    + LI++PQ ++ VIP +V  FIGLFKD+SL+S++ + +
Sbjct: 273 LQAVSRGQVEAAKALGLNTFFVVLLIVLPQALRAVIPALVGQFIGLFKDTSLLSLVGLVE 332

Query: 332 LLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHK 382
           L GI R   ++  +I         +FIG ++W+FC+S+SL S  +E+ L+ 
Sbjct: 333 LTGIARSILAQPQFIGRYAEVY--LFIGLIYWLFCYSMSLASRRLERQLNN 381



 Score = 36.2 bits (82), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 39/101 (38%), Gaps = 26/101 (25%)

Query: 29  IAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQP 88
           + W+ KN F T  + LLT +   L L+ + GII W               TT +Q     
Sbjct: 4   LTWLRKNLFSTWYNSLLTVICSALSLWLVQGIIVW--------------ATTKAQ----- 44

Query: 89  DGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSIL 129
                  WA I      F+ G +P  + WR  +V    S L
Sbjct: 45  -------WAVIQVNLRLFLVGRFPQTEYWRVWIVLAIASTL 78


>gi|254456396|ref|ZP_05069825.1| amino acid ABC transporter, permease protein [Candidatus
           Pelagibacter sp. HTCC7211]
 gi|207083398|gb|EDZ60824.1| amino acid ABC transporter, permease protein [Candidatus
           Pelagibacter sp. HTCC7211]
          Length = 480

 Score =  199 bits (507), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 94/214 (43%), Positives = 150/214 (70%), Gaps = 2/214 (0%)

Query: 165 GLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVP 224
            L  VET  WGGL +T ++SFF +I   P+G+ L+LGR S+ P+++Y  I  IE +RGVP
Sbjct: 263 ALEWVETGAWGGLSLTFIVSFFCLIFCFPIGLFLSLGRRSDFPIIKYISIGMIEFWRGVP 322

Query: 225 LVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAAN 284
           L+TVLFM+S+M P+FLP+   +DKL+R ++ +S F +AY+AEV+RGGLQ++ +GQ++AA 
Sbjct: 323 LITVLFMSSVMFPMFLPEDMFIDKLVRVIIAISLFEAAYVAEVIRGGLQALPRGQYDAAK 382

Query: 285 SLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSEST 344
           SLG+ Y +   L+I+PQ +K VIPGI NTF+ L KD+ LI ++ + +++G++ +  +   
Sbjct: 383 SLGMGYWKMHILVILPQALKLVIPGIANTFLALVKDTPLIFVVGLLEIVGMLNLAKTNPE 442

Query: 345 WISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEK 378
           W+       G +F   +F+I C+++S YS  +E+
Sbjct: 443 WLG--FAMEGYVFASVLFFIICYAMSKYSYNLEQ 474



 Score = 54.3 bits (129), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 52/100 (52%), Gaps = 11/100 (11%)

Query: 32  IHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGW 91
           ++KN      +  L+ LI+ +++ S+P ++ W  LDA   G ++ VCT            
Sbjct: 79  VNKNINTNSFNAFLSLLIVFVVIKSLPPLLSWFILDASIAGDSKDVCTG----------- 127

Query: 92  NAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLT 131
             ACW +I   + +F++G YP A++WR  L F+  + L T
Sbjct: 128 TGACWTYIKIWFNRFMYGMYPNAEQWRINLSFIALAFLGT 167


>gi|113475661|ref|YP_721722.1| polar amino acid ABC transporter inner membrane subunit
           [Trichodesmium erythraeum IMS101]
 gi|110166709|gb|ABG51249.1| polar amino acid ABC transporter, inner membrane subunit
           [Trichodesmium erythraeum IMS101]
          Length = 403

 Score =  199 bits (507), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 101/220 (45%), Positives = 156/220 (70%), Gaps = 2/220 (0%)

Query: 162 GGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFR 221
           GGLGL  V T+ WGGL++T++++   I +S PLG+LLALGR S +PV+R   I +IE+ R
Sbjct: 183 GGLGLKSVSTNDWGGLMLTVLMAVVSIFLSFPLGVLLALGRQSTLPVIRIFSIGYIEIIR 242

Query: 222 GVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFE 281
           G+PL+++LFM  I++PLFLPD    D++ RA+LG++ F++AY+AE +RGGLQS+ +GQ E
Sbjct: 243 GLPLISILFMGQILIPLFLPDGMRPDRIFRAILGLTLFSAAYLAENVRGGLQSVLRGQSE 302

Query: 282 AANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFS 341
           AA +LGL+    + LI++PQ +K  IP IV  FI LF+D++L+SI+ + +LLGI R   +
Sbjct: 303 AAKALGLNTPLSLGLIVLPQALKVAIPSIVGQFISLFQDTTLLSIVGLVELLGISRSILA 362

Query: 342 ESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
           +  ++         +F G +FWI C+++S+ S  +EK L+
Sbjct: 363 QPEFLGDYAEVY--LFDGIIFWIVCYAMSVGSRQLEKKLN 400


>gi|254464309|ref|ZP_05077720.1| amino acid ABC transporter, permease protein [Rhodobacterales
           bacterium Y4I]
 gi|206685217|gb|EDZ45699.1| amino acid ABC transporter, permease protein [Rhodobacterales
           bacterium Y4I]
          Length = 432

 Score =  199 bits (507), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 104/220 (47%), Positives = 154/220 (70%), Gaps = 1/220 (0%)

Query: 166 LSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPL 225
           LS V +   GG ++ L++    + +S+PLGI LALGR S++P++++ C+ FIE  RGVPL
Sbjct: 214 LSPVPSRDLGGFMLNLMLGVTCVSLSLPLGIALALGRQSDMPLIKWMCVIFIEFVRGVPL 273

Query: 226 VTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANS 285
           +T+LF+AS+ML  F P    VD  LR ++ ++ F++AYIAEV+RGGL ++ KGQ+EAA+S
Sbjct: 274 ITLLFVASVMLAYFFPPESTVDLFLRVVIMITMFSAAYIAEVIRGGLAALPKGQYEAADS 333

Query: 286 LGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTW 345
           LGL Y Q MRLII+PQ +K  IPGIVN  +GLFKD++L+S+I+MFDL+G++R     ST 
Sbjct: 334 LGLDYAQAMRLIILPQALKISIPGIVNVAVGLFKDTTLVSVISMFDLVGMIRGPILASTE 393

Query: 346 ISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSK 385
            + V     L F   +F++ C+ IS YS ++E+ L    +
Sbjct: 394 WNGVYWEL-LGFAALLFFVVCYGISQYSQWLERRLATDHR 432



 Score = 75.1 bits (183), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 40/160 (25%), Positives = 77/160 (48%), Gaps = 11/160 (6%)

Query: 5   CKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWV 64
            +   +VR+  + P+ PP  + G++ W+ +N F    +  LT   + ++   +   + W+
Sbjct: 6   AQTVAFVRETQIPPAPPPASETGVVKWLRENLFSNAANSALTIAALAVIYMVLQNTLPWI 65

Query: 65  FLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFG-NYPMAQRWRPILVF 123
            L+ VW  S+   C  + QG         AC++ + +R+ Q ++G  YP    WRP L  
Sbjct: 66  -LNGVWTTSSLAECREILQGK------TGACFSVLTERWNQLLYGFKYPSDAYWRPNLAL 118

Query: 124 LTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGG 163
           +       P+L    PRK L   +   ++P  +F++++GG
Sbjct: 119 VLLLFAAAPVLFFDLPRKLL---IFTAIYPFLAFWLIWGG 155


>gi|126464335|ref|YP_001045448.1| polar amino acid ABC transporter, inner membrane subunit
           [Rhodobacter sphaeroides ATCC 17029]
 gi|126106146|gb|ABN78676.1| polar amino acid ABC transporter, inner membrane subunit
           [Rhodobacter sphaeroides ATCC 17029]
          Length = 370

 Score =  199 bits (505), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 120/328 (36%), Positives = 190/328 (57%), Gaps = 20/328 (6%)

Query: 60  IIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRP 119
           ++ W  ++AV+  ++  VC   +           ACWA I +++   +FG YP  + WR 
Sbjct: 57  VLDWGVVNAVFYTTDPDVCRAAT----------GACWAVIVEKHRPMLFGLYPYDEHWRL 106

Query: 120 ILVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSF---FVLYGG-LGLSIVETSLWG 175
           +L+    ++ L  +++  +PR + N   L  L+ + S     +++GG LGL  V TS WG
Sbjct: 107 VLMM---AVYLGTVVLSLWPRCW-NLRFLVPLWIVSSLSIGILMFGGVLGLRYVPTSEWG 162

Query: 176 GLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIM 235
           GL +T+++    ++I MP+ +LLALGR + +PV R   + FIE  RGVPL+T+LF+A  +
Sbjct: 163 GLPLTMLLFTGTVLIGMPVAVLLALGRRAPLPVARGVSVVFIEALRGVPLITILFVAVNV 222

Query: 236 LPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMR 295
            PLFLP   +V+KLLR  +G++ F + Y AEV+RGGLQ+I  GQ+EAA SL LSY Q  R
Sbjct: 223 FPLFLPAGVEVNKLLRITVGIAIFFACYQAEVIRGGLQAIPTGQYEAAASLSLSYWQTTR 282

Query: 296 LIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGL 355
            II+PQ ++  +P I N  I   K++S + II +FD+L        +  W          
Sbjct: 283 RIILPQALRISLPAITNHIIAAMKNTSFVIIIGLFDILTATTAVMQDPLWRKFY--IEAY 340

Query: 356 IFIGFVFWIFCFSISLYSVFIEKTLHKG 383
           +F+  V+  F +++SLY+  +EK +  G
Sbjct: 341 LFVAAVYLFFGYALSLYARQVEKWIASG 368


>gi|221370065|ref|YP_002521161.1| Polar amino acid ABC transporter, inner membrane subunit precursor
           [Rhodobacter sphaeroides KD131]
 gi|221163117|gb|ACM04088.1| Polar amino acid ABC transporter, inner membrane subunit precursor
           [Rhodobacter sphaeroides KD131]
          Length = 370

 Score =  198 bits (504), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 128/358 (35%), Positives = 204/358 (56%), Gaps = 20/358 (5%)

Query: 30  AWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPD 89
           AW+  N F +    LLT ++  +L+     ++ W  ++AV+  ++  VC   +       
Sbjct: 27  AWLRANLFSSVWQSLLTLVVAVVLIRFFWFVLDWGVVNAVFYTTDPDVCRAAT------- 79

Query: 90  GWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLF 149
               ACWA I +++   +FG YP  + WR +L+    ++ L  +++  +PR + N   L 
Sbjct: 80  ---GACWAVIVEKHRPMLFGLYPYDEHWRLVLMM---AVYLGTVVLSLWPRCW-NLRFLV 132

Query: 150 GLFPIFSF---FVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSN 205
            L+ + S     +++GG LGL  V TS WGGL +T+++    ++I MP+ +LLALGR + 
Sbjct: 133 PLWIVSSLSIGILMFGGVLGLRYVPTSEWGGLPLTMLLFTGTVLIGMPVAVLLALGRRAP 192

Query: 206 IPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIA 265
           +PV R   + FIE  RGVPL+T+LF+A  + PLFLP   +V+KLLR  +G++ F + Y A
Sbjct: 193 LPVARGVSVVFIEALRGVPLITILFVAVNVFPLFLPAGVEVNKLLRITVGIAIFFACYQA 252

Query: 266 EVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLIS 325
           EV+RGGLQ+I  GQ+EAA SL LSY Q  R II+PQ ++  +P I N  I   K++S + 
Sbjct: 253 EVIRGGLQAIPTGQYEAAASLSLSYWQTTRRIILPQALRISLPAITNHIIAAMKNTSFVI 312

Query: 326 IINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKG 383
           II +FD+L        +  W          +F+  V+  F +++SLY+  +EK +  G
Sbjct: 313 IIGLFDILTATTAVMQDPLWRKFY--IEAYLFVAAVYLFFGYALSLYARQVEKWIASG 368


>gi|260577144|ref|ZP_05845121.1| polar amino acid ABC transporter, inner membrane subunit
           [Rhodobacter sp. SW2]
 gi|259020618|gb|EEW23937.1| polar amino acid ABC transporter, inner membrane subunit
           [Rhodobacter sp. SW2]
          Length = 434

 Score =  198 bits (503), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 153/440 (34%), Positives = 228/440 (51%), Gaps = 69/440 (15%)

Query: 7   EFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLT----ALIICLLLFSIPGIIH 62
           E  Y+R  +L    PP+  RGII WI +N F    +  LT    A +  LL  S+P  +H
Sbjct: 3   EPSYLRDTVLPQLPPPLVDRGIIKWIRENLFSGVLNTFLTLAGLAAVWWLLAASLPWFLH 62

Query: 63  WVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWA--------FIYDRY--EQF------ 106
            V+ DA  +G  R++       G Q      ACWA        FI+  Y  E +      
Sbjct: 63  GVW-DANSLGECRSIIAAEFGEGAQ-----GACWAMLRERWHQFIFGFYPPEAYWRVGLA 116

Query: 107 -----------IFGNYPMAQRWRPIL-------VFLTGSI------------------LL 130
                      +F   P    W  ++       +   GSI                  LL
Sbjct: 117 FVLLFVALAPVLFTEVPRLLLWGTVIYPALGYWLLWGGSIWGPVVAMAGFGLLALVFKLL 176

Query: 131 TPML-IP-SFPRKFLNSIL--LFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFF 186
            P+L +P +    F+ ++L  LF   P+         +GL  VE+  +GG L+++VI   
Sbjct: 177 RPLLGVPVAGGLGFVAAVLWWLFAQGPVAGLLAGVMPVGLVPVESDRFGGFLLSIVIGVT 236

Query: 187 GIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDV 246
            I  S+PLGILLALGR S++ +++   + FIE  RGVPL+T+LF AS++L  FLP     
Sbjct: 237 SIAASLPLGILLALGRRSDMFLVKTLSVAFIEFIRGVPLITMLFTASLLLQYFLPPGTSF 296

Query: 247 DKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRV 306
           D +LR  + V+ FA+AY+AEV+RGG+ ++ +GQ+EAA++LGL Y    RLII+PQ +K  
Sbjct: 297 DLILRVDILVTIFAAAYLAEVVRGGMAALPRGQYEAADALGLDYWSAERLIILPQALKIS 356

Query: 307 IPGIVNTFIGLFKDSSLISIINMFD-LLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIF 365
           IP IV+TFI LFKD++L+S + + D L GI  +  ++  W          +F+G VF++ 
Sbjct: 357 IPSIVSTFISLFKDTTLVSFVGLLDPLKGISTIVRADMAWKGVYWEPY--LFVGAVFFVL 414

Query: 366 CFSISLYSVFIEKTLHKGSK 385
           CFS+S YS+++E+ L    K
Sbjct: 415 CFSMSRYSMYLERKLKTDHK 434


>gi|295689851|ref|YP_003593544.1| polar amino acid ABC transporter inner membrane subunit
           [Caulobacter segnis ATCC 21756]
 gi|295431754|gb|ADG10926.1| polar amino acid ABC transporter, inner membrane subunit
           [Caulobacter segnis ATCC 21756]
          Length = 342

 Score =  198 bits (503), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 112/326 (34%), Positives = 181/326 (55%), Gaps = 16/326 (4%)

Query: 61  IHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPI 120
           + W+ LDA W G +R  C         P G   ACWA I  R  Q + G YP     R +
Sbjct: 31  LRWLILDATWTGDSRAAC--------DPAG---ACWAMITARAPQILIGFYPPGHGGRVL 79

Query: 121 LVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVT 180
           L  L  +  L+P+   + PR+    ++   L  +    ++ G   L  V ++ WGGL + 
Sbjct: 80  LAVLALAAGLSPL---ALPRRAGLVLVTAPLGAVVCLVLMGGARLLPSVPSAYWGGLALN 136

Query: 181 LVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFL 240
           L++     I ++PLG+LL L R S +P++R     ++E  R  PL+ VLF A+++ PL L
Sbjct: 137 LIVGAVCAIFALPLGVLLGLARQSRLPLIRLLASAYVETARAAPLIVVLFAAAVLGPLLL 196

Query: 241 PDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMP 300
           P    +DKL RA++ ++ F +AY+AE +RGGL ++ +GQ EAA +LGL  L+ +  +++P
Sbjct: 197 PSALPLDKLGRAMVAITLFEAAYMAEAVRGGLMAVPQGQREAARALGLGPLRALVDVVLP 256

Query: 301 QVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGF 360
           Q ++   P +VN+FIGL KD+SL+ +I + D+ G++R   S+  W   + P    IF+G 
Sbjct: 257 QALRTATPALVNSFIGLLKDTSLLYVIGVLDITGVLRNAVSDFAW-QGLEPEA-YIFVGL 314

Query: 361 VFWIFCFSISLYSVFIEKTLHKGSKK 386
            FW+ CF +S  +  +E+ L    + 
Sbjct: 315 SFWLLCFGLSRAAAALERRLQTAPRS 340


>gi|326794956|ref|YP_004312776.1| polar amino acid ABC transporter inner membrane subunit
           [Marinomonas mediterranea MMB-1]
 gi|326545720|gb|ADZ90940.1| polar amino acid ABC transporter, inner membrane subunit
           [Marinomonas mediterranea MMB-1]
          Length = 456

 Score =  198 bits (503), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 106/250 (42%), Positives = 164/250 (65%), Gaps = 4/250 (1%)

Query: 134 LIPSFPRKFLNSILLFGLFPIFSFFV--LYGGLGLSIVETSLWGGLLVTLVISFFGIIIS 191
           L+ ++ ++ + S+ L  ++   S  V  + GG  L  V    WGGL +T +I+ F I ++
Sbjct: 206 LLETYLKRRVASVSLILVWAALSMLVALVIGGFDLDPVPIERWGGLFLTFIIAGFSIAMA 265

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +P+G+LLALGR S +PV+ +  +  IEL R VPL+TVLFMA  +LP+FLP   + +KL +
Sbjct: 266 IPVGVLLALGRRSKLPVIHWLSLVVIELVRSVPLITVLFMAVTLLPIFLPSDVEFNKLSQ 325

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
            L+ V  FA AY+AE +RGGLQ+I KGQFEAA +LG  Y Q M LI++PQ ++ +IP I+
Sbjct: 326 VLVAVCLFAGAYMAENIRGGLQAIPKGQFEAATTLGFGYWQTMFLIVLPQALRMMIPNIM 385

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISL 371
            +FI L KD++L+SII +FD++ + R   ++  W+     T  L+ I  +F++ C+S+S 
Sbjct: 386 TSFISLLKDTTLVSIIGLFDIMLMARNIANDKDWVG--LHTEPLVLIAVLFFVLCYSMSQ 443

Query: 372 YSVFIEKTLH 381
           YS+ +EK L 
Sbjct: 444 YSLNLEKRLK 453



 Score = 65.1 bits (157), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 53/177 (29%), Positives = 78/177 (44%), Gaps = 17/177 (9%)

Query: 17  QPSLPP-VYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNR 75
            P+ PP     G I  I   +F T  + LLT   + +L +     ++W   +AV+    R
Sbjct: 22  SPARPPQTNSNGAIGKIRNRYFNTIGNSLLTIASLIVLFYLAKWGLNWALFEAVFDADTR 81

Query: 76  TVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLI 135
             C  +S         N ACWA +   +   I+G +P+ ++WR  L  + G+  L P+L 
Sbjct: 82  RQCLDISP--------NGACWAGVMSWFNGLIYGRFPLQEQWRVNLGVIVGAFWLLPLLS 133

Query: 136 PSFPRKFLNSILL--FGLFPIFSFFVLYGGLGLSIVETSLWG-GLLVTLVISFFGII 189
              P +  N ILL   GLFP   F   Y  LG        WG GL+  L + F  +I
Sbjct: 134 KRIPLR--NVILLSWVGLFP---FAAAYLFLGGRFGHELSWGHGLMTCLSLGFLALI 185


>gi|254422244|ref|ZP_05035962.1| ABC transporter, permease protein [Synechococcus sp. PCC 7335]
 gi|196189733|gb|EDX84697.1| ABC transporter, permease protein [Synechococcus sp. PCC 7335]
          Length = 531

 Score =  197 bits (502), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 96/218 (44%), Positives = 148/218 (67%), Gaps = 2/218 (0%)

Query: 165 GLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVP 224
           GL  V T+ WGGL +TL ++  GI +  P G+LLALGR S +P++R   +T+IEL RGVP
Sbjct: 313 GLETVRTNSWGGLTLTLFLAISGIALCFPAGVLLALGRRSKLPLIRMFSVTYIELVRGVP 372

Query: 225 LVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAAN 284
           L+++LFM  +++PLFLP+    D ++RA++G++ F++AY+AE +R GLQS+ +GQ EAA 
Sbjct: 373 LISILFMGQVLIPLFLPEGMRPDPVVRAIIGLTIFSAAYLAENVRAGLQSVPQGQGEAAQ 432

Query: 285 SLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSEST 344
           SLGL+    M LI++PQ +K  IP IV  FI LF+D++L+ I+ + +LLGI R   +   
Sbjct: 433 SLGLNKPLTMALIVLPQALKTAIPAIVGQFISLFQDTTLLGIVGLLELLGITRNLLANPN 492

Query: 345 WISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHK 382
           ++    P    +FIG ++W+FC+ +S  S  +E  L+ 
Sbjct: 493 YLGDFAPAY--VFIGVIYWVFCYGMSYGSRRVEAALNT 528



 Score = 36.6 bits (83), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 20/106 (18%), Positives = 45/106 (42%), Gaps = 26/106 (24%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
            R ++   P V + G + W  K+ F +P + ++T ++  ++++++  ++ W F+      
Sbjct: 5   SRPIERGAPRVQRTGPLVWTQKHLFNSPFNSVITIVLGGVIIYALYSMLTWAFIQ----- 59

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWR 118
                                A WA + + + Q++ G YP    WR
Sbjct: 60  ---------------------APWAVVTENFAQYMVGLYPPEFYWR 84


>gi|89070520|ref|ZP_01157809.1| ABC glutamate/glutamine/aspartate/asparagine transporter, inner
           membrane subunit BztC [Oceanicola granulosus HTCC2516]
 gi|89043827|gb|EAR50025.1| ABC glutamate/glutamine/aspartate/asparagine transporter, inner
           membrane subunit BztC [Oceanicola granulosus HTCC2516]
          Length = 662

 Score =  197 bits (501), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 107/229 (46%), Positives = 155/229 (67%), Gaps = 12/229 (5%)

Query: 162 GGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFR 221
           G +GL  VE+  +GG ++ L+I   GII+S+PLGILLALGR S++ ++    + FIE+ R
Sbjct: 441 GSIGLRPVESRDFGGFMLALIIGLSGIILSLPLGILLALGRQSDLFIINKVSVAFIEIIR 500

Query: 222 GVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFE 281
           GVPL+  LF A ++L  FLP   + D LLR ++ V+ FASAYIAEV+RGGL ++  GQ+E
Sbjct: 501 GVPLIVWLFTAQLLLNYFLPPGTNFDLLLRVIIMVTLFASAYIAEVVRGGLAALPTGQYE 560

Query: 282 AANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFS 341
           AA++LGL Y + MRL+++PQ +K  IPGIVNTFIGLFKD++L+  I + D +G+      
Sbjct: 561 AADALGLDYGKSMRLVVLPQALKISIPGIVNTFIGLFKDTTLVVFIGLLDPIGL------ 614

Query: 342 ESTWISSVTPTTGL-----IFIGFVFWIFCFSISLYSVFIEKTLHKGSK 385
            S  I + T   G+     +FIG +F+I CFS+  YS+ +EK L +  +
Sbjct: 615 -SNTIRASTEWNGIYWELFVFIGLLFFICCFSMGRYSLSLEKKLTREHR 662



 Score = 82.0 bits (201), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 47/160 (29%), Positives = 88/160 (55%), Gaps = 6/160 (3%)

Query: 5   CKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWV 64
            +  P+VR+ +L    PP+ ++G++ WI +N   +  +++LT L + ++   +  I+ W 
Sbjct: 6   AQTVPFVRESMLPEQEPPLTEKGVVKWIRENMLSSWLNVILTILSVIVIYLVLAEILPW- 64

Query: 65  FLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFL 124
           FL++VW   + + C  V      P+G   ACWA + +R+ Q I+G YP    WRP L  +
Sbjct: 65  FLNSVWDARSLSECREVFLVIGSPEG-GGACWAVLQERWVQLIYGFYPSDLYWRPNLALI 123

Query: 125 TGSILLTPMLIPSFPRKFLNSILLF-GLFPIFSFFVLYGG 163
              + + P+L   +  +F + +L F  ++P F  ++L+GG
Sbjct: 124 LFFVAVAPVL---YADRFPSWMLWFTAIYPFFMPWLLWGG 160


>gi|163848773|ref|YP_001636817.1| polar amino acid ABC transporter inner membrane subunit
           [Chloroflexus aurantiacus J-10-fl]
 gi|222526723|ref|YP_002571194.1| polar amino acid ABC transporter inner membrane subunit
           [Chloroflexus sp. Y-400-fl]
 gi|163670062|gb|ABY36428.1| polar amino acid ABC transporter, inner membrane subunit
           [Chloroflexus aurantiacus J-10-fl]
 gi|222450602|gb|ACM54868.1| polar amino acid ABC transporter, inner membrane subunit
           [Chloroflexus sp. Y-400-fl]
          Length = 410

 Score =  197 bits (501), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 113/229 (49%), Positives = 160/229 (69%), Gaps = 6/229 (2%)

Query: 158 FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFI 217
            +L GGLGL IVET LWGGLL+TL+++  GI++S PLG+LLALGR S++PV+R  C+ +I
Sbjct: 181 LILRGGLGLPIVETKLWGGLLLTLLLAISGIVLSFPLGVLLALGRRSSLPVIRVFCVLYI 240

Query: 218 ELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISK 277
           EL RGVPLVTVLFM +++LPLF+P    +D L+RA++ V+ F++AY+AE +RGGLQSI K
Sbjct: 241 ELIRGVPLVTVLFMGALLLPLFIPGGESIDALVRAIVAVTLFSAAYLAENVRGGLQSIPK 300

Query: 278 GQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVR 337
           GQ EAA +LGL+  Q   LI +PQ ++ V+P +V  FI LFKD+SL+ II + DLLG  +
Sbjct: 301 GQIEAARALGLNVFQTTLLITLPQALRAVVPVLVGQFIALFKDTSLVVIIGLVDLLGAAQ 360

Query: 338 VNFSESTWISSVTP----TTGLIFIGFVFWIFCFSISLYSVFIEKTLHK 382
               +  W+   TP        + I  ++W+F F++S  S  IE  + +
Sbjct: 361 NIVGQPQWLG--TPGGVWRETFLVIAAIYWVFSFTMSRISKRIEDQIAR 407


>gi|166366535|ref|YP_001658808.1| amino acid ABC-transporter permease protein [Microcystis aeruginosa
           NIES-843]
 gi|166088908|dbj|BAG03616.1| amino acid ABC-transporter permease protein [Microcystis aeruginosa
           NIES-843]
          Length = 331

 Score =  196 bits (498), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 130/357 (36%), Positives = 197/357 (55%), Gaps = 39/357 (10%)

Query: 31  WIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDG 90
           W+ KN F T  +++LT   + L L+     + W                           
Sbjct: 4   WLRKNLFNTWYNVILTLAGLFLSLWGGLSFLDWAI------------------------- 38

Query: 91  WNAACWAFIYDRYEQFIFGNYPMAQRWR--PILVFLTGSILLTPML-------IPSFPRK 141
            N A WA + +    F+ G YP    WR   IL  L    L +  L        P+F ++
Sbjct: 39  -NQAKWAVVTENIGLFVVGRYPEQSIWRIWLILTILAALSLFSWQLNRGRFPNCPAFLQR 97

Query: 142 FLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALG 201
           +   + L  L  I   ++L GGL L  +      GL++TL+++   +I+S PLG+LLALG
Sbjct: 98  WWGLLWLLTLPLI--AWLLLGGLFLKAIPLDDLSGLILTLLVAIASMILSFPLGVLLALG 155

Query: 202 RNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFAS 261
           R S +P +R+  I +IEL RG+PL+ +LFMA +MLPL LP     ++++RA+ G + FA+
Sbjct: 156 RQSELPAIRWLSIGYIELLRGLPLLGILFMAQVMLPLILPAGTRPERVIRAIAGFTLFAA 215

Query: 262 AYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDS 321
           AY+AE +RGGLQ+I KGQ EAA +LGL  +  + LI++PQ +K VIP IV  FI LFKD+
Sbjct: 216 AYLAENVRGGLQAIPKGQIEAAKALGLKPIFVLLLIVLPQALKAVIPAIVGQFISLFKDT 275

Query: 322 SLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEK 378
           SL++I+ + DLLG+     +   +I         +F+ F++WIFC+S+SL S  +E+
Sbjct: 276 SLLAIVGLVDLLGMAGSVLANPKFIGDYPEVY--LFLAFIYWIFCYSMSLASRRLEQ 330


>gi|149925442|ref|ZP_01913706.1| Amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine [Limnobacter sp. MED105]
 gi|149825559|gb|EDM84767.1| Amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine [Limnobacter sp. MED105]
          Length = 332

 Score =  196 bits (498), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 116/286 (40%), Positives = 181/286 (63%), Gaps = 7/286 (2%)

Query: 87  QPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSI 146
           Q  G   ACW  + +++   +FG YP+ ++WR  +V L  S+LL       F  K   + 
Sbjct: 48  QQAGGQGACWGVVAEKWRVILFGRYPLEEQWRAGIVLLLWSVLLFATAARLFKSK--TAF 105

Query: 147 LLFGLFPIFSFFVLYGGLG-LSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSN 205
            L+ L    S  +L+GG+  L  V T+LWGGL +TL++S  G  +++PL +LLALGR S 
Sbjct: 106 SLWALLLPASAVLLHGGVAALPTVPTNLWGGLPLTLILSTVGFALALPLAVLLALGRQSA 165

Query: 206 IPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIA 265
              LR  CIT+IEL R +PLVTVLF+A+ +LPL+LP    +D   R L  ++ F++AY+A
Sbjct: 166 FAPLRRFCITYIELLRALPLVTVLFLAAFVLPLWLPGE-GLDLFTRVLFTIALFSAAYLA 224

Query: 266 EVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLIS 325
           EVLRGGLQ++  GQ +AA +LGL+ +Q+   +++PQ I+  +P ++N+F+ LFK+ SL++
Sbjct: 225 EVLRGGLQAVPAGQGQAAKALGLNRVQRNVHVVLPQAIRACLPSLINSFVTLFKECSLVT 284

Query: 326 IINMFDLLGIVRVNFS-ESTWISSVTPTTGLIFIGFVFWIFCFSIS 370
           I+ +F+L G + +  + +  W S      G +FIG V+W +CF +S
Sbjct: 285 IVALFELTGALSLALAGDVQWRSFY--LEGYLFIGLVYWAYCFGLS 328


>gi|310816974|ref|YP_003964938.1| glutamate/glutamine/aspartate/asparagine transport system
           permeaseprotein BztC [Ketogulonicigenium vulgare Y25]
 gi|308755709|gb|ADO43638.1| glutamate/glutamine/aspartate/asparagine transport system
           permeaseprotein BztC [Ketogulonicigenium vulgare Y25]
          Length = 457

 Score =  195 bits (496), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 103/223 (46%), Positives = 153/223 (68%), Gaps = 2/223 (0%)

Query: 163 GLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRG 222
           G+GL  V +   GG  ++ +I   GI++S+PLGILLALGR SN+ ++    + FIE+ RG
Sbjct: 237 GVGLPGVASRDIGGFTLSFIIGISGIVLSLPLGILLALGRKSNMFIINKLSVAFIEIIRG 296

Query: 223 VPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEA 282
           VPL+  LF AS++L  FLP   + D +LR ++ V+ F++AYIAEV+RGGL +I KGQ+EA
Sbjct: 297 VPLIVWLFTASLLLNYFLPPGSNFDLMLRVIIMVTLFSAAYIAEVVRGGLAAIPKGQYEA 356

Query: 283 ANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSE 342
           A++LGL Y + MRLII+PQ +K  IPGIVNTFIGLFKD++L+  I M D + ++    + 
Sbjct: 357 ADALGLDYWRAMRLIILPQALKISIPGIVNTFIGLFKDTTLVVFIGMMDPVNLLNSIRAN 416

Query: 343 STWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSK 385
           + W          +F+G +F++ CFS+S YS+++EK L +  +
Sbjct: 417 TAWNGIYWEL--FLFVGLMFFVVCFSMSRYSIYLEKRLRREHR 457



 Score = 81.6 bits (200), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 57/184 (30%), Positives = 92/184 (50%), Gaps = 15/184 (8%)

Query: 1   MIDSCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGI 60
           M DS  +  YVR+ +L P  PP  + G  +W+  N F +  +I+LT   +  + + +  +
Sbjct: 1   MADS--KIAYVRETMLPPEAPPGNESGAWSWVRANLFSSWLNIILTIASVYAVYWVVSHV 58

Query: 61  IHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPI 120
             W+ L  +W  S+   C  + +  I   G N AC+A I +R+ Q +FG YP    WR +
Sbjct: 59  APWM-LGGIWNASSLAECRLI-RDEIYGSGANVACFAVITERWPQLLFGFYPRDGYWRIV 116

Query: 121 LVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVT 180
           L F+   I + P+L  S PRK L   L   L P   F +++GG        ++WG + V 
Sbjct: 117 LAFVLFLIAIAPILFQSLPRKMLWFSL---LTPFIMFTLIWGG--------TIWGPVSVI 165

Query: 181 LVIS 184
           + I+
Sbjct: 166 IAIA 169


>gi|119510483|ref|ZP_01629616.1| Amino acid ABC transporter, permease protein, 3-TM
           region,His/Glu/Gln/Arg/opine [Nodularia spumigena
           CCY9414]
 gi|119464905|gb|EAW45809.1| Amino acid ABC transporter, permease protein, 3-TM
           region,His/Glu/Gln/Arg/opine [Nodularia spumigena
           CCY9414]
          Length = 383

 Score =  193 bits (490), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 102/213 (47%), Positives = 154/213 (72%), Gaps = 2/213 (0%)

Query: 169 VETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTV 228
           V T+LW GLL+TL+++   I++S P+G+LLALGR S +PV+R+ CI +IE+ RG+PL+ +
Sbjct: 170 VSTNLWNGLLLTLLMASVSIVLSFPIGVLLALGRTSYLPVVRWFCIFYIEIVRGLPLIGI 229

Query: 229 LFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGL 288
           LF+A +MLPLFLP    +D+LLR + G+  F++AY+AE LRGGLQ+I +GQ EAA +LGL
Sbjct: 230 LFLAQVMLPLFLPTELRLDRLLRGVAGLVLFSAAYMAENLRGGLQAIPRGQVEAAKALGL 289

Query: 289 SYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISS 348
           +    + LII+PQ ++ VIP IV  FIGLFKD+SL+S++ + +L GI R   ++  ++  
Sbjct: 290 NTPLVVILIILPQALRAVIPAIVGQFIGLFKDTSLLSLVGLVELTGISRSILAQPQFLGR 349

Query: 349 VTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
                  +FIG ++WIFC+ +SL S  +E+ L+
Sbjct: 350 YAEVY--LFIGLIYWIFCYLMSLASRRLERQLN 380


>gi|148658093|ref|YP_001278298.1| polar amino acid ABC transporter inner membrane subunit
           [Roseiflexus sp. RS-1]
 gi|148570203|gb|ABQ92348.1| polar amino acid ABC transporter, inner membrane subunit
           [Roseiflexus sp. RS-1]
          Length = 403

 Score =  192 bits (488), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 114/237 (48%), Positives = 165/237 (69%), Gaps = 10/237 (4%)

Query: 152 FPIFSFFVLYGGLG-----LSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNI 206
           FPI   FVL  G+G     +  V T+LWGGLL+TL++S  GI+ S PLG+LLALGR S++
Sbjct: 171 FPIL--FVLVSGVGADDSPIPPVPTNLWGGLLLTLLLSVVGIVFSFPLGVLLALGRQSSL 228

Query: 207 PVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAE 266
           PV+R+ C+ +IEL RGVP ++VLFMA +MLPLFLP    +D+++RA+ GV  F++AY+AE
Sbjct: 229 PVVRWLCVAYIELIRGVPFISVLFMAQLMLPLFLPGI-TIDRVVRAMAGVVIFSAAYLAE 287

Query: 267 VLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISI 326
            +RGGLQSI +GQ+EAA +LGL+  +   LII+PQ ++ VIP +V  FI LFKD+SL+ I
Sbjct: 288 NVRGGLQSIPRGQYEAARALGLNPWKMTLLIILPQALRAVIPILVGQFIALFKDTSLVVI 347

Query: 327 INMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKG 383
           + + DL+GI R   ++  ++          F+ F++ IFC+ +S +S  +E  LH G
Sbjct: 348 VGLLDLMGIARTVLAQPDFLGLQAEV--YTFVAFIYGIFCYLMSAFSQRLEAKLHTG 402



 Score = 45.8 bits (107), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 38/98 (38%), Gaps = 26/98 (26%)

Query: 21  PPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTT 80
           PP  +  I+ W+HKN F T  + LLT +++ L    + G++ W F               
Sbjct: 17  PPTERSSIVRWLHKNLFSTWYNALLTVVMLFLAALIVRGVLEWAF--------------- 61

Query: 81  VSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWR 118
                        A W  I      F+ G YP+A  WR
Sbjct: 62  -----------TQARWEVITANLRLFMVGQYPVAALWR 88


>gi|159026343|emb|CAO86432.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 241

 Score =  191 bits (486), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 100/220 (45%), Positives = 150/220 (68%), Gaps = 2/220 (0%)

Query: 159 VLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIE 218
           +L GGL L  +      GL++TL+++   +I+S PLG+LLALGR S +P +R+  I +IE
Sbjct: 23  LLLGGLFLKAIPLDDLSGLILTLLVAIASMILSFPLGVLLALGRQSELPAIRWLSIGYIE 82

Query: 219 LFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKG 278
           L RG+PL+ +LFMA +MLPL LP     ++++RA+ G + FA+AY+AE +RGGLQ+I KG
Sbjct: 83  LLRGLPLLGILFMAQVMLPLILPAGTRPERVIRAIAGFTLFAAAYLAENVRGGLQAIPKG 142

Query: 279 QFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRV 338
           Q EAA +LGL  +  + LI++PQ +K VIP IV  FI LFKD+SL++I+ + DLLG+   
Sbjct: 143 QIEAARALGLKPIFVLLLIVLPQALKAVIPAIVGQFISLFKDTSLLAIVGLVDLLGMAGS 202

Query: 339 NFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEK 378
             +   +I         +F+ F++WIFC+S+SL S  +E+
Sbjct: 203 VLANPKFIGDYPEVY--LFLAFIYWIFCYSMSLASRRLEQ 240


>gi|298491369|ref|YP_003721546.1| polar amino acid ABC transporter inner membrane subunit ['Nostoc
           azollae' 0708]
 gi|298233287|gb|ADI64423.1| polar amino acid ABC transporter, inner membrane subunit ['Nostoc
           azollae' 0708]
          Length = 340

 Score =  190 bits (482), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 129/366 (35%), Positives = 205/366 (56%), Gaps = 45/366 (12%)

Query: 29  IAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQP 88
           + W+ KN F T  + LLT + +  L + + G + W F                       
Sbjct: 4   VTWLRKNLFSTWYNTLLTIICLYFLFWIVKGCLLWAF----------------------- 40

Query: 89  DGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSF--------PR 140
              + A W  I      F+ G +  +  WR  +V   G I +  ++  S          R
Sbjct: 41  ---DQAQWQVIPVNLHLFLVGRFLQSLYWRIWIVL--GIITILTLITLSLFTKKSNIIKR 95

Query: 141 KFLNSILLFGL------FPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPL 194
           +F  SI  +        FPI + +++ GG GL  V T+LW GLL+TL+++   I++S P+
Sbjct: 96  RFSQSITPWIAPTWLLSFPI-NIWLIGGGFGLQSVSTNLWNGLLLTLLMAIVSIVLSFPI 154

Query: 195 GILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALL 254
           G++LALGR SN+ + R+  I +IE+ RG+P++ +LF+A +MLPLFLP    +D+L+R + 
Sbjct: 155 GVILALGRTSNLFLTRWFSILYIEIVRGLPIIGILFIAQVMLPLFLPTELRLDRLIRGIA 214

Query: 255 GVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTF 314
           G+  F++AY+AE +RGGLQSI +GQ EA+ +LG +    + LII+PQ ++ VIP IV  F
Sbjct: 215 GLVLFSAAYMAENVRGGLQSIPRGQTEASKALGFNTPLVVILIILPQALRAVIPAIVGQF 274

Query: 315 IGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSV 374
           I LFKD+SL+S++ + +L GI R   ++  ++         IFIG ++ +FC+S+SL S 
Sbjct: 275 ISLFKDTSLLSLVGLVELTGIARSILAQPQFLGRYAEVY--IFIGLIYCLFCYSMSLASR 332

Query: 375 FIEKTL 380
            +EK L
Sbjct: 333 KLEKQL 338


>gi|119383547|ref|YP_914603.1| polar amino acid ABC transporter, inner membrane subunit
           [Paracoccus denitrificans PD1222]
 gi|119373314|gb|ABL68907.1| L-glutamate ABC transporter membrane protein / L-asparagine ABC
           transporter membrane protein / L-glutamine ABC
           transporter membrane protein / L-aspartate ABC
           transporter membrane protein [Paracoccus denitrificans
           PD1222]
          Length = 484

 Score =  189 bits (480), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 98/223 (43%), Positives = 153/223 (68%), Gaps = 3/223 (1%)

Query: 164 LGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGV 223
           L L  V +  +GG ++++ I   GI +S+PLG++LAL R S++PV++   + FIE  RGV
Sbjct: 264 LRLRPVSSDQFGGFVLSITIGVAGIALSLPLGVILALARRSDLPVIKLLAVMFIEFIRGV 323

Query: 224 PLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAA 283
           PL+T+LF+AS++L  FLP   + D +LR ++ V+ FA+AY+AEV+RGGL ++ KGQ+EAA
Sbjct: 324 PLITLLFVASLLLNYFLPPGTNFDIILRVIIMVTLFAAAYMAEVIRGGLAALPKGQYEAA 383

Query: 284 NSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSES 343
           ++LGL Y +  RLII+PQ +K  IPGIV+TFIG+FKD++L+  + +FD L  +      S
Sbjct: 384 DALGLDYWKAQRLIILPQALKISIPGIVSTFIGMFKDTTLVVFVGLFDPLKAMADTIRAS 443

Query: 344 -TWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSK 385
             W  +       IF+G +F+I CF +S YS+++E+ L +  +
Sbjct: 444 FEWKGAYWEP--YIFVGAIFFILCFGMSRYSMYLERRLKRDHR 484



 Score = 58.2 bits (139), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/134 (32%), Positives = 68/134 (50%), Gaps = 10/134 (7%)

Query: 5   CKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTAL---IICLLLFSI-PGI 60
            +   YVR+ +L P  PP+ + G I W+ +N F  P +I LT +   I+ L+L ++ P +
Sbjct: 6   SETVAYVRETMLPPEPPPLAESGAIKWLRENLFSGPLNIALTFVGLGIVWLILSTVGPWL 65

Query: 61  IHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPI 120
            H V+         + +  T  QG       + AC+A I  R+ QF+FG YP    WRP+
Sbjct: 66  SHSVWNAGSMAECRQIIAETWGQGA------SGACFALIKHRWNQFMFGFYPQVLYWRPV 119

Query: 121 LVFLTGSILLTPML 134
           L F    + L P+L
Sbjct: 120 LAFGLLFLALAPVL 133


>gi|326204746|ref|ZP_08194601.1| polar amino acid ABC transporter, inner membrane subunit
           [Clostridium papyrosolvens DSM 2782]
 gi|325985117|gb|EGD45958.1| polar amino acid ABC transporter, inner membrane subunit
           [Clostridium papyrosolvens DSM 2782]
          Length = 387

 Score =  189 bits (479), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 125/408 (30%), Positives = 212/408 (51%), Gaps = 76/408 (18%)

Query: 25  QRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQG 84
           +  II W+ KN FG+    ++T L   + +F    ++ ++F+ A                
Sbjct: 7   KSKIIDWLKKNLFGSWISGIVTCLFAIITIFIAKAVLKFIFVTA---------------- 50

Query: 85  GIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWR-----PILVFLTG------------- 126
                      W  I    +  + G Y  ++ WR      ++VFL G             
Sbjct: 51  ----------KWDVIPANLKILMVGQYTASEVWRVWLSLSVVVFLLGVLWGIKRGIIKAV 100

Query: 127 -----SILLTPMLIP---------SFPR--------------KFLNSILLFG-LFPIFSF 157
                +I    +L+P         +F +              KF+      G L  +   
Sbjct: 101 SFSIIAIFAITLLLPFVSIATRVWAFTQILLTLAGFWIGHKFKFIKKYYFLGWLLSVPII 160

Query: 158 FVLYGGLG-LSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITF 216
            +L  G+G +  V T+LWGG L+T++I+   I++S P+G+LLALGR S + V+R+ CI +
Sbjct: 161 LILLNGVGNMKDVNTNLWGGFLLTVLIAVVDIVLSFPIGVLLALGRRSKLVVIRWFCIIY 220

Query: 217 IELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSIS 276
           IE+ RGVPL+TVLF A ++LPLFL +  +++ +LR ++G + F +AY+AE +RGG+Q I 
Sbjct: 221 IEVIRGVPLITVLFGAQLLLPLFLGNGLELNNVLRVMIGFTLFNAAYVAETVRGGMQIIP 280

Query: 277 KGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIV 336
           +GQ+EAA +LGL+Y+Q++  +IMPQ ++ V+P +V + I +FKD+SL++I+++ DLLGI 
Sbjct: 281 QGQYEAAQALGLNYVQRITFVIMPQALRSVVPALVGSVIEVFKDTSLVAIVSLMDLLGIA 340

Query: 337 RVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
           +   +   ++         +F+  VF++ C  IS  S  +E +   G 
Sbjct: 341 KRVVANPQFLGRQMEV--FLFVAAVFFVICTVISKISKRMEVSSSYGK 386


>gi|218198736|gb|EEC81163.1| hypothetical protein OsI_24129 [Oryza sativa Indica Group]
          Length = 180

 Score =  188 bits (478), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 93/178 (52%), Positives = 127/178 (71%), Gaps = 2/178 (1%)

Query: 206 IPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIA 265
           +PV+R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV  F SAY+A
Sbjct: 1   MPVVRVLSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTTIDKLIRALVGVILFQSAYVA 60

Query: 266 EVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLIS 325
           EV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I LFKD+SL+ 
Sbjct: 61  EVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTIIALFKDTSLVI 120

Query: 326 IINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKG 383
           II +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  +EK  + G
Sbjct: 121 IIGLFDLFSSVQQATVDPVWLG--MSTEGYVFAALIYWIFCFSMSRYSQHLEKRFNTG 176


>gi|312972460|ref|ZP_07786634.1| general L-amino acid transport system permease aapM domain protein
           [Escherichia coli 1827-70]
 gi|310334837|gb|EFQ01042.1| general L-amino acid transport system permease aapM domain protein
           [Escherichia coli 1827-70]
          Length = 180

 Score =  188 bits (477), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 92/178 (51%), Positives = 127/178 (71%), Gaps = 2/178 (1%)

Query: 206 IPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIA 265
           +P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV  F SAY+A
Sbjct: 1   MPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVGVILFQSAYVA 60

Query: 266 EVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLIS 325
           EV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I LFKD+SL+ 
Sbjct: 61  EVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTIIALFKDTSLVI 120

Query: 326 IINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKG 383
           II +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  +EK  + G
Sbjct: 121 IIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQHLEKRFNTG 176


>gi|78779549|ref|YP_397661.1| amino acid ABC transporter permease [Prochlorococcus marinus str.
           MIT 9312]
 gi|78713048|gb|ABB50225.1| amino acid ABC transporter membrane protein 2, PAAT family
           [Prochlorococcus marinus str. MIT 9312]
          Length = 343

 Score =  188 bits (477), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 112/294 (38%), Positives = 183/294 (62%), Gaps = 11/294 (3%)

Query: 96  WAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSF-PR-KFLNSILLFGLFP 153
           W  +      + FG++P+ Q+WRP L F +   LL+   I  + P+ K+L   L+FG   
Sbjct: 54  WEVVTSNLNLYAFGSFPIDQQWRPTLWFFS---LLSITFITVYGPKWKWLRKNLIFGWIG 110

Query: 154 I--FSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRY 211
                 ++L GGLGL+ V T  WGGL +T++I+   I+ S+P+GILLAL R S+I +++ 
Sbjct: 111 TVPLGIYLLSGGLGLNPVMTRHWGGLTLTILITSCSILFSLPIGILLALCRRSSIFLIQK 170

Query: 212 ACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGG 271
           +   +I++ R VPL++VLF   +++PLFLP   ++D++ RA++  + F SAYIAE ++GG
Sbjct: 171 SSSLYIDVMRAVPLISVLFFGQLLIPLFLPVGLEIDRVWRAVIAFTFFVSAYIAEDIKGG 230

Query: 272 LQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFD 331
           LQSI K Q EAA SLGL+  Q    I++PQ ++  +P I N  IGLF+++SL++I+ + +
Sbjct: 231 LQSIPKNQIEAAKSLGLNKYQINIYILIPQALRVALPAITNQLIGLFQNTSLMAILGLME 290

Query: 332 LLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEK--TLHKG 383
           LLG+ R   +   +I         I++  V+W+FC  ++  S  +E+  T++KG
Sbjct: 291 LLGVSRSILANPEFIGQYIEV--YIWLASVYWLFCTIMAFVSKKLEQKMTINKG 342


>gi|172039038|ref|YP_001805539.1| amino acid ABC transporter permease, His/Glu/Gln/Arg/opine
           [Cyanothece sp. ATCC 51142]
 gi|171700492|gb|ACB53473.1| amino acid ABC transporter permease protein, His/Glu/Gln/Arg/opine
           [Cyanothece sp. ATCC 51142]
          Length = 391

 Score =  188 bits (477), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 128/408 (31%), Positives = 203/408 (49%), Gaps = 85/408 (20%)

Query: 29  IAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQP 88
           +AWI KN F +  + LLT + +  + +   G+I+W F  A                    
Sbjct: 12  VAWIKKNLFNSWFNSLLTIISLIFIYWVSSGLINWAFFQA-------------------- 51

Query: 89  DGWNAACWAFIYDRYEQFIFGNYPMAQRWRP-----ILVFLTG---------SILLTPM- 133
                  W  +      F  G YP    WR      I++ L G         +    P+ 
Sbjct: 52  ------QWGVLSANLRLFFVGQYPANLLWRAWTSLAIIISLVGLSWGTLSPKNNFFNPVK 105

Query: 134 -----------LIPSFPRKFLNSILLFGLFPIFSFFVL---------------------- 160
                      ++ + P   ++S +L  +  +F  FV+                      
Sbjct: 106 LTLLGLIALLSVLLAIPISLISSAMLLAILFLFIIFVVLGQQISQTFPNFKNWLSLLWFI 165

Query: 161 ---------YGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRY 211
                     G   L  V    + GL++T+ ++   I++S P GILLALGR SN+PV+R+
Sbjct: 166 TFFLLLGLLQGAFFLRDVRLDDFSGLILTIFVAVISIVLSFPFGILLALGRQSNLPVIRW 225

Query: 212 ACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGG 271
             I +IEL RG+PL+ +LFMA +MLPL LP    + +++RA+ G + F++AY+AE +RGG
Sbjct: 226 LSIGYIELIRGLPLIGILFMAQVMLPLILPQEMRIQRVVRAIAGFTLFSAAYLAENVRGG 285

Query: 272 LQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFD 331
           LQS+ KGQ EAA ++GL+    + L+++PQ ++ VIP IV  FI LFKD+SL++I+ + D
Sbjct: 286 LQSVPKGQIEAAKAVGLNGFFVLILVVLPQALRVVIPTIVGQFISLFKDTSLLAIVGLVD 345

Query: 332 LLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKT 379
           LLGI +   +   +I +       +F+  ++WIFC+S+SL S  +EKT
Sbjct: 346 LLGISQSILANPKFIGTYGEVY--LFVAAIYWIFCYSMSLLSRKLEKT 391


>gi|218437715|ref|YP_002376044.1| polar amino acid ABC transporter inner membrane protein [Cyanothece
           sp. PCC 7424]
 gi|218170443|gb|ACK69176.1| polar amino acid ABC transporter, inner membrane subunit
           [Cyanothece sp. PCC 7424]
          Length = 402

 Score =  187 bits (476), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 102/226 (45%), Positives = 154/226 (68%), Gaps = 2/226 (0%)

Query: 157 FFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITF 216
           +++L GGL L +V  SL  GL++TL ++   I++S P G+LLALGR S++PV+R+  I +
Sbjct: 179 WWLLRGGLFLDLVPLSLISGLILTLSVAIVSIVLSFPFGVLLALGRQSSLPVIRWLSIAY 238

Query: 217 IELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSIS 276
           IEL RG PL+ +LFMA +MLPL LP     D ++RA+ G + F++AY+AE +RGGLQS+ 
Sbjct: 239 IELIRGFPLIGILFMAQVMLPLVLPLGVRPDSIVRAIAGFTLFSAAYLAENVRGGLQSVP 298

Query: 277 KGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIV 336
           +GQ EAA +LGL+ L  + LI++PQ +K VIP +V  FI LFKD+SL++I+ + DLLGI 
Sbjct: 299 RGQTEAAKALGLNPLLVLSLIVLPQALKAVIPTLVGQFISLFKDTSLLAIVGLVDLLGIS 358

Query: 337 RVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHK 382
           +   +   +          +FIGF++W+ C ++SL S  IE  + +
Sbjct: 359 QSILANPKYQGRNVEVY--LFIGFMYWLCCSAMSLASRKIETKMSQ 402


>gi|218248365|ref|YP_002373736.1| polar amino acid ABC transporter inner membrane subunit [Cyanothece
           sp. PCC 8801]
 gi|218168843|gb|ACK67580.1| polar amino acid ABC transporter, inner membrane subunit
           [Cyanothece sp. PCC 8801]
          Length = 401

 Score =  187 bits (475), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 106/236 (44%), Positives = 158/236 (66%), Gaps = 6/236 (2%)

Query: 150 GLFPIFSFFVL----YGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSN 205
           GL  + +FFVL     GGL L  V+   + GL++TL+ +   I++S P GILLALGR S+
Sbjct: 168 GLCWLITFFVLLWLLQGGLFLETVKLDNFSGLILTLLTAIVSIVLSFPFGILLALGRQSS 227

Query: 206 IPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIA 265
           + V+R+  I +IE+ RG+PL+ +LFMA IMLPL LP     D+++RA+ G + F++AY+A
Sbjct: 228 LNVIRWLSIAYIEVIRGLPLIGILFMAQIMLPLILPVGSRPDRVIRAIAGFTLFSAAYLA 287

Query: 266 EVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLIS 325
           E +RGGLQS+ KGQ EAA +LGL+ +  +  I++PQ +K VIP IV  FI LFKD+SL++
Sbjct: 288 ENVRGGLQSVPKGQIEAAKALGLNPIFVLIFIVLPQALKAVIPSIVGQFISLFKDTSLLA 347

Query: 326 IINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
           I+ + DLLGI +   +   +I         +FI  ++WIFC+S+S  S  +E+ L+
Sbjct: 348 IVGLVDLLGISQSILANPKFIGRYGEVY--LFIAVIYWIFCYSMSWASRKLEQKLN 401


>gi|257060311|ref|YP_003138199.1| polar amino acid ABC transporter inner membrane subunit [Cyanothece
           sp. PCC 8802]
 gi|256590477|gb|ACV01364.1| polar amino acid ABC transporter, inner membrane subunit
           [Cyanothece sp. PCC 8802]
          Length = 401

 Score =  186 bits (471), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 105/236 (44%), Positives = 158/236 (66%), Gaps = 6/236 (2%)

Query: 150 GLFPIFSFFVL----YGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSN 205
           GL  + +FFVL     GGL L  V+   + GL++TL+ +   I++S P GILLALGR S+
Sbjct: 168 GLCWLITFFVLLWLLQGGLFLETVKLDNFSGLILTLLTAIVSIVLSFPFGILLALGRQSS 227

Query: 206 IPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIA 265
           + V+R+  I +IE+ RG+PL+ +LFMA IMLPL LP     ++++RA+ G + F++AY+A
Sbjct: 228 LNVIRWLSIAYIEVIRGLPLIGILFMAQIMLPLILPVGSRPERVIRAIAGFTLFSAAYLA 287

Query: 266 EVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLIS 325
           E +RGGLQS+ KGQ EAA +LGL+ +  +  I++PQ +K VIP IV  FI LFKD+SL++
Sbjct: 288 ENVRGGLQSVPKGQIEAAKALGLNPIFVLIFIVLPQALKAVIPSIVGQFISLFKDTSLLA 347

Query: 326 IINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
           I+ + DLLGI +   +   +I         +FI  ++WIFC+S+S  S  +E+ L+
Sbjct: 348 IVGLVDLLGISQSILANPKFIGRYGEVY--LFIAVIYWIFCYSMSWASRKLEQKLN 401


>gi|81299059|ref|YP_399267.1| amino acid ABC transporter permease [Synechococcus elongatus PCC
           7942]
 gi|81167940|gb|ABB56280.1| Amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine [Synechococcus elongatus PCC 7942]
          Length = 396

 Score =  186 bits (471), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 92/212 (43%), Positives = 147/212 (69%), Gaps = 2/212 (0%)

Query: 169 VETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTV 228
           V ++ W GLL+TL  +   ++ S+PLGILLALGR S++P +R+  +T+IELFRG+PLVT+
Sbjct: 183 VSSNDWSGLLLTLATALISMVCSLPLGILLALGRQSSLPAIRWLSVTYIELFRGLPLVTI 242

Query: 229 LFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGL 288
           LF   +M+PL L   W +D++LRA++G++ F SAY+AE +RGGLQ+I +GQFEAA +LGL
Sbjct: 243 LFFGQVMVPLMLDSEWRIDRILRAIVGLTIFLSAYLAETVRGGLQAIPQGQFEAAAALGL 302

Query: 289 SYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISS 348
           +  Q  R I++PQ ++  IP IV  F+ L +D++L+SI+ + +LLGI R   +   ++  
Sbjct: 303 NLFQTYRFIVLPQALRISIPAIVGLFLNLLQDTTLLSIVGLLELLGISRSILANPAYLGR 362

Query: 349 VTPTTGLIFIGFVFWIFCFSISLYSVFIEKTL 380
                  +F+G ++W+ C+ ++  S  +E+ L
Sbjct: 363 YAEV--YLFLGVLYWLCCYGLAQLSRRLEQRL 392


>gi|126659707|ref|ZP_01730836.1| Amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine [Cyanothece sp. CCY0110]
 gi|126619052|gb|EAZ89792.1| Amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine [Cyanothece sp. CCY0110]
          Length = 391

 Score =  185 bits (470), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 93/204 (45%), Positives = 144/204 (70%), Gaps = 2/204 (0%)

Query: 175 GGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASI 234
            GL++T+ ++   II+S P G+LLALGR SN+P++R+  I++IEL RG+PL+ +LFMA +
Sbjct: 189 SGLILTVFVAIISIILSFPFGVLLALGRQSNLPIIRWLSISYIELIRGLPLIGILFMAQV 248

Query: 235 MLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKM 294
           MLPL LP    + +++RA+ G + F++AY+AE +RGGLQS+ +GQ EAA +LGL+    +
Sbjct: 249 MLPLILPQEMRIQRVIRAIAGFTLFSAAYLAENVRGGLQSVPQGQTEAAKALGLNTFFVL 308

Query: 295 RLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTG 354
            L+++PQ ++ VIP IV  FI LFKD+SL++I+ + DLLGI +   +   +I        
Sbjct: 309 ILVVLPQALRVVIPTIVGQFISLFKDTSLLAIVGLVDLLGISQSILANPKFIGRYGEVY- 367

Query: 355 LIFIGFVFWIFCFSISLYSVFIEK 378
            IF+  ++WIFC+S+SL S  +EK
Sbjct: 368 -IFVAAIYWIFCYSMSLISRQLEK 390


>gi|297624236|ref|YP_003705670.1| polar amino acid ABC transporter inner membrane subunit [Truepera
           radiovictrix DSM 17093]
 gi|297165416|gb|ADI15127.1| polar amino acid ABC transporter, inner membrane subunit [Truepera
           radiovictrix DSM 17093]
          Length = 408

 Score =  185 bits (470), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 104/243 (42%), Positives = 158/243 (65%), Gaps = 18/243 (7%)

Query: 156 SFFVLYGGLGLS-----IVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLR 210
           +FF+LYG  G+      +V T  WGG+++T V+SF GI +S P+G+ LALGR S +P ++
Sbjct: 171 AFFLLYGLPGVRSGPWRVVPTREWGGMMLTFVLSFVGIGVSFPIGVALALGRRSKLPAIK 230

Query: 211 YACITFIELFRGVPLVTVLFMASIMLPLFL---PDTWDVDKLLRALLGVSAFASAYIAEV 267
             CI +IE+ RG PL++ LF+AS+M+PL     P+   V  L RAL+ ++ F++AY+AE 
Sbjct: 231 LFCIAYIEIIRGAPLISWLFIASLMVPLIFNVGPE--RVSALTRALVALTLFSAAYMAEN 288

Query: 268 LRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISII 327
           +RGGLQ++ KGQ EAA +LGLS  Q MRLII+PQ +K VIP IV   IGLFKD+SL+ I+
Sbjct: 289 VRGGLQAVPKGQSEAARALGLSGWQAMRLIILPQALKAVIPAIVGQAIGLFKDTSLVLIV 348

Query: 328 NMFDLLGIVRVNFSESTWISSVTPTTGL-----IFIGFVFWIFCFSISLYSVFIEKTLHK 382
            + D   +  +   ++   +S+    G+     +F+  V+W F + +S+ S  +EK L  
Sbjct: 349 GLADFFQVHNIVAQQN---ASLQVVGGIRLELSLFLAVVYWFFAYRMSVASRQLEKELGV 405

Query: 383 GSK 385
           G++
Sbjct: 406 GTR 408


>gi|56751274|ref|YP_171975.1| amino acid ABC transporter permease [Synechococcus elongatus PCC
           6301]
 gi|56686233|dbj|BAD79455.1| permease protein of amino acid ABC transporter [Synechococcus
           elongatus PCC 6301]
          Length = 396

 Score =  185 bits (470), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 92/212 (43%), Positives = 146/212 (68%), Gaps = 2/212 (0%)

Query: 169 VETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTV 228
           V ++ W GLL+TL  +   ++ S+PLGILLALGR S++P +R+  +T+IELFRG+PLVT+
Sbjct: 183 VSSNDWSGLLLTLATALISMVCSLPLGILLALGRQSSLPAIRWLSVTYIELFRGLPLVTI 242

Query: 229 LFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGL 288
           LF   +M+PL L   W +D++LRA++G++ F SAY+AE +RGGLQ+I +GQFEAA +LGL
Sbjct: 243 LFFGQVMVPLMLDSEWRIDRILRAIVGLTIFLSAYLAETVRGGLQAIPQGQFEAAAALGL 302

Query: 289 SYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISS 348
              Q  R I++PQ ++  IP IV  F+ L +D++L+SI+ + +LLGI R   +   ++  
Sbjct: 303 DLFQTYRFIVLPQALRISIPAIVGLFLNLLQDTTLLSIVGLLELLGISRSILANPAYLGR 362

Query: 349 VTPTTGLIFIGFVFWIFCFSISLYSVFIEKTL 380
                  +F+G ++W+ C+ ++  S  +E+ L
Sbjct: 363 YAEV--YLFLGVLYWLCCYGLAQLSRRLEQRL 392


>gi|220910018|ref|YP_002485329.1| polar amino acid ABC transporter inner membrane subunit [Cyanothece
           sp. PCC 7425]
 gi|219866629|gb|ACL46968.1| polar amino acid ABC transporter, inner membrane subunit
           [Cyanothece sp. PCC 7425]
          Length = 341

 Score =  185 bits (469), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 138/364 (37%), Positives = 204/364 (56%), Gaps = 38/364 (10%)

Query: 20  LPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCT 79
           LPP  +     W+ +N F T  + LLT  + C    +I  I+ ++F  A+          
Sbjct: 10  LPPDSRLTPYQWLQRNLFNTWYNSLLT--LTCA--GTIAAILWFMFNWAI---------- 55

Query: 80  TVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFP 139
                         A WA +     +F+ G YP A  WR  LV      L+  M I    
Sbjct: 56  ------------TQAEWAVVQQNLPRFLVGRYPPALYWRLWLVL----ALVVGMGIWIAS 99

Query: 140 RKFLNSIL-LFGL-FPIFSFFVLYGGLGL----SIVETSLWGGLLVTLVISFFGIIISMP 193
           RK   + L L  L  P   F V+   +G     + V+T+LW GLL+TL++S   I+++ P
Sbjct: 100 RKKAQTKLNLVNLALPALLFLVMLWLIGGGLGLTPVKTNLWNGLLLTLLLSAVSIVLAFP 159

Query: 194 LGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRAL 253
           LG+LLALGR S++P+LR    T+IE+ RG+PL+ VLFMA +MLPL LP    +D+LLRA+
Sbjct: 160 LGVLLALGRQSSLPLLRGFSTTYIEILRGLPLIGVLFMAQVMLPLVLPADLRLDRLLRAI 219

Query: 254 LGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNT 313
            G+  F +AY+AE +RGGLQS+ +GQ EAA +LG +    + LI++PQ ++ VIP IV  
Sbjct: 220 AGLVLFNAAYLAENVRGGLQSVPRGQIEAAQALGFNIPLTLLLIVLPQALRTVIPAIVGQ 279

Query: 314 FIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYS 373
           FI L KD+SL+S+  + +L GI R   ++  ++   T     +FIG ++W FCF++S YS
Sbjct: 280 FISLIKDTSLLSLFALLELTGIARSILAQPQFLGHYTEV--YLFIGLIYWFFCFTLSHYS 337

Query: 374 VFIE 377
             +E
Sbjct: 338 RRLE 341


>gi|319782289|ref|YP_004141765.1| binding-protein-dependent transport systems inner membrane
           component [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317168177|gb|ADV11715.1| binding-protein-dependent transport systems inner membrane
           component [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 359

 Score =  184 bits (468), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 111/357 (31%), Positives = 187/357 (52%), Gaps = 17/357 (4%)

Query: 32  IHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGW 91
           + + FF TP   +++   + +++F +  +++W    AV+  S        + G       
Sbjct: 17  LRRRFFATPLQAVVSLACLTIMVFLVWKLLNWAVFSAVFTTSGGPEACQATAG------- 69

Query: 92  NAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSF--PRKFLNSILLF 149
             ACW+ I  R+    FG YP  ++WR  L  +   ++     IP+F   R+     L++
Sbjct: 70  --ACWSVIAARWRIIFFGLYPYEEQWRSALACVAVVVMTVLSCIPAFWTGRRI---ALVW 124

Query: 150 GLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPV 208
           G      + ++ GG LGL+ V    WGGL +TL I     +I  PL I LAL R S +P 
Sbjct: 125 GAGTGLFYVLMKGGVLGLAHVGEEAWGGLALTLFIFVTTCLIGFPLAICLALLRRSELPW 184

Query: 209 LRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVL 268
           +       I+  R +PL+++LF  +++LP  LP     DKL R +LG + F SAY AE++
Sbjct: 185 ISRTTGLIIDGVRSLPLISILFTFAVVLPFALPQWLQGDKLYRVILGSALFFSAYQAEIV 244

Query: 269 RGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIIN 328
           RGG+Q ++ GQ EAA +LG+ Y Q++  I++PQ ++  +P  +N F+  FK++SL+ I+ 
Sbjct: 245 RGGMQGVATGQEEAAMALGMRYWQRISRILLPQAMRNAMPATINQFVISFKETSLVVIVG 304

Query: 329 MFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSK 385
            F++L      +    W  +        FI F+++IF FS+S Y  F+E+ +    +
Sbjct: 305 FFEILASGNAAYGTGEWRFAYVEVYA--FIAFIYFIFVFSLSRYGAFLERRMSVSER 359


>gi|67923501|ref|ZP_00516976.1| Amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine [Crocosphaera watsonii WH 8501]
 gi|67854643|gb|EAM49927.1| Amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine [Crocosphaera watsonii WH 8501]
          Length = 391

 Score =  184 bits (467), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 131/384 (34%), Positives = 204/384 (53%), Gaps = 39/384 (10%)

Query: 29  IAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVW--IGSN-RTVCTTVSQGG 85
           I WI KN F    + LLT + +  + +   G+I W    A W  IG N R          
Sbjct: 12  INWIKKNLFSNWFNSLLTLVSLSFIFWVGSGLISWAIFQAQWGVIGDNLRLFFVGQYPVS 71

Query: 86  IQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNS 145
           +    W +    F    +       Y  +  ++PI +F+ GSI +   L+ S P   ++S
Sbjct: 72  LLWRAWTSLAIIFSLIGFSWGTIKYY--SNLFKPINLFILGSITVFITLL-SIPVSLVSS 128

Query: 146 ---------ILLFGL--------FPIFSFFV--------------LYGGLGLSIVETSLW 174
                    +++F L         P FS ++              L G   L  V    +
Sbjct: 129 AKLLGILLLLVIFALIGQQTSKKLPTFSNWLSLIWVLTFFLLLGLLQGAFFLRPVRLDDF 188

Query: 175 GGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASI 234
            GL++TL ++   II+S P G+LLALGR S +PV+R+  I +IEL RG+PL+ +LFMA +
Sbjct: 189 SGLILTLFVAIISIILSFPFGVLLALGRQSELPVIRWLSIAYIELIRGLPLIGILFMAQV 248

Query: 235 MLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKM 294
           MLPL LP    + +++RA+ G + F++AY+AE +RGGLQS+ KGQ EAA +LGL+    +
Sbjct: 249 MLPLILPQDMRIQRVIRAIAGFTLFSAAYLAENVRGGLQSVPKGQTEAAKALGLNGFFVL 308

Query: 295 RLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTG 354
             +++PQ ++ VIP IV  FI LFKD+SL++I+ + DLLG+ +   +   +I        
Sbjct: 309 IFVVLPQALRVVIPAIVGQFISLFKDTSLLAIVGLVDLLGMSQSILANPKFIGRYGEVY- 367

Query: 355 LIFIGFVFWIFCFSISLYSVFIEK 378
            IF+  ++W+FC+S+SL S  +E 
Sbjct: 368 -IFVAAIYWVFCYSMSLLSRQLEN 390


>gi|72382451|ref|YP_291806.1| amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine [Prochlorococcus marinus str.
           NATL2A]
 gi|72002301|gb|AAZ58103.1| amino acid ABC transporter membrane protein 2, PAAT family
           [Prochlorococcus marinus str. NATL2A]
          Length = 344

 Score =  183 bits (465), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 104/290 (35%), Positives = 179/290 (61%), Gaps = 7/290 (2%)

Query: 94  ACWAFIYDRYEQFIFGNYPMAQRWRP---ILVFLTGSILLTPMLIPSFPRKFLNSILLFG 150
           A W  +      + FG++P  ++WRP   I+  L+ SI         + RK L  IL  G
Sbjct: 52  ANWKVVISNLPLYAFGSFPSNEQWRPATWIISLLSLSIFTLYGPEWKWLRKHL-LILWVG 110

Query: 151 LFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLR 210
             P+   ++LYGG+GLS + +  WGGL +T++++    ++S+P+GI+LAL R+S++P+++
Sbjct: 111 TIPL-GLYLLYGGIGLSPIMSRQWGGLTLTILLTVCSSLLSLPIGIILALCRHSSLPIIQ 169

Query: 211 YACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRG 270
                FI++ R +PL+ VLF   +++PLFLP   ++D++ RA+   + F SAYIAE +RG
Sbjct: 170 KLSSIFIDVMRAIPLIAVLFFGQLLIPLFLPVEIEIDRVWRAIFAFTLFVSAYIAEDIRG 229

Query: 271 GLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMF 330
           GLQSI   Q EAANSLGL+  Q ++ I++PQ ++  +P + N  IGLF+++SL++I+ + 
Sbjct: 230 GLQSIPNTQIEAANSLGLNQYQIIQFILIPQALRIALPALTNQSIGLFQNTSLMAILGLV 289

Query: 331 DLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTL 380
           +LLGI R   +   +I         +++  V+WI C  +++ +  +E+ +
Sbjct: 290 ELLGIGRSILANPEFIGQYIEV--YVWLACVYWIVCTIMAVLARHLEQRM 337


>gi|123966463|ref|YP_001011544.1| ABC transporter for amino acids, membrane component
           [Prochlorococcus marinus str. MIT 9515]
 gi|123200829|gb|ABM72437.1| ABC transporter for amino acids, membrane component
           [Prochlorococcus marinus str. MIT 9515]
          Length = 339

 Score =  182 bits (462), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 109/296 (36%), Positives = 179/296 (60%), Gaps = 11/296 (3%)

Query: 94  ACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKF--LNSILLFGL 151
           + W  +      + FG++P+ ++WRP L FL+   LL+   I  +  K+  L   L+FG 
Sbjct: 48  SNWKVVTSNLNLYAFGSFPINEQWRPTLWFLS---LLSITFITVYGPKWNWLRKNLIFGW 104

Query: 152 FPI--FSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVL 209
                   ++L GGLGL  V T  WGGL +T++I+   I+ S+P+GI+LAL R S++ ++
Sbjct: 105 MGTVPLGIYLLNGGLGLVPVMTRHWGGLTLTILITSCSILFSLPIGIVLALCRRSSMFLI 164

Query: 210 RYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLR 269
           +     +I++ R VPL+ VLF   +++PLFLP   +++++ RA++  + F SAYIAE +R
Sbjct: 165 QKLSSFYIDVMRAVPLIAVLFFGQLLIPLFLPVGLEIERVWRAIIAFTLFVSAYIAEDIR 224

Query: 270 GGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINM 329
           GGLQSI   Q EAA SLGL+  Q    I++PQ ++  +P I N  IGLF+++SL+SI+ +
Sbjct: 225 GGLQSIPNNQIEAAKSLGLNKYQVNIFILIPQALRVALPAITNQLIGLFQNTSLMSILGL 284

Query: 330 FDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEK--TLHKG 383
            +LLG+ R   +   +I         I++  V+W+FC  ++  S  +E+  T++KG
Sbjct: 285 MELLGVSRSILANPEFIGQYIEV--YIWLASVYWLFCTVMAFVSKKLEQRMTINKG 338


>gi|124026132|ref|YP_001015248.1| amino acid ABC transporter permease [Prochlorococcus marinus str.
           NATL1A]
 gi|123961200|gb|ABM75983.1| Amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine [Prochlorococcus marinus str.
           NATL1A]
          Length = 344

 Score =  180 bits (457), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 103/290 (35%), Positives = 178/290 (61%), Gaps = 7/290 (2%)

Query: 94  ACWAFIYDRYEQFIFGNYPMAQRWRP---ILVFLTGSILLTPMLIPSFPRKFLNSILLFG 150
           A W  +      + FG++P  ++WRP   I+  L+ SI         + RK L  I+  G
Sbjct: 52  ANWKVVISNLPLYAFGSFPSNEQWRPATWIISLLSLSIFTLYGPEWKWLRKNL-LIVWVG 110

Query: 151 LFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLR 210
             P+   ++LYGG+GLS + +  WGGL +T++++    + S+P+GI+LAL R+S++P+++
Sbjct: 111 TIPL-GLYLLYGGIGLSPIMSRQWGGLTLTILLTVCSSLFSLPIGIVLALCRHSSLPIIQ 169

Query: 211 YACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRG 270
                FI++ R +PL+ VLF   +++PLFLP   ++D++ RA+   + F SAYIAE +RG
Sbjct: 170 KLSSIFIDVMRAIPLIAVLFFGQLLIPLFLPVEIEIDRVWRAIFAFTLFVSAYIAEDIRG 229

Query: 271 GLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMF 330
           GLQSI   Q EAANSLGL+  Q ++ I++PQ ++  +P + N  IGLF+++SL++I+ + 
Sbjct: 230 GLQSIPNTQIEAANSLGLNQYQIIQFILIPQALRIALPALTNQSIGLFQNTSLMAILGLV 289

Query: 331 DLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTL 380
           +LLGI R   +   +I         +++  V+WI C  +++ +  +E+ +
Sbjct: 290 ELLGIGRSILANPEFIGQYIEV--YVWLACVYWIVCTIMAVLARHLEQRM 337


>gi|254230449|ref|ZP_04923827.1| hypothetical protein VEx25_B0033 [Vibrio sp. Ex25]
 gi|151937020|gb|EDN55900.1| hypothetical protein VEx25_B0033 [Vibrio sp. Ex25]
          Length = 218

 Score =  180 bits (457), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 92/223 (41%), Positives = 139/223 (62%), Gaps = 13/223 (5%)

Query: 17  QPSLPPVYQR-GIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNR 75
           QP LPP     G + W+ KN F  P + ++T ++  L+  +I  I+ W F++A WIGS R
Sbjct: 7   QPDLPPPANTVGFVGWMRKNLFNGPVNSIVTVILAYLVFSAIWHIVDWAFINADWIGSTR 66

Query: 76  TVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLI 135
             C+              ACW FI  R+EQF++G YP ++ WRP L ++T +I    +  
Sbjct: 67  DDCSR-----------EGACWVFISVRWEQFMYGFYPESELWRPRLFYITLAIFTVLLAY 115

Query: 136 PSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPL 194
              P++    +    ++P     +LYGG+ GL +V+T  WGGLLVTL+I+  GI++S+P+
Sbjct: 116 EKTPKRIWIWLFFVNIYPFIIAGLLYGGIFGLEVVDTHKWGGLLVTLIIALVGIVVSLPI 175

Query: 195 GILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLP 237
           G++LALGR S +P++R  C  +IE++RGVPL+TVLFMAS+MLP
Sbjct: 176 GVVLALGRRSEMPIIRSICTVYIEVWRGVPLITVLFMASVMLP 218


>gi|313902270|ref|ZP_07835675.1| polar amino acid ABC transporter, inner membrane subunit
           [Thermaerobacter subterraneus DSM 13965]
 gi|313467421|gb|EFR62930.1| polar amino acid ABC transporter, inner membrane subunit
           [Thermaerobacter subterraneus DSM 13965]
          Length = 375

 Score =  180 bits (456), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 91/210 (43%), Positives = 138/210 (65%), Gaps = 2/210 (0%)

Query: 176 GLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIM 235
           GL++TLV++  GI +S PLG+LLALGR S++PV+R   I +IEL RG PL+ VLF +   
Sbjct: 168 GLILTLVLAVAGITLSFPLGVLLALGRVSSLPVVRALSIAYIELVRGTPLMVVLFFSMTA 227

Query: 236 LPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMR 295
           LPLFLP +   D + RA  G+  F +AY+AE +RGGLQ + +GQ EAA +LGL+  Q + 
Sbjct: 228 LPLFLPPSVRPDLVTRAAAGLVLFTAAYVAEAVRGGLQGVPRGQVEAAQALGLTGTQAVL 287

Query: 296 LIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGL 355
           LII+PQ ++ VIP +V  FI LFKD+SL+++  + + +G+ +   S  +++         
Sbjct: 288 LIILPQALRAVIPALVGQFISLFKDTSLVAVWGLLEFVGVAQSVLSNPSYLGRHVEMYA- 346

Query: 356 IFIGFVFWIFCFSISLYSVFIEKTLHKGSK 385
            F+  V+W+FC+ +SL S  +E+ L  G +
Sbjct: 347 -FVAAVYWVFCYGMSLASRRLERRLGVGER 375


>gi|307150942|ref|YP_003886326.1| polar amino acid ABC transporter inner membrane subunit [Cyanothece
           sp. PCC 7822]
 gi|306981170|gb|ADN13051.1| polar amino acid ABC transporter, inner membrane subunit
           [Cyanothece sp. PCC 7822]
          Length = 398

 Score =  180 bits (456), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 99/222 (44%), Positives = 150/222 (67%), Gaps = 2/222 (0%)

Query: 157 FFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITF 216
           +++L GGL L  V  SL  G ++T+V++   I +  P G+LLALGR S++PV+R+  I +
Sbjct: 176 WWLLRGGLFLQPVSLSLISGFILTIVVAIVSIFLCFPFGVLLALGRQSSLPVIRWLSIGY 235

Query: 217 IELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSIS 276
           IE+ RG+PL+ +LFMA +MLPL LP     D ++RA+ G + F++AY+AE +RGGLQS+ 
Sbjct: 236 IEIIRGLPLIGILFMAQVMLPLVLPLGVRPDSIVRAIAGYTIFSAAYLAENIRGGLQSVP 295

Query: 277 KGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIV 336
           +GQ EAA +LGL+ L  + LII+PQ +K VIP IV  FI LFKD+SL++I+ + DLLGI 
Sbjct: 296 RGQTEAAIALGLNPLLVLGLIILPQALKAVIPTIVGQFISLFKDTSLLAIVGLVDLLGIS 355

Query: 337 RVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEK 378
           +   +   +          +FI F++W+ C ++SL S  +E+
Sbjct: 356 QSILANPKYQGRNVEV--YLFIAFIYWLCCSAMSLASRKLEQ 395


>gi|289678216|ref|ZP_06499106.1| amino acid ABC transporter permease [Pseudomonas syringae pv.
           syringae FF5]
          Length = 214

 Score =  178 bits (451), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 95/219 (43%), Positives = 136/219 (62%), Gaps = 13/219 (5%)

Query: 17  QPSLPPVYQR-GIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNR 75
           +P +PP  +  G +AW+ +N F +  + LLT   + L+   +P II W  LDA WIG+ +
Sbjct: 7   KPDMPPPGKVFGPVAWMRQNLFSSWINTLLTLFSLYLIYLVVPPIISWSLLDANWIGTTK 66

Query: 76  TVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLI 135
             CT              ACW FI  R+ QF++G +P   RWR  L  +   +   P+ I
Sbjct: 67  ADCTKA-----------GACWVFIEQRFGQFMYGYFPNELRWRVDLTAILAIVGAAPLFI 115

Query: 136 PSFPRKFLNSILLFGLFPIFSFFVLYGG-LGLSIVETSLWGGLLVTLVISFFGIIISMPL 194
             FPRK +  I    ++P+ +F++L+GG  GL+ V TS WGGL++TLVI+  GI+ ++PL
Sbjct: 116 SKFPRKAVYGIAFLVIYPVVAFYLLHGGAFGLTNVPTSQWGGLMLTLVIATVGIVGALPL 175

Query: 195 GILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMAS 233
           GILLALGR SN+P +R  C+TFIE +RGVPL+TVLFM+S
Sbjct: 176 GILLALGRRSNMPAVRVVCVTFIEFWRGVPLITVLFMSS 214


>gi|77462293|ref|YP_351797.1| ABC glutamate/glutamine/aspartate/asparagine transporter, inner
           membrane subunit BztC [Rhodobacter sphaeroides 2.4.1]
 gi|77386711|gb|ABA77896.1| ABC glutamate/glutamine/aspartate/asparagine transporter, inner
           membrane subunit BztC [Rhodobacter sphaeroides 2.4.1]
          Length = 442

 Score =  177 bits (450), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 96/223 (43%), Positives = 148/223 (66%), Gaps = 3/223 (1%)

Query: 164 LGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGV 223
           L L  V +  +GG ++ + I   GI +S+PLGI+LALGR S++ +++   ++FIE  RGV
Sbjct: 222 LWLEEVRSDKFGGFVLAVTIGVSGIALSLPLGIILALGRRSDMFLIKALSVSFIEFIRGV 281

Query: 224 PLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAA 283
           PL+ +LF AS++L  FLP     D +LR ++ V+ FA+AYIAEV+RGGL ++ +GQ+EAA
Sbjct: 282 PLIALLFTASLLLNYFLPPGTTFDIILRVIIMVTLFAAAYIAEVIRGGLAALPRGQYEAA 341

Query: 284 NSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFD-LLGIVRVNFSE 342
           ++LGL Y +  RLII+PQ +K  IPGIV+TFIG+FKD++L+  + + D L GI     + 
Sbjct: 342 DALGLDYWKAQRLIILPQALKISIPGIVSTFIGMFKDTTLVVFVGLLDPLKGITDAVRAS 401

Query: 343 STWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSK 385
           + W          IF+G +F+ F F++S YS+ +E+ L    +
Sbjct: 402 TDWKGIYWEP--YIFVGLIFFAFNFAMSRYSMHLERRLKTDHR 442



 Score =  100 bits (248), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 54/163 (33%), Positives = 89/163 (54%), Gaps = 11/163 (6%)

Query: 4   SCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHW 63
             +  P+VR+ +L P  PP  + G+++W+ +N F  P +I LT L +  + + + GI+ W
Sbjct: 5   HAQTVPFVRETMLPPVAPPANEAGVVSWMRQNLFSGPLNIALTVLGLVAIYYVLEGIVPW 64

Query: 64  VFLDAVWIGSNRTVCTTV--SQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPIL 121
           + + +VW       C  +   + G   +G   ACWA I +R+ QF++G YP    WRP L
Sbjct: 65  L-MRSVWTADTLAQCRQIITERWG---EGATGACWAVIRERWPQFLYGFYPNHLYWRPTL 120

Query: 122 VFLTGSILLTPMLIPSFPRKFLNSILLFGL-FPIFSFFVLYGG 163
            FL   + L P+L    PR+    +L F L +P  +F++L+GG
Sbjct: 121 TFLLLFVALAPILFAQVPRQ----MLWFSLAYPFLAFWLLWGG 159


>gi|126461169|ref|YP_001042283.1| polar amino acid ABC transporter, inner membrane subunit
           [Rhodobacter sphaeroides ATCC 17029]
 gi|221638147|ref|YP_002524409.1| Polar amino acid ABC transporter inner membrane subunit
           [Rhodobacter sphaeroides KD131]
 gi|126102833|gb|ABN75511.1| polar amino acid ABC transporter, inner membrane subunit
           [Rhodobacter sphaeroides ATCC 17029]
 gi|221158928|gb|ACL99907.1| Polar amino acid ABC transporter, inner membrane subunit
           [Rhodobacter sphaeroides KD131]
          Length = 442

 Score =  177 bits (450), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 96/223 (43%), Positives = 148/223 (66%), Gaps = 3/223 (1%)

Query: 164 LGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGV 223
           L L  V +  +GG ++ + I   GI +S+PLGI+LALGR S++ +++   ++FIE  RGV
Sbjct: 222 LWLEEVRSDKFGGFVLAVTIGVSGIALSLPLGIILALGRRSDMFLIKALSVSFIEFIRGV 281

Query: 224 PLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAA 283
           PL+ +LF AS++L  FLP     D +LR ++ V+ FA+AYIAEV+RGGL ++ +GQ+EAA
Sbjct: 282 PLIALLFTASLLLNYFLPPGTTFDIILRVIIMVTLFAAAYIAEVIRGGLAALPRGQYEAA 341

Query: 284 NSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFD-LLGIVRVNFSE 342
           ++LGL Y +  RLII+PQ +K  IPGIV+TFIG+FKD++L+  + + D L GI     + 
Sbjct: 342 DALGLDYWKAQRLIILPQALKISIPGIVSTFIGMFKDTTLVVFVGLLDPLKGITDAVRAS 401

Query: 343 STWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSK 385
           + W          IF+G +F+ F F++S YS+ +E+ L    +
Sbjct: 402 TDWKGIYWEP--YIFVGLIFFAFNFAMSRYSMHLERRLKTDHR 442



 Score = 99.8 bits (247), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 54/163 (33%), Positives = 89/163 (54%), Gaps = 11/163 (6%)

Query: 4   SCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHW 63
             +  P+VR+ +L P  PP  + G+++W+ +N F  P +I LT L +  + + + GI+ W
Sbjct: 5   HAQTVPFVRETMLPPVAPPANEAGVVSWMRQNLFSGPLNIALTLLGLVAIYYVLEGIVPW 64

Query: 64  VFLDAVWIGSNRTVCTTV--SQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPIL 121
           + + +VW       C  +   + G   +G   ACWA I +R+ QF++G YP    WRP L
Sbjct: 65  L-MRSVWTADTLAQCRQIITERWG---EGATGACWAVIRERWPQFLYGFYPNHLYWRPTL 120

Query: 122 VFLTGSILLTPMLIPSFPRKFLNSILLFGL-FPIFSFFVLYGG 163
            FL   + L P+L    PR+    +L F L +P  +F++L+GG
Sbjct: 121 TFLLLFVALAPILFAQVPRQ----MLWFSLAYPFLAFWLLWGG 159


>gi|289678215|ref|ZP_06499105.1| amino acid ABC transporter, permease protein [Pseudomonas syringae
           pv. syringae FF5]
          Length = 154

 Score =  177 bits (449), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 115/155 (74%), Gaps = 2/155 (1%)

Query: 232 ASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYL 291
           AS+MLPLF+P+  + DKLLRAL+GV  F SAYIAEV+RGG+Q+I KGQ+EAA+++GL Y 
Sbjct: 2   ASVMLPLFMPEGMNFDKLLRALIGVILFQSAYIAEVVRGGMQAIPKGQYEAASAMGLGYW 61

Query: 292 QKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTP 351
           + M L+I+PQ +K VIPGIVNTFI LFKD+SL+ II +FDLL  V+   ++  W+     
Sbjct: 62  RSMGLVILPQALKMVIPGIVNTFIALFKDTSLVIIIGLFDLLNSVKQATADPAWLG--MA 119

Query: 352 TTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
           T G +F   VFWIFCF +S YS+ +E+ L  G K+
Sbjct: 120 TEGYVFAALVFWIFCFGMSRYSMHLERKLDTGHKR 154


>gi|317970285|ref|ZP_07971675.1| polar amino acid ABC transporter, inner membrane subunit
           [Synechococcus sp. CB0205]
          Length = 403

 Score =  176 bits (445), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 97/274 (35%), Positives = 158/274 (57%), Gaps = 3/274 (1%)

Query: 113 MAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSI-LLFGLFPIFSFFVLYGGLGLSIVET 171
           ++QRW  I   L         L P+ P  F     +++ L  +    ++ GGLGL +V  
Sbjct: 130 ISQRWWGITALLLACRWWAGRLGPALPAAFRRGWPVIWPLLYLLGMTLIAGGLGLPVVSP 189

Query: 172 SLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFM 231
           S WGGLL+TL+ + F I++  PLG+LLALGR S +P+LR+  + +IE  RG PL+T+LF+
Sbjct: 190 SRWGGLLLTLIEASFAILLCFPLGVLLALGRRSRLPLLRWLSVLYIEFIRGAPLITLLFL 249

Query: 232 ASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYL 291
              +L L LP  +  D++ RA   ++ FA+AY+AE +R GL ++  GQ EAA +LGL   
Sbjct: 250 GQNILGLLLPGGFSPDRVWRAAWVLTFFAAAYVAEAVRSGLVALPPGQMEAARALGLPVH 309

Query: 292 QKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTP 351
           Q M  +++PQ ++  +P +V  FI L +D++L+S+I +F+LLG  R   +   ++     
Sbjct: 310 QAMLKVVLPQALRVALPAMVGQFINLLQDTTLLSLIGLFELLGTARAVMANPAFLGKDAE 369

Query: 352 TTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSK 385
               + +  +FW  C ++ L S  +E  L+   +
Sbjct: 370 VY--LVLAVLFWCCCAALGLGSRALETRLNSNPQ 401


>gi|83592120|ref|YP_425872.1| amino acid ABC transporter permease [Rhodospirillum rubrum ATCC
           11170]
 gi|83575034|gb|ABC21585.1| Amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine [Rhodospirillum rubrum ATCC 11170]
          Length = 367

 Score =  174 bits (442), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 120/353 (33%), Positives = 199/353 (56%), Gaps = 17/353 (4%)

Query: 33  HKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWN 92
            +  FG+  + LLT L++ +L + +P ++ W  +DAVW G     C   S          
Sbjct: 29  REGLFGSLGNTLLTLLVLAVLAWVVPPLVRWAVIDAVWSGPAEA-CAARS---------- 77

Query: 93  AACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILL-FGL 151
            ACWAF+ ++    +FG YP A +       L   +L   ++    PR +  ++L+ + L
Sbjct: 78  GACWAFLAEKTRFILFGLYPAAAQ---GAPALASLLLGALLVASGLPRLWGRNLLVAWIL 134

Query: 152 FPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRY 211
            P+ +  V+ G      V T  WGGL +TL+++   +  + PL ++LAL R S   + R 
Sbjct: 135 VPLLAVLVMAGVFSGLRVGTDQWGGLPLTLLLTTVAMGGAFPLAVVLALARRSRFRLFRL 194

Query: 212 ACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGG 271
             +  IE  RGVPL+TVL+ A +++PL LP    +DKLLRA   +  F ++Y+AE++R G
Sbjct: 195 MAVCVIEGVRGVPLITVLYGAILLVPLMLPAGTAIDKLLRAQGAILLFTASYLAEIIRAG 254

Query: 272 LQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFD 331
           LQ+I  GQ+EAA SLGL Y   MRL+++PQ ++ VIP IV   IG+ +D++L+++I + D
Sbjct: 255 LQAIPPGQYEAARSLGLGYGLTMRLVVLPQALRLVIPSIVTLAIGILQDTTLVAVIGIHD 314

Query: 332 LLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
           LL   ++  ++  W+     T G   +  +++  CF+ S YS+++E+ L +G 
Sbjct: 315 LLSASKLAATDPDWLGFY--TEGFCLVATLYFALCFAASRYSLWLERYLARGQ 365


>gi|113952871|ref|YP_730397.1| polar amino acid ABC transporter permease [Synechococcus sp.
           CC9311]
 gi|113880222|gb|ABI45180.1| polar amino amino acid ABC transporter (PAAT) family, permease
           protein [Synechococcus sp. CC9311]
          Length = 342

 Score =  174 bits (441), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 107/296 (36%), Positives = 172/296 (58%), Gaps = 9/296 (3%)

Query: 92  NAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPML----IPSFPRKFLNSIL 147
             A W  +      F FG+YP  QRWRP++  +   +L    L    +P  P K L   L
Sbjct: 45  TGADWRVVTHNLPLFAFGSYPADQRWRPLVWMVVLLLLTITTLGSDHLPQ-PLKRLRPCL 103

Query: 148 LFG--LFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSN 205
            +   L       +L G   L  V +  WGGL +TL+++     +++PLG+ LA+GR SN
Sbjct: 104 PWAWILMVPTGVVLLAGSANLQAVPSRAWGGLTLTLLLTTASGFLALPLGVGLAIGRTSN 163

Query: 206 IPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIA 265
           + ++   C  +I+L R VPL+ VLF   ++LPLFLP   +++++LRA++  + FA+AY+A
Sbjct: 164 LGLVAMLCRIYIDLMRAVPLIAVLFFGQLLLPLFLPVEIEINRVLRAVMAFALFAAAYVA 223

Query: 266 EVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLIS 325
           E +RGGLQSI   Q EAA +LGL+    MRLII+PQ ++  +P + N  IGL +++SL++
Sbjct: 224 EDVRGGLQSIPPTQAEAAAALGLNASLTMRLIILPQALRIAVPALTNQAIGLMQNTSLMA 283

Query: 326 IINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
           I+ + +LLGI R   +   +I     T   +++  V+W+ C +++L +  IE+  H
Sbjct: 284 ILGLIELLGISRSLLANPDYIGRHLET--YVWLAGVYWLLCSAMALLAKRIERQGH 337


>gi|317122273|ref|YP_004102276.1| polar amino acid ABC transporter inner membrane subunit
           [Thermaerobacter marianensis DSM 12885]
 gi|315592253|gb|ADU51549.1| polar amino acid ABC transporter, inner membrane subunit
           [Thermaerobacter marianensis DSM 12885]
          Length = 370

 Score =  174 bits (440), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 124/378 (32%), Positives = 187/378 (49%), Gaps = 46/378 (12%)

Query: 18  PSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTV 77
           P   P  QR   AWI  N  GT    LLT + + +L+ +   ++ W F            
Sbjct: 29  PPQVPWPQRAA-AWIRANLLGTWYHGLLTLVCLTVLVRAGRAVVEWAF------------ 75

Query: 78  CTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLI-- 135
                           A WA + D     + G YP  Q WR         +L+    +  
Sbjct: 76  --------------TRAQWAVVRDNLLLLLVGAYPRDQLWRVGAALGVLVLLVLAGGLAW 121

Query: 136 --PSFPRKFLNSILL--FGLFPIFSFFVL----YGGLGLSIVETSLWGGLLVTLVISFFG 187
              +  R+F   ++     L P     VL     GG G          GL++TLV++  G
Sbjct: 122 AGSARWRRFQLPVVAAWVVLVPAAMALVLSVPRVGGAGTGY-------GLVLTLVLAVAG 174

Query: 188 IIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVD 247
           I +S PLG+ LALGR S++PV+R   I +IEL RG PL+ VLF +   LPLFLP     D
Sbjct: 175 ITLSFPLGVALALGRVSSLPVVRALSIAYIELVRGTPLMVVLFFSMTALPLFLPPAVRPD 234

Query: 248 KLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVI 307
            + RA  G+  F +AY+AE +RGGLQ + +GQ EAA +LGL+  Q + L+++PQ ++ VI
Sbjct: 235 LVTRAAAGLVLFTAAYVAEAVRGGLQGVPRGQIEAAQALGLTGTQAVFLVVLPQALRAVI 294

Query: 308 PGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCF 367
           P +V  FI LFKD+SL+++  + + +G+ +   S   ++          F+  V+W+FC+
Sbjct: 295 PALVGQFISLFKDTSLVAVWGLLEFVGVAQSVLSNPAYLGRHVEVYA--FVAAVYWVFCY 352

Query: 368 SISLYSVFIEKTLHKGSK 385
            +SL S  +E+ L  G +
Sbjct: 353 GMSLASRRLERRLGVGER 370


>gi|218510923|ref|ZP_03508801.1| polar amino acid ABC transporter, inner membrane subunit [Rhizobium
           etli Brasil 5]
          Length = 250

 Score =  172 bits (436), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 89/213 (41%), Positives = 138/213 (64%), Gaps = 2/213 (0%)

Query: 169 VETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTV 228
           V TS WGGL +TL++S  G+  + P+ +LLAL R S + +LR   + FIE  RGVPL+ V
Sbjct: 37  VPTSQWGGLPITLLVSLTGLATAFPIALLLALARRSEMRILRIFAVLFIECLRGVPLIAV 96

Query: 229 LFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGL 288
           L++A +++P+ LP     DKLLRA +G++ F SAY+AEV+R GLQSI  GQ EAA SLGL
Sbjct: 97  LYVAMLIVPMALPADALTDKLLRAQIGITLFVSAYLAEVIRAGLQSIPAGQTEAAYSLGL 156

Query: 289 SYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISS 348
            Y + ++L+++PQ ++ VIP +VN  IG+  ++SL+++I + DLL   +   ++  W+  
Sbjct: 157 GYWRTVQLVVLPQALRIVIPAVVNLSIGILLNTSLLTVIGISDLLNGAKTAATDPNWLGF 216

Query: 349 VTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
              +   +F   V++   F  S YS+++E  L 
Sbjct: 217 Y--SEAFVFAACVYFAISFGASRYSIWLEPKLR 247


>gi|87124566|ref|ZP_01080415.1| Amino acid ABC transporter, permease protein, 3-TM
           region,His/Glu/Gln/Arg/opine [Synechococcus sp. RS9917]
 gi|86168138|gb|EAQ69396.1| Amino acid ABC transporter, permease protein, 3-TM
           region,His/Glu/Gln/Arg/opine [Synechococcus sp. RS9917]
          Length = 345

 Score =  170 bits (430), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 103/297 (34%), Positives = 175/297 (58%), Gaps = 11/297 (3%)

Query: 94  ACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILL---------TPMLIPSFPRKFLN 144
           A W  +      +  G+YP  QRWRP+L      +L           P   P   R  L 
Sbjct: 43  ADWRLVSANLPLYASGSYPAEQRWRPLLWLALILVLTLVTLLAPRPAPGQRPGPFRLALP 102

Query: 145 SILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNS 204
            + L  L           G GLS V +  WGGL++TL+++    ++++PLG++LALGR+S
Sbjct: 103 WLWLLMLPLGLPVLAGGAGTGLSAVSSRTWGGLVLTLLLTGASGLLALPLGVMLALGRSS 162

Query: 205 NIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYI 264
           ++PVLR+    +++L R VPL+ VLF   +++PLFLP   +++++LRA+L  + FASAY+
Sbjct: 163 DLPVLRHGSRLYVDLMRAVPLIAVLFFGQLLIPLFLPVQLELNRVLRAVLAFALFASAYV 222

Query: 265 AEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLI 324
           AE +RGGLQSI   Q EAA +LGLS  Q ++L+++PQ ++  IP + N  IGL +++SL+
Sbjct: 223 AEDVRGGLQSIPSTQKEAAAALGLSAWQSLQLVVLPQALQIAIPALTNQAIGLLQNTSLM 282

Query: 325 SIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
           +++ + +LLGI R   +   +I         +++  ++W+ C +++L +  +E+++ 
Sbjct: 283 ALLGLVELLGISRSLLANPAFIGRHLEV--YVWLASLYWLLCTAMALLARRLERSVQ 337


>gi|328950980|ref|YP_004368315.1| polar amino acid ABC transporter, inner membrane subunit
           [Marinithermus hydrothermalis DSM 14884]
 gi|328451304|gb|AEB12205.1| polar amino acid ABC transporter, inner membrane subunit
           [Marinithermus hydrothermalis DSM 14884]
          Length = 376

 Score =  169 bits (428), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 96/220 (43%), Positives = 147/220 (66%), Gaps = 2/220 (0%)

Query: 166 LSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPL 225
           LS V T+LWGGLL+TL+I+   +++S PLG+LLALGR S +P +R     +IE  RGVPL
Sbjct: 159 LSGVNTNLWGGLLLTLLITLLTVVLSFPLGLLLALGRTSRLPAIRILATLYIETVRGVPL 218

Query: 226 VTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANS 285
           V+VLF+A IM+PLF+P+ W   +L+R + G + FA+AY+AE +RGGLQ + KGQ+EAA +
Sbjct: 219 VSVLFLAWIMVPLFVPEAWRPPQLVRVIAGFTLFAAAYLAEYIRGGLQGVPKGQYEAAWA 278

Query: 286 LGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTW 345
           LGL+  Q    II+PQ I+ VIP ++   I +FKD+SL++I+ + DLLGI +   +   +
Sbjct: 279 LGLNGFQTAYYIILPQAIRSVIPALIGQVIAIFKDTSLVAIVGLLDLLGIAQSVLANPNY 338

Query: 346 ISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSK 385
           +         +F+  V++I    +S  S  +E+ +  G++
Sbjct: 339 LGLEREV--YLFLLVVYFIGAGLMSYASRQLERAMGLGTR 376


>gi|116070916|ref|ZP_01468185.1| Amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine [Synechococcus sp. BL107]
 gi|116066321|gb|EAU72078.1| Amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine [Synechococcus sp. BL107]
          Length = 324

 Score =  168 bits (425), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 108/295 (36%), Positives = 182/295 (61%), Gaps = 9/295 (3%)

Query: 91  WNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPR----KFLNSI 146
           W+ A W  +      +  G+YP  QRWRP+L     ++++  ++    PR    + +  +
Sbjct: 29  WHGADWTVVTTNLPLYAVGSYPEDQRWRPLLCI--AAVVVLIVITLVGPRQGGWRRVMPL 86

Query: 147 LLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNI 206
           L  G+ P F  ++L GGLGL+ V T  WGG  +TL+++    ++++P G+LLALGR S++
Sbjct: 87  LWSGMAP-FGLWLLAGGLGLAPVGTQSWGGFSLTLLLTAGSGMLALPFGVLLALGRRSDL 145

Query: 207 PVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAE 266
           PVLR +   +IEL R VPL+ VLF   +++PLFLP   +++++LRA++  + FA+AYIAE
Sbjct: 146 PVLRGSSTVYIELMRAVPLIAVLFFGQLLIPLFLPPGIELNRVLRAVVAFALFAAAYIAE 205

Query: 267 VLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISI 326
            +RGGLQ+IS  Q EAA  LGLS  Q ++L+++PQ  +  +P + N  +GL +++SL++I
Sbjct: 206 DVRGGLQAISPTQREAAMVLGLSPRQTLQLVVLPQAFRVALPSLTNQAVGLLQNTSLMAI 265

Query: 327 INMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
           + + +LLGI R   +   +I         I++  V+W+ C +++L +  +E  L 
Sbjct: 266 LGLVELLGISRSLLANPEFIGRYLEV--YIWLAAVYWLACTAMALLARHLEIQLD 318


>gi|313680182|ref|YP_004057921.1| polar amino acid ABC transporter, inner membrane subunit
           [Oceanithermus profundus DSM 14977]
 gi|313152897|gb|ADR36748.1| polar amino acid ABC transporter, inner membrane subunit
           [Oceanithermus profundus DSM 14977]
          Length = 371

 Score =  167 bits (423), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 91/216 (42%), Positives = 136/216 (62%), Gaps = 2/216 (0%)

Query: 170 ETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVL 229
           +T   GG   TL+++    + + PLG+LLALGR    PV R   I +IEL RGVPL+TVL
Sbjct: 158 KTDRLGGFSFTLMLTVLASVFAFPLGLLLALGRTGKWPVFRALSILYIELIRGVPLITVL 217

Query: 230 FMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLS 289
           F++  M+PLFLP +W+V  L   ++G S FA+AY+AE +RGG+Q + KGQ+EAA +LGLS
Sbjct: 218 FLSYYMVPLFLPASWEVPTLFSIVVGFSMFAAAYLAEYVRGGIQGVPKGQYEAAWALGLS 277

Query: 290 YLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSV 349
             Q  R II+PQ I+ VIP ++   I +FKD+SL+ I+ +FDLL +         ++   
Sbjct: 278 GTQSARYIILPQAIRSVIPALIGQLIAIFKDTSLVYILGLFDLLFMAITVARNPKFLG-- 335

Query: 350 TPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSK 385
           T    L+FI  V+++    +S  S  +E+ +  G++
Sbjct: 336 TEREVLLFIALVYFVGAALMSYASRKLERAMGLGTR 371


>gi|78184424|ref|YP_376859.1| amino acid ABC transporter permease [Synechococcus sp. CC9902]
 gi|78168718|gb|ABB25815.1| Amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine [Synechococcus sp. CC9902]
          Length = 324

 Score =  167 bits (423), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 103/293 (35%), Positives = 174/293 (59%), Gaps = 5/293 (1%)

Query: 91  WNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLF- 149
           WN A W  +      +  G+YP  +RWRP+L  +   +L+   L+      +  +I L  
Sbjct: 29  WNGADWTVVMTNLPLYAVGSYPEDERWRPLLCIVAVVVLIVITLVGPRQAGWRRAIPLLW 88

Query: 150 -GLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPV 208
            G+ P+  + +  G      V T  WGG  +TL+++    ++++PLG+LLALGR S++PV
Sbjct: 89  SGMAPLGLWLLAGGLGLAP-VGTQSWGGFSLTLLLTAGSGMLALPLGVLLALGRRSDLPV 147

Query: 209 LRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVL 268
           LR +   +IEL R VPL+ VLF   +++PLFLP   +++++LRA++  + FA+AYIAE +
Sbjct: 148 LRGSSTAYIELMRAVPLIAVLFFGQLLIPLFLPPGVEINRVLRAVVAFALFAAAYIAEDV 207

Query: 269 RGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIIN 328
           RGGLQ+I   Q EAA  LGLS  Q ++L+++PQ  +  +P + N  +GL +++SL++I+ 
Sbjct: 208 RGGLQAIPPTQREAAMVLGLSPRQTLQLVVLPQAFRVALPSLTNQAVGLLQNTSLMAILG 267

Query: 329 MFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
           + +LLGI R   +   +I         I++  V+W+ C +++L +  +E  L 
Sbjct: 268 LVELLGISRSLLANPAFIGRYLEV--YIWLAAVYWLACTAMALLARHLEIQLD 318


>gi|323165238|gb|EFZ51028.1| general L-amino acid transport system permease aapM domain protein
           [Shigella sonnei 53G]
          Length = 168

 Score =  167 bits (423), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 82/157 (52%), Positives = 112/157 (71%), Gaps = 2/157 (1%)

Query: 227 TVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSL 286
           TVLFM+S+MLPLF+ +  ++DKL+RAL+GV  F SAY+AEV+RGGLQ++ KGQ+EAA SL
Sbjct: 10  TVLFMSSVMLPLFMAEGTNIDKLIRALVGVILFQSAYVAEVVRGGLQALPKGQYEAAESL 69

Query: 287 GLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWI 346
            L Y +   L+I+PQ +K VIPG+VNT I LFKD+SL+ II +FDL   V+    +  W+
Sbjct: 70  ALGYWKTQGLVILPQALKLVIPGLVNTIIALFKDTSLVIIIGLFDLFSSVQQATVDPAWL 129

Query: 347 SSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKG 383
                T G +F   ++WIFCFS+S YS  +EK  + G
Sbjct: 130 G--MSTEGYVFAALIYWIFCFSMSRYSQHLEKRFNTG 164


>gi|330903629|gb|EGH34201.1| amino acid ABC transporter permease [Pseudomonas syringae pv.
           japonica str. M301072PT]
          Length = 130

 Score =  163 bits (413), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 79/130 (60%), Positives = 104/130 (80%)

Query: 221 RGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQF 280
           RGVPL+TVLFM+S+MLPLF+P+  + DKLLRAL+GV  F SAYIAEV+RGG+Q+I KGQ+
Sbjct: 1   RGVPLITVLFMSSVMLPLFMPEGMNFDKLLRALIGVILFQSAYIAEVVRGGMQAIPKGQY 60

Query: 281 EAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNF 340
           EAA+++GL Y + M L+I+PQ +K VIPGIVNTFI LFKD+SL+ II +FDLL  V+   
Sbjct: 61  EAASAMGLGYWRSMGLVILPQALKMVIPGIVNTFIALFKDTSLVIIIGLFDLLNSVKQAT 120

Query: 341 SESTWISSVT 350
           ++  W+   T
Sbjct: 121 ADPAWLGMAT 130


>gi|159904018|ref|YP_001551362.1| ABC-type amino acid transport system, permease component
           [Prochlorococcus marinus str. MIT 9211]
 gi|159889194|gb|ABX09408.1| ABC-type amino acid transport system, permease component
           [Prochlorococcus marinus str. MIT 9211]
          Length = 339

 Score =  160 bits (405), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 100/296 (33%), Positives = 168/296 (56%), Gaps = 7/296 (2%)

Query: 94  ACWAFIYDRYEQFIFGNYPMAQRWRPIL-VFLTGSILLTPMLIPSFP--RKFLNSILLFG 150
           A W  +      + FG +P  QRWRP L +F   ++    +L P  P  RK +  I    
Sbjct: 47  ANWTVVTHNLSLYTFGIFPPDQRWRPTLWLFSLLALTTVTLLRPGLPWVRKLI-PIAWIS 105

Query: 151 LFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLR 210
             P+   ++L GGLGL  + +  WGGL +TL +     +I+ PLG++ A+GR S   +++
Sbjct: 106 AVPV-GIYLLSGGLGLLPISSRYWGGLTLTLFLMASSALIAFPLGMIFAIGRQSEHFLIK 164

Query: 211 YACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRG 270
           Y    +I+  R +PL+ +LF   +++PLFLP   +++++LRA++  + F SAY+AE +RG
Sbjct: 165 YLSAIYIDTLRAIPLIAILFFGQLLIPLFLPFGLEINRVLRAVIAFALFVSAYVAEDIRG 224

Query: 271 GLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMF 330
           GLQ+I   Q EAA +LGL+  Q  + I++PQ I   IP + N  IGL +++SL++I+ + 
Sbjct: 225 GLQAIPTSQIEAAKALGLTDFQIKQFIVLPQAITIAIPALANQAIGLLQNTSLMAILGLV 284

Query: 331 DLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
           +LLGI R   +   +I         +++  ++W+ C  I++ S  IE+ +  G   
Sbjct: 285 ELLGISRSILANPEFIGRYVEV--YVWLALIYWLVCTVIAILSRHIEQRMKIGKSH 338


>gi|33863166|ref|NP_894726.1| ABC transporter for amino acids, membrane component
           [Prochlorococcus marinus str. MIT 9313]
 gi|33635083|emb|CAE21069.1| ABC transporter for amino acids, membrane component
           [Prochlorococcus marinus str. MIT 9313]
          Length = 327

 Score =  159 bits (402), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 120/348 (34%), Positives = 195/348 (56%), Gaps = 35/348 (10%)

Query: 37  FGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACW 96
             TP D L+T L++ LL +     +HW+F+DA W          VSQ             
Sbjct: 1   MATPLDGLMTVLLLALLGWVATTTLHWLFVDADW--------QVVSQN------------ 40

Query: 97  AFIYDRYEQFIFGNYPMAQRWRPIL--VFLTGSILLTPMLIP--SFPRKFLNSILLFGLF 152
                    + FG+YP  QRWRP L    L G   LT +L P   + RK L  ++   + 
Sbjct: 41  ------LPLYAFGSYPPHQRWRPFLWIALLIGLTFLT-LLGPRRGWIRKAL-PLVWIAMV 92

Query: 153 PIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYA 212
           P     +  G   L I  +  WGGL +TL+++     +++PLGILLALGR + + V++ +
Sbjct: 93  PCGVVLLAGGLGLLPI-PSHAWGGLTLTLLLTACSGALALPLGILLALGRQTRLAVIQRS 151

Query: 213 CITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGL 272
           C  +I++ R VPL+ VLF   +++PLFLP   +V+++LRA+L  + FA+AYIAE +RGGL
Sbjct: 152 CSVYIDVMRAVPLIAVLFFGQLLIPLFLPMHLEVNRVLRAVLAFALFAAAYIAEDVRGGL 211

Query: 273 QSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDL 332
           Q+I + Q EAA  LGLS  Q ++L+++PQ ++  +P + N  +GL +++SL++I+ + +L
Sbjct: 212 QAIPRTQREAAAVLGLSPKQIIQLVVLPQALRTALPALTNQAVGLLQNTSLMAILGLVEL 271

Query: 333 LGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTL 380
           LGI R   +   +I         +++  V+W+ C +++L +  +E  L
Sbjct: 272 LGISRSLLANPDFIGRYLEV--YVWLAGVYWLVCTAMALLARHLEHQL 317


>gi|260434995|ref|ZP_05788965.1| amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine [Synechococcus sp. WH 8109]
 gi|260412869|gb|EEX06165.1| amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine [Synechococcus sp. WH 8109]
          Length = 324

 Score =  159 bits (401), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 103/297 (34%), Positives = 177/297 (59%), Gaps = 7/297 (2%)

Query: 93  AACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNS---ILLF 149
           AA W+ +      +  G++P  QRWRP+L ++   I L P+ +    R ++     ++  
Sbjct: 31  AADWSVVTTNLPLYAVGSFPADQRWRPLL-WMAALITLMPLTLVGPKRGWVRRWLPLVWI 89

Query: 150 GLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVL 209
            + P+  + +  G   L  V T  WGGL +TL+++     +++PLGILLALGR S +PVL
Sbjct: 90  AMAPLGLWLLAGGLGLLP-VGTRSWGGLTLTLLLTGGSGALALPLGILLALGRRSELPVL 148

Query: 210 RYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLR 269
           R++   +IEL R VPL+ VLF   +++PLFLP   +++++LRA++  + FA+AYIAE +R
Sbjct: 149 RWSSAAYIELMRAVPLIAVLFFGQLLIPLFLPPGLEINRVLRAVVAFALFAAAYIAEDVR 208

Query: 270 GGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINM 329
           GGLQ+I   Q EAA  LGLS  Q ++L+++PQ ++  +P + N  +GL +++SL++I+ +
Sbjct: 209 GGLQAIPPTQREAAAVLGLSPRQVLQLVVLPQALRVALPSLTNQAVGLLQNTSLMAILGL 268

Query: 330 FDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
            +LLGI R   +   +I         +++  V+W+ C +++L +  +E  L      
Sbjct: 269 VELLGISRSLLANPAFIGRYLEVY--LWLAAVYWLACTAMALLARHLEVQLDPARSA 323


>gi|124022918|ref|YP_001017225.1| amino acid ABC transporter permease [Prochlorococcus marinus str.
           MIT 9303]
 gi|123963204|gb|ABM77960.1| ABC transporter for amino acids, membrane component
           [Prochlorococcus marinus str. MIT 9303]
          Length = 342

 Score =  158 bits (400), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 118/352 (33%), Positives = 198/352 (56%), Gaps = 33/352 (9%)

Query: 32  IHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGW 91
           + ++   TP D L+T L++ LL +     +HW+F+DA W          VSQ        
Sbjct: 11  LKRHLLATPLDGLMTVLLLALLGWVATTTLHWLFVDADW--------QVVSQN------- 55

Query: 92  NAACWAFIYDRYEQFIFGNYPMAQRWRPIL-VFLTGSILLTPMLIPS--FPRKFLNSILL 148
                         + FG+YP  QRWRP L + L   + L  +L P   + RK L  ++ 
Sbjct: 56  -----------LPLYAFGSYPPHQRWRPFLWIALLIGLTLLTLLGPRRGWIRKAL-PLVW 103

Query: 149 FGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPV 208
             + P     +  G   L I  +  WGGL +TL+++     +++PLGILLALGR + + V
Sbjct: 104 IAMVPCGVVLLAGGLGLLPI-PSHAWGGLTLTLLLTACSGALALPLGILLALGRQTRLAV 162

Query: 209 LRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVL 268
           ++ +C  +I++ R VPL+ VLF   +++PLFLP   +V+++LRA+L  + FA+AYIAE +
Sbjct: 163 IQRSCSIYIDVMRAVPLIAVLFFGQLLIPLFLPMHLEVNRVLRAVLAFALFAAAYIAEDV 222

Query: 269 RGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIIN 328
           RGGLQ+I + Q EAA  LGLS  Q ++L+++PQ ++  +P + N  +GL +++SL++I+ 
Sbjct: 223 RGGLQAIPRTQREAAAVLGLSPKQMIQLVVLPQALRTALPALTNQAVGLLQNTSLMAILG 282

Query: 329 MFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTL 380
           + +LLGI R   +   +I         +++  V+W+ C +++L +  +E  L
Sbjct: 283 LVELLGISRSLLANPDFIGRYLEV--YVWLAGVYWLVCTAMALLARHLEHQL 332


>gi|86608410|ref|YP_477172.1| polar amino acid ABC transporter permease [Synechococcus sp.
           JA-2-3B'a(2-13)]
 gi|86556952|gb|ABD01909.1| polar amino amino acid ABC transporter (PAAT) family, permease
           protein [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 402

 Score =  157 bits (397), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 87/199 (43%), Positives = 127/199 (63%), Gaps = 4/199 (2%)

Query: 188 IIISMPLGILLALGR-NSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDV 246
           +II  P+G+LLALGR N  +PV+R  C   IEL RGVPL T+LF A +++P FL     V
Sbjct: 207 MIIGFPIGVLLALGRANRALPVIRIFCTLVIELVRGVPLTTILFAAWLLVPFFLGGI-SV 265

Query: 247 DKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRV 306
           + ++RA +    F + Y+AE +RGGLQSI  GQ EAA +LGL+  Q   L+I+PQ ++  
Sbjct: 266 NLIIRAEVAFILFTAVYVAEDVRGGLQSIPLGQLEAARALGLNPFQVTALVILPQALRAA 325

Query: 307 IPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFC 366
           +P +VN F+ LFKD+SL+ I+ + DLL   RV F+   W+   T    L FIG +++I C
Sbjct: 326 VPALVNEFLTLFKDTSLVFIVGLIDLLQAGRVVFTNPNWLG--TQREVLFFIGLIYFICC 383

Query: 367 FSISLYSVFIEKTLHKGSK 385
           F+++  +  +EK L  G +
Sbjct: 384 FAMAYAAQQVEKALGLGKR 402


>gi|86605964|ref|YP_474727.1| polar amino acid ABC transporter permease [Synechococcus sp.
           JA-3-3Ab]
 gi|86554506|gb|ABC99464.1| polar amino amino acid ABC transporter (PAAT) family, permease
           protein [Synechococcus sp. JA-3-3Ab]
          Length = 401

 Score =  157 bits (397), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 87/199 (43%), Positives = 127/199 (63%), Gaps = 4/199 (2%)

Query: 188 IIISMPLGILLALGR-NSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDV 246
           +II  P+G+LLALGR N  +PV+R  C   IEL RGVPL T+LF A +++P FL     V
Sbjct: 206 MIIGFPIGVLLALGRANRALPVIRIFCTLVIELVRGVPLTTILFAAWLLVPFFLGGI-SV 264

Query: 247 DKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRV 306
           + ++RA +    F + Y+AE +RGGLQSI  GQ EAA +LGL+  Q   L+I+PQ ++  
Sbjct: 265 NLIIRAEVAFILFTAVYVAEDVRGGLQSIPLGQLEAARALGLNPFQVTALVILPQALRAA 324

Query: 307 IPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFC 366
           +P +VN F+ LFKD+SL+ I+ + DLL   RV F+   W+   T    L FIG +++I C
Sbjct: 325 VPALVNEFLTLFKDTSLVFIVGLIDLLQAGRVVFTNPNWLG--TQREVLFFIGLIYFICC 382

Query: 367 FSISLYSVFIEKTLHKGSK 385
           F+++  +  +EK L  G +
Sbjct: 383 FAMAYAAQQVEKALGLGKR 401


>gi|33240124|ref|NP_875066.1| ABC-type amino acid transport system permease component
           [Prochlorococcus marinus subsp. marinus str. CCMP1375]
 gi|33237651|gb|AAP99718.1| ABC-type amino acid transport system permease component
           [Prochlorococcus marinus subsp. marinus str. CCMP1375]
          Length = 339

 Score =  156 bits (394), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 95/295 (32%), Positives = 172/295 (58%), Gaps = 5/295 (1%)

Query: 94  ACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFGLFP 153
           A W  +      ++FG+YP+ QRWRP L ++   I+LT + +     +++   L F    
Sbjct: 47  ADWGVVNLNLPLYLFGSYPLTQRWRPAL-WIVLIIILTALTLCESKWRWIGKSLPFAWIS 105

Query: 154 I--FSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRY 211
           I     ++L GGLGL  + +  WGGL +T++++    + S+PLG+ LALGR S + +++ 
Sbjct: 106 ITPIGIYLLAGGLGLLPIASRYWGGLTLTILLTASSALFSLPLGVALALGRQSKLSIIKK 165

Query: 212 ACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGG 271
               +I+  R VPL++VLF   +++PLFLP   ++ ++ RA +  + F SAYIAE +RGG
Sbjct: 166 ISSIYIDAMRSVPLISVLFFGQLLIPLFLPVGIEISRVWRAAIAFTLFVSAYIAEDIRGG 225

Query: 272 LQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFD 331
           LQ+I   Q EA  ++GL+ +Q  + I++PQ ++  +P + N  IGL +++SL++I+ + +
Sbjct: 226 LQAIPNTQIEAGKAIGLNNIQITQFIVLPQALRIALPALTNQAIGLLQNTSLMAILGLVE 285

Query: 332 LLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
           LLGI R   +   +I         +++  ++W+ C  ++L +  +E+ L    + 
Sbjct: 286 LLGIGRSLLANPEFIGRYIEVY--VWLAAIYWLVCMIMALLARNLEQKLSINRRN 338


>gi|116072944|ref|ZP_01470206.1| Amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine [Synechococcus sp. RS9916]
 gi|116068249|gb|EAU74001.1| Amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine [Synechococcus sp. RS9916]
          Length = 340

 Score =  155 bits (391), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 108/293 (36%), Positives = 186/293 (63%), Gaps = 9/293 (3%)

Query: 92  NAACWAFIYDRYEQFIFGNYPMAQRWRPIL-VFLTGSILLTPMLIPSFPRK--FLNSILL 148
            AA W+ +      ++ G+YP ++RWRP L V L   + L  +L P+   +  +L   L 
Sbjct: 41  QAADWSVVGSNLPLYLSGSYPESERWRPWLWVSLLTVLTLVTLLRPTKGGRLRWLELALP 100

Query: 149 F---GLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSN 205
           +   G+ P+    +  G + LS V +  WGGL +TL+++     +++P+G+LLALGRNS+
Sbjct: 101 WCWIGMIPLGLGLLGGG-IALSAVPSRDWGGLSLTLLLTACSAALALPIGVLLALGRNSD 159

Query: 206 IPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIA 265
           +PVLR +   +I+L R VPL+ VLF   +++PLFLP   +++++LRA++  + FA+AY+A
Sbjct: 160 LPVLRLSSRLYIDLMRAVPLIAVLFFGQLLIPLFLPMQLEINRVLRAVVAFALFAAAYVA 219

Query: 266 EVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLIS 325
           E +RGGLQSI   Q EAA +LGLS +Q +RL+++PQ ++  IP + N  IGL +++SL++
Sbjct: 220 EDVRGGLQSIPSTQTEAAAALGLSPIQSLRLVVLPQALRIAIPALTNQAIGLLQNTSLMA 279

Query: 326 IINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEK 378
           ++ + +LLGI R   +   +I         +++G ++W+FC +++L +  IE+
Sbjct: 280 LLGLVELLGIGRSLLANPAFIGRHLEV--YVWLGGLYWMFCTAMALLARRIER 330


>gi|78213328|ref|YP_382107.1| amino acid ABC transporter permease [Synechococcus sp. CC9605]
 gi|78197787|gb|ABB35552.1| Amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine [Synechococcus sp. CC9605]
          Length = 324

 Score =  155 bits (391), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 108/297 (36%), Positives = 179/297 (60%), Gaps = 7/297 (2%)

Query: 93  AACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLI---PSFPRKFLNSILLF 149
           AA W+ +      +  G++P  QRWRP+L       L    L+     + R++L   LL+
Sbjct: 31  AADWSVVTTNLPLYAVGSFPADQRWRPLLWMAALITLTLLTLVGPKRGWVRRWLP--LLW 88

Query: 150 GLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVL 209
            +      ++L GGLGL  V T  WGGL +TL+++     +++PLGILLALGR S++PVL
Sbjct: 89  IVMAPLGLWLLAGGLGLLPVGTRSWGGLTLTLLLTGGSGALALPLGILLALGRRSDLPVL 148

Query: 210 RYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLR 269
           R++   +IEL R VPL+ VLF   +++PLFLP   +++++LRA++  + FA+AYIAE +R
Sbjct: 149 RWSSAAYIELMRAVPLIAVLFFGQLLIPLFLPPGLEINRVLRAVVAFALFAAAYIAEDVR 208

Query: 270 GGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINM 329
           GGLQ+I   Q EAA  LGLS  Q ++L+++PQ ++  +P + N  +GL +++SL++I+ +
Sbjct: 209 GGLQAIPPTQREAAAVLGLSPRQSLQLVVLPQALRVALPSLTNQAVGLLQNTSLMAILGL 268

Query: 330 FDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
            +LLGI R   +   +I         +++  V+W+ C +++L +  +E  L      
Sbjct: 269 VELLGISRSLLANPAFIGRYLEVY--LWLAAVYWLACTAMALLARHLEVQLDPARSA 323


>gi|254430539|ref|ZP_05044242.1| amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine [Cyanobium sp. PCC 7001]
 gi|197624992|gb|EDY37551.1| amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine [Cyanobium sp. PCC 7001]
          Length = 418

 Score =  153 bits (386), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 120/402 (29%), Positives = 199/402 (49%), Gaps = 49/402 (12%)

Query: 32  IHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVW--IGSNRTVCTTVSQGGIQP- 88
           + ++ F TP D L+T +++ ++  ++ G++ W F  A W  I  N T+         Q  
Sbjct: 19  LRRDLFATPTDGLITLVLLGVIGGALTGLLRWAFGRADWAVIRLNSTLFAVGRYPLAQQW 78

Query: 89  ---------DGWNAACWAFIYDRYEQFIFGN-YPMAQRWR-----------PILVFLTGS 127
                     G     W  +  +      G  +P A RW            P  + L+ S
Sbjct: 79  RLWLLLALFCGAAGLSWGLLRSQPRPDRQGRLWPPADRWACGLIVALALWTPWALELSAS 138

Query: 128 I-------------------LLTPMLIPSFPRKFLNSI-LLFGLFPIFSFFVLYGGLGLS 167
           I                    L   L P      L S+ LL+    +    ++ GG+GL+
Sbjct: 139 IQLRWAGLAALLLALRWLAGRLGQALSPRQGSWALRSLALLWPALYLIGMELISGGIGLA 198

Query: 168 IVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVT 227
            V +S WGGLL+TL+ + F I++  PLG+ LALGR S++P+LR+  + +IE  RG PL+T
Sbjct: 199 RVPSSDWGGLLLTLLQASFAILLCFPLGVALALGRRSDLPLLRWGSVLYIEFVRGAPLIT 258

Query: 228 VLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLG 287
           +LF+   +L   LP     +++ RA   ++ FA+AY+AE +R GL ++ KGQ EAA SLG
Sbjct: 259 LLFLGQNILGFLLPGGLAPERVWRAAWVLTFFAAAYLAEAVRSGLAAVPKGQREAARSLG 318

Query: 288 LSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWIS 347
           L  LQ +R +++PQ ++  +P +V+ FI L +D++L+S+I + +LLG  R   +   ++ 
Sbjct: 319 LGPLQTLRHVVLPQALRVALPVMVSQFISLLQDTTLLSLIGLLELLGTARAVMANPAFLG 378

Query: 348 SVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTL---HKGSKK 386
                   + +  +FW  C ++ L S  +E  L   H  S +
Sbjct: 379 DYGEV--YLTLAVLFWGCCTALGLGSRALEHRLDPRHTASAR 418


>gi|87302594|ref|ZP_01085411.1| permease protein of amino acid ABC transporter [Synechococcus sp.
           WH 5701]
 gi|87282938|gb|EAQ74895.1| permease protein of amino acid ABC transporter [Synechococcus sp.
           WH 5701]
          Length = 427

 Score =  151 bits (381), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 87/246 (35%), Positives = 148/246 (60%), Gaps = 3/246 (1%)

Query: 137 SFPRKFLNSI-LLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
           S+P + +  + L + L  +    ++ GGLG+  V  S WGGLL+TL+++ F I++S P+G
Sbjct: 178 SWPPRLVKLVPLSWPLLYLLGMVLIAGGLGIPRVPPSEWGGLLLTLLMASFAILLSFPIG 237

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           +++ALGR S++P+LR+  + +IE  RG PL+T+LF+   +L   LP  W  D++ RA   
Sbjct: 238 VVVALGRRSSLPLLRWTSVFYIEFIRGAPLITLLFLGQNILGYMLPGGWAPDRVWRAAWV 297

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           ++ F  AY+AE +R GL ++  GQ EAA SLGLS    ++ +++PQ ++  +P  V  FI
Sbjct: 298 LTFFCGAYLAEAVRAGLSAVPPGQLEAARSLGLSMPLALQRVVLPQALRIALPAAVGQFI 357

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            L +D++L+S+I + DLLG  R   +   ++         + +  +FW  C ++ L S  
Sbjct: 358 SLLQDTTLLSLIGLLDLLGTARTVMANPEFLGKNAEV--YLTLAVLFWCCCAALGLGSRA 415

Query: 376 IEKTLH 381
           +E+ L 
Sbjct: 416 LERRLD 421


>gi|148239751|ref|YP_001225138.1| ABC-type amino acid transport system permease component
           [Synechococcus sp. WH 7803]
 gi|147848290|emb|CAK23841.1| ABC-type amino acid transport system permease component
           [Synechococcus sp. WH 7803]
          Length = 328

 Score =  150 bits (380), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 105/292 (35%), Positives = 172/292 (58%), Gaps = 8/292 (2%)

Query: 94  ACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLI-PSFPRKF--LNSILL-- 148
           A W+ +      F  G+YP A RWRPIL   +  +L    L  P   R+   LNS +L  
Sbjct: 28  ADWSVVSGNLPLFAIGSYPEASRWRPILWLGSLLLLTLFTLAQPLLLRRGIGLNSTILSW 87

Query: 149 -FGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIP 207
            + L      ++L GG  L  V + LWGGL++TL+++ F  +I++PLG+LLALGR S + 
Sbjct: 88  SWLLMMPLGLWLLAGGGVLDPVPSRLWGGLVLTLLLTVFSGVIALPLGVLLALGRCSELT 147

Query: 208 VLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEV 267
             R     +I+  R VPL+ VLF   ++LPLFLP   ++++LLRA++    FA+AY+AE 
Sbjct: 148 TARQLSKIYIDGMRAVPLIAVLFFGQLLLPLFLPVQIEINRLLRAVVAFGLFAAAYVAED 207

Query: 268 LRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISII 327
           +RGGLQ++   Q EAA +LGL   Q  RL+I+PQ ++  +P + N  +GL +++SL++I+
Sbjct: 208 VRGGLQAVPPTQSEAAAALGLGPWQIQRLVILPQALRIAVPALTNQAVGLLQNTSLMAIL 267

Query: 328 NMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKT 379
            + +LLGI +   +   +I         +++  ++W+ C +++L +   E+ 
Sbjct: 268 GLVELLGISQSLLANPAYIGRHLEVY--VWLAALYWLLCTAMALMARQFERQ 317


>gi|218658149|ref|ZP_03514079.1| polar amino acid ABC transporter, inner membrane subunit [Rhizobium
           etli IE4771]
          Length = 177

 Score =  150 bits (379), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 117/186 (62%), Gaps = 16/186 (8%)

Query: 202 RNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFAS 261
           R S +P +R   I FIE  RGVPL+T+LF AS++L  FLP   + D +LR ++ VS FA+
Sbjct: 1   RRSRMPFIRGMSIVFIEFVRGVPLITLLFTASLLLNYFLPPGTNFDLILRVIIMVSLFAT 60

Query: 262 AYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDS 321
           AY+AEV+RGGL ++ +GQ+EA  SLGL Y Q  RL+IMPQ +K  IP IVNTFIGLFKD+
Sbjct: 61  AYMAEVIRGGLAALPRGQYEAGESLGLDYWQAQRLVIMPQALKISIPSIVNTFIGLFKDT 120

Query: 322 SLISIINMFDLLGIVRVNFSESTW-------ISSVTPTTGLIFIGFVFWIFCFSISLYSV 374
           +++  I + D + +     + + W       +S   P         +F++ CF +S YSV
Sbjct: 121 TIVVFIGLLDPIALTNSIRATTDWQGIYWELLSLPVP---------LFFVCCFGMSRYSV 171

Query: 375 FIEKTL 380
            +E+ L
Sbjct: 172 HLEQRL 177


>gi|209547001|ref|YP_002278919.1| polar amino acid ABC transporter inner membrane protein [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|209538245|gb|ACI58179.1| polar amino acid ABC transporter, inner membrane subunit [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 325

 Score =  148 bits (374), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 103/357 (28%), Positives = 177/357 (49%), Gaps = 42/357 (11%)

Query: 31  WIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDG 90
           W+ +N F    D +LT  ++ L+ +     + W   DA W G                  
Sbjct: 9   WLRRNLFANTVDSILTIFVLALVAWLTARFLGWAIEDARWRG------------------ 50

Query: 91  WNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFG 150
                   IY+     + G YP  + WR  L+     + +   +IPS  R+F  +ILL  
Sbjct: 51  --------IYESRRLLLVGLYPPEEIWRTWLMLGILCMAIGAAMIPSL-RRFAVAILLAA 101

Query: 151 LFPIFSFFVLYGGLGLSIVETSL--WGGLLVTLVISFFGIIISMPLGILLALGRNSNIPV 208
                       G  L +    L  WGGLL++L+++      S+PLG LLA GR+S  P 
Sbjct: 102 C----------AGAVLVLAPPGLDRWGGLLLSLMLAIVVSAASLPLGTLLAFGRSSRNPS 151

Query: 209 LRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVL 268
           LR  C  +IE+ R VPL+ V++   I +PLF P++  +  L+R ++G + F +AY+AE +
Sbjct: 152 LRACCAGYIEVMRSVPLILVVYWIWITVPLFAPES-SMSSLVRGMIGYTVFNAAYVAEFV 210

Query: 269 RGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIIN 328
           R GLQ++ +GQ EAA SLG+S       I++PQ I+ V P +V   + +F  ++L+ II 
Sbjct: 211 RSGLQAVPRGQREAAQSLGMSNWTVSTDIVLPQAIRFVQPALVGNVLDVFNGATLVFIIG 270

Query: 329 MFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSK 385
           + D L   ++  ++ +  S+V      +F+  V+++   +I+  +  +E  + + ++
Sbjct: 271 LTDFLRAGQMILADPSSSSAVQEV--YVFMFAVYFLIGSAITFGARRMEARMQRSTR 325


>gi|323162955|gb|EFZ48790.1| general L-amino acid transport system permease protein aapM
           [Escherichia coli E128010]
          Length = 154

 Score =  146 bits (369), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 72/139 (51%), Positives = 98/139 (70%), Gaps = 2/139 (1%)

Query: 245 DVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIK 304
           ++DKL+RAL+GV  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K
Sbjct: 14  NIDKLIRALVGVILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALK 73

Query: 305 RVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWI 364
            VIPG+VNT I LFKD+SL+ II +FDL   V+    + TW+     T G +F   ++WI
Sbjct: 74  LVIPGLVNTIIALFKDTSLVIIIGLFDLFSSVQQATVDPTWLG--MSTEGYVFAALIYWI 131

Query: 365 FCFSISLYSVFIEKTLHKG 383
           FCFS+S YS  +EK  + G
Sbjct: 132 FCFSMSRYSQHLEKRFNTG 150


>gi|193084290|gb|ACF09949.1| glutamine transport ATP-binding protein glnQ [uncultured marine
           group II euryarchaeote KM3-130-D10]
          Length = 552

 Score =  145 bits (365), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 83/222 (37%), Positives = 122/222 (54%), Gaps = 21/222 (9%)

Query: 169 VETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTV 228
           +E S WGGL V L+++  G ++   +G++LA GR S+ P      +  IEL R  PL+  
Sbjct: 331 IEASQWGGLFVNLIVATAGCVLGFGIGVILAFGRQSDQPFFSIPSVALIELVRSGPLICW 390

Query: 229 LFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGL 288
           L+ A  ++P  +   +D + ++R LL    F   YIAEVLRGGLQS+  GQ EAA +LGL
Sbjct: 391 LWFAVFLMPDLMDPFYDAEDIIRMLLMFGVFGGCYIAEVLRGGLQSVDSGQKEAAIALGL 450

Query: 289 SYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISS 348
           S  Q    + +P  ++  +P IV+ FIGL+KD++L+ IIN+ D   + +           
Sbjct: 451 SPFQTKMTVELPNAVRTTLPSIVSVFIGLWKDTTLLFIINILDFFKLAK----------- 499

Query: 349 VTPTTGLIFIG----------FVFWIFCFSISLYSVFIEKTL 380
             P T L F+G           VFW+F F +S  S+ IEK L
Sbjct: 500 DLPATDLRFLGNFLEPLYVTAIVFWVFAFYLSRVSMGIEKNL 541


>gi|297567747|ref|YP_003686718.1| hypothetical protein Mesil_3399 [Meiothermus silvanus DSM 9946]
 gi|296852196|gb|ADH65210.1| hypothetical protein Mesil_3399 [Meiothermus silvanus DSM 9946]
          Length = 363

 Score =  144 bits (364), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 82/217 (37%), Positives = 138/217 (63%), Gaps = 2/217 (0%)

Query: 169 VETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTV 228
           +   LW GL+++++++   ++++ PLG+ LAL +   +P+LR     ++EL RGVPLV+V
Sbjct: 149 IPIQLWSGLMLSVLLAVSSMVLAFPLGLALALAKAGRLPLLRALATGYVELVRGVPLVSV 208

Query: 229 LFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGL 288
           LF+A + LPLFLP+ +   ++LRA++G + FA+AY+AE +RGGLQ++ +GQ EAA +LGL
Sbjct: 209 LFLAFVTLPLFLPEGFRPPQVLRAIVGFTLFAAAYLAENVRGGLQAVPQGQREAAYALGL 268

Query: 289 SYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISS 348
           +       +++PQ ++ VIP IV  FI LFKD+SL+ +I + DLLG+ +   +   ++  
Sbjct: 269 NGFHTAYYVVLPQALRAVIPAIVGQFIALFKDTSLVVLIGLLDLLGMAQAVLANPLYLHR 328

Query: 349 VTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSK 385
                  +F+  V+     + S     IE+ L  GS+
Sbjct: 329 EREVY--LFLALVYLAVSGTFSYLGRLIERRLGVGSR 363


>gi|193084368|gb|ACF10024.1| glutamine transport system permease protein glnP [uncultured marine
           group II euryarchaeote AD1000-18-D2]
          Length = 561

 Score =  142 bits (357), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 81/222 (36%), Positives = 122/222 (54%), Gaps = 21/222 (9%)

Query: 169 VETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTV 228
           +E S WGGL V L+++  G ++   +G++LA GR S+ P      +  IEL R  PL+  
Sbjct: 340 IEASQWGGLFVNLIVATAGCVLGFGIGVILAFGRQSDQPFFSVPSVALIELVRSGPLICW 399

Query: 229 LFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGL 288
           L+ A  ++P  +   ++ + ++R LL    F   YIAEVLRGGLQ++  GQ EAA +LGL
Sbjct: 400 LWFAVFLMPDLMDPFYNAEDIMRMLLMFGIFGGCYIAEVLRGGLQAVDSGQKEAALALGL 459

Query: 289 SYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISS 348
           S  Q    + +P  ++  +P IV+ FIGL+KD++L+ IIN+ D   + +           
Sbjct: 460 SPFQTKMTVELPNAVRTTLPSIVSVFIGLWKDTTLLFIINILDFFKLAK----------- 508

Query: 349 VTPTTGLIFIG----------FVFWIFCFSISLYSVFIEKTL 380
             P T L F+G           VFW+F F +S  S+ IEK L
Sbjct: 509 DLPATDLRFLGNFLEPLYVTAIVFWVFAFYLSRVSMGIEKNL 550


>gi|193083902|gb|ACF09581.1| glutamine transport system permease protein glnP [uncultured marine
           group II euryarchaeote KM3-72-G3]
          Length = 564

 Score =  141 bits (355), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 82/222 (36%), Positives = 122/222 (54%), Gaps = 21/222 (9%)

Query: 169 VETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTV 228
           +E S WGGL V L+++  G ++   +G++LA GR S+ P      I  IEL R  PL+  
Sbjct: 343 IEASQWGGLFVNLIVATAGCVLGFGIGVVLAFGRQSDQPFFSVPSIALIELVRSGPLICW 402

Query: 229 LFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGL 288
           L+ A  ++P  +   ++ + ++R LL    F   YIAEVLRGGLQ++  GQ EAA +LGL
Sbjct: 403 LWFAVFLMPDLMDPFYNAEDIMRMLLMFGIFGGCYIAEVLRGGLQAVDSGQKEAALALGL 462

Query: 289 SYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISS 348
           S  Q    + +P  ++  +P IV+ FIGL+KD++L+ IIN+ D   + +           
Sbjct: 463 SPFQTKMQVELPNAVRTTLPSIVSVFIGLWKDTTLLFIINILDFFKLAK----------- 511

Query: 349 VTPTTGLIFIG----------FVFWIFCFSISLYSVFIEKTL 380
             P T L F+G           VFW+F F +S  S+ IEK L
Sbjct: 512 DLPATDLRFLGNFLEPLYVTALVFWVFAFYLSRISMKIEKGL 553


>gi|161170238|gb|ABX59209.1| transport system permease protein BztC [uncultured marine group II
           euryarchaeote EF100_57A08]
          Length = 699

 Score =  141 bits (355), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 86/235 (36%), Positives = 130/235 (55%), Gaps = 25/235 (10%)

Query: 160 LYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIEL 219
           L  G   S ++ S WGGL V L ++  G ++   +G++LA GR SN+P+ +Y  I  IEL
Sbjct: 464 LADGFSESGLKPSQWGGLFVNLFVAAAGCVLGFGIGVVLAFGRQSNLPLFKYPSIGIIEL 523

Query: 220 FRGVPLVTVLFMASIMLPLFLPDTW----DVDKLLRALLGVSAFASAYIAEVLRGGLQSI 275
            R  PL+  L+ A  +LP  +  T+    D D ++R +L    F   YIAEV+RGGLQS+
Sbjct: 524 VRSGPLICWLYFAMYLLPDVVEPTFKDPEDFDNIVRMMLIFGIFGGCYIAEVIRGGLQSV 583

Query: 276 SKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGI 335
             GQ EAA +LGL+ +Q    I +P  I+  +P IV+ FIGL+KD++L+ IIN+ D   +
Sbjct: 584 DSGQREAAIALGLNPIQTKLQIELPNAIRTTLPSIVSVFIGLWKDTTLLFIINILDFFKL 643

Query: 336 VRVNFSESTWISSVTPTTGLIFIG----------FVFWIFCFSISLYSVFIEKTL 380
            +            +P T + F+G           VFW+  F +S  S+ +E+ L
Sbjct: 644 AK-----------DSPNTDMRFLGDFIEPVYFSAIVFWVVAFYLSRVSMRMERNL 687


>gi|170516839|gb|ACB15241.1| glutamine transport ATP-binding protein GlnQ [uncultured marine
           group II euryarchaeote DeepAnt-15E7]
          Length = 545

 Score =  140 bits (354), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 83/227 (36%), Positives = 124/227 (54%), Gaps = 21/227 (9%)

Query: 169 VETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTV 228
           ++ S WGGL V L+++  G ++   +GI+LA GR S+ P      I  IEL R  PL+  
Sbjct: 324 IQASQWGGLFVNLIVATAGCVLGFGIGIVLAFGRQSDQPFFSIPSIALIELVRSGPLICW 383

Query: 229 LFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGL 288
           L+ A  ++P  +   ++ + ++R LL    F   YIAEVLRGGLQ++  GQ EAA +LGL
Sbjct: 384 LWFAVFLMPDLMDPFYNAEDIIRMLLMFGVFGGCYIAEVLRGGLQAVDSGQKEAAIALGL 443

Query: 289 SYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISS 348
           S  Q    + +P  ++  +P IV+ FIGL+KD++L+ IIN+ D   + +           
Sbjct: 444 SPFQTKMQVELPNAVRTTLPSIVSVFIGLWKDTTLLFIINILDFFKLAK----------- 492

Query: 349 VTPTTGLIFIG----------FVFWIFCFSISLYSVFIEKTLHKGSK 385
             P T L F+G           VFW+F F +S  S+ IEK L   S+
Sbjct: 493 DLPATDLRFLGNFLEPLYVTALVFWVFAFYLSRVSMKIEKGLGLTSE 539


>gi|33865376|ref|NP_896935.1| ABC transporter for amino acids, membrane component [Synechococcus
           sp. WH 8102]
 gi|33632545|emb|CAE07357.1| ABC transporter for amino acids, membrane component [Synechococcus
           sp. WH 8102]
          Length = 324

 Score =  139 bits (351), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 107/323 (33%), Positives = 183/323 (56%), Gaps = 31/323 (9%)

Query: 60  IIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRP 119
           ++HW+                           + A W+ +      F  G+YP  QRWRP
Sbjct: 24  VVHWLL--------------------------HGADWSVVSANLPLFAVGSYPSDQRWRP 57

Query: 120 ILVFLTGSILLTPMLIPSFPRKFLNSI--LLFGLFPIFSFFVLYGGLGLSIVETSLWGGL 177
           +L   T  +L+   L       +  ++  L   + P+  + +  G   L  V T  WGGL
Sbjct: 58  LLWISTCVVLVVLTLTAPRGAGWRRALPPLWIAMAPLGLWLLAGGLGLLP-VGTRHWGGL 116

Query: 178 LVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLP 237
            +TL+++    ++++PLG+LLALGR S++PVLR++   +IEL R VPL+ VLF   +++P
Sbjct: 117 TLTLLLTAGSGLLALPLGVLLALGRRSDLPVLRWSSTVYIELMRAVPLIAVLFFGQLLIP 176

Query: 238 LFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLI 297
           LFLP   +++++LRA+L  + FA+AYIAE +RGGLQ+I   Q EAA+ LGLS LQ ++L+
Sbjct: 177 LFLPPGLEINRVLRAVLAFALFAAAYIAEDVRGGLQAIPPTQREAASVLGLSPLQTLQLV 236

Query: 298 IMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIF 357
           ++PQ ++  +P + N  +GL +++SL++I+ + +LLGI R   +   +I         ++
Sbjct: 237 VLPQALRVALPSLTNQAVGLLQNTSLMAILGLVELLGISRSLLANPAFIGRYLEV--YLW 294

Query: 358 IGFVFWIFCFSISLYSVFIEKTL 380
           +  V+W+ C +++L +  +E  L
Sbjct: 295 LAAVYWLACTAMALLARHLEVQL 317


>gi|88808787|ref|ZP_01124297.1| ABC transporter for amino acids, membrane component [Synechococcus
           sp. WH 7805]
 gi|88787775|gb|EAR18932.1| ABC transporter for amino acids, membrane component [Synechococcus
           sp. WH 7805]
          Length = 335

 Score =  135 bits (341), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 109/296 (36%), Positives = 174/296 (58%), Gaps = 13/296 (4%)

Query: 92  NAACWAFIYDRYEQFIFGNYPMAQRWRPILVFL-----TGSILLTPMLIPSFPRKFLNSI 146
             A W+ +      F  G YP A RWRPIL        TG  L  P L+    R  LNS 
Sbjct: 34  QQAEWSVVSGNLPLFAVGGYPEASRWRPILWLALLVLLTGFTLAQPFLLQ---RLRLNST 90

Query: 147 LL---FGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRN 203
           +L   + L      ++L GG  L+ V + LWGGL++TL+++ F  +I++PLGILLALGR 
Sbjct: 91  MLSWSWLLMMPLGLWLLAGGGVLAPVPSRLWGGLVLTLLLTLFSGLIALPLGILLALGRC 150

Query: 204 SNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAY 263
           S +   R     +I+  R VPL+ VLF   ++LPLFLP   +++++ RA++  + FA+AY
Sbjct: 151 SELTTARLLSKIYIDGMRAVPLIAVLFFGQLLLPLFLPVQIEINRVFRAVVAFALFAAAY 210

Query: 264 IAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSL 323
           +AE LRGGLQ++S  Q EAA +LGL   Q  RL+I+PQ ++  +P + N  +GL +++SL
Sbjct: 211 VAEDLRGGLQAVSPTQIEAAAALGLGPWQIQRLVILPQALRIAVPALTNQAVGLLQNTSL 270

Query: 324 ISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKT 379
           ++I+ + +LLGI +   +   +I         +++  ++W+FC +++L +   E+ 
Sbjct: 271 MAILGLVELLGISQSLLANPAYIGRHLEV--YVWLAALYWLFCTAMALMARQFERQ 324


>gi|308126407|ref|ZP_07663749.1| general L-amino acid transport system permease protein AapM [Vibrio
           parahaemolyticus AQ4037]
 gi|308108538|gb|EFO46078.1| general L-amino acid transport system permease protein AapM [Vibrio
           parahaemolyticus AQ4037]
          Length = 118

 Score =  135 bits (339), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 89/120 (74%), Gaps = 2/120 (1%)

Query: 267 VLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISI 326
           ++RGGLQ+I KGQ+EAA++LGLSY +K  LII+PQ +K  IP IVNTFIGLFKD+SL+ I
Sbjct: 1   MVRGGLQAIPKGQYEAADALGLSYWKKTGLIILPQALKITIPSIVNTFIGLFKDTSLVLI 60

Query: 327 INMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
           I MFD+LGI +   ++  W+   T +   +F+  VFW+FCF +S YS+++E  LH G K+
Sbjct: 61  IGMFDVLGIGQAANTDPEWLGFATES--YVFVALVFWVFCFGMSRYSIWLENKLHTGHKR 118


>gi|312897773|ref|ZP_07757189.1| ABC transporter, permease protein [Megasphaera micronuciformis
           F0359]
 gi|310621157|gb|EFQ04701.1| ABC transporter, permease protein [Megasphaera micronuciformis
           F0359]
          Length = 216

 Score =  131 bits (330), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 80/216 (37%), Positives = 122/216 (56%), Gaps = 7/216 (3%)

Query: 166 LSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPL 225
           LS +  ++  GL VTL I    I++S+PLGI++A+ R S + VLR     +I L RG PL
Sbjct: 4   LSTIVPAIADGLQVTLKIFVITIVLSLPLGIIMAMARLSPLAVLRKLLEGYIYLMRGTPL 63

Query: 226 VTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANS 285
           +  +      LP  +P     D     +  V  +A AY AE+ RGG+QSI +GQ+E A  
Sbjct: 64  MLQILFIYYGLPFLIPGLRLADYPAAIIAFVLNYA-AYFAEIFRGGIQSIDRGQYEGAKV 122

Query: 286 LGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTW 345
           LG++Y Q MR I++PQV+KRV+P + N  I L KD+SL+ I+ M D+L I R      + 
Sbjct: 123 LGMTYAQTMRRIVLPQVLKRVLPPVANETINLLKDTSLVYILAMNDVLRITR------SI 176

Query: 346 ISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
           +     TT  I     + +F F ++ + +++EK  +
Sbjct: 177 VQRDFDTTAFIVAAVFYLVFTFILTRFFMYLEKRFN 212


>gi|258406609|ref|YP_003199351.1| polar amino acid ABC transporter, inner membrane subunit
           [Desulfohalobium retbaense DSM 5692]
 gi|257798836|gb|ACV69773.1| polar amino acid ABC transporter, inner membrane subunit
           [Desulfohalobium retbaense DSM 5692]
          Length = 335

 Score =  130 bits (328), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 74/209 (35%), Positives = 123/209 (58%), Gaps = 11/209 (5%)

Query: 176 GLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIM 235
           GL +TL +S   II+ + LG+L  L R S+ P LR++ IT+IE+ RG PL+  +F+   +
Sbjct: 129 GLWITLKVSVVAIILGIVLGVLTGLSRISSNPALRWSAITYIEIIRGSPLLVQIFLWYFV 188

Query: 236 LPLFLPDTWDVDKLLR------ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLS 289
           +   +      + L +       ++ ++ F  AY+AE++R G+QS+S+GQ EAA SLG++
Sbjct: 189 IGTLVNSILAQNGLGQISPLWFGIISLAVFTGAYVAEIVRAGIQSVSRGQMEAARSLGMT 248

Query: 290 YLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSV 349
           Y Q MR +I+PQ  KR++P +   FI L KDSSL+ +I++ +L    R   +     SS+
Sbjct: 249 YTQSMRKVILPQAFKRILPALAGQFISLIKDSSLLGVISVRELTKATREVVT-----SSL 303

Query: 350 TPTTGLIFIGFVFWIFCFSISLYSVFIEK 378
            P    I    ++ +  F++SL   +IE+
Sbjct: 304 QPFELWITCAVLYLLLTFTLSLVVQYIER 332


>gi|218887871|ref|YP_002437192.1| polar amino acid ABC transporter inner membrane protein
           [Desulfovibrio vulgaris str. 'Miyazaki F']
 gi|218758825|gb|ACL09724.1| polar amino acid ABC transporter, inner membrane subunit
           [Desulfovibrio vulgaris str. 'Miyazaki F']
          Length = 596

 Score =  130 bits (327), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 74/206 (35%), Positives = 125/206 (60%), Gaps = 6/206 (2%)

Query: 175 GGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASI 234
           GGL  +L+++   I +S  +G+ + +GR+S+  V R  C+ +IEL RG PL+ V+F    
Sbjct: 388 GGLAYSLLMAVIAISVSFFIGLAVGVGRSSSNRVFRIPCLLYIELIRGNPLIIVIFWVYF 447

Query: 235 MLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKM 294
            +P+    T +V     A   ++AF  AYIAE++R G+Q+I  GQ EAA S GL+YLQ M
Sbjct: 448 FIPVMFGTTLNV--FWSATWALTAFTGAYIAEIVRTGIQNIPAGQVEAAYSTGLTYLQAM 505

Query: 295 RLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTG 354
           R I++PQ +K++IP IV  FI +FKD+SL  ++ + +L  + +   +       + P   
Sbjct: 506 RRIVLPQALKQMIPAIVGQFIAIFKDTSLAFVLGVLELTFVAQGINNRLM----IHPMEI 561

Query: 355 LIFIGFVFWIFCFSISLYSVFIEKTL 380
              + F+++I C+S+S+++  +E+ L
Sbjct: 562 YGTVAFLYFICCYSMSVFAARLERRL 587



 Score = 87.4 bits (215), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 54/144 (37%), Positives = 77/144 (53%), Gaps = 6/144 (4%)

Query: 195 GILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVD------K 248
           G +L L R S    LR      IE FR  PL+  LF      P  LPD           +
Sbjct: 79  GTMLGLARLSLFRPLRVTATCVIEFFRNTPLLIQLFFWYFAFPAILPDNAREALFSIQFE 138

Query: 249 LLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIP 308
              A +G+S + ++++AEV+R GLQSI KG  EAA S GLSY Q +R II+P   + +IP
Sbjct: 139 FWCATIGLSIYTASFMAEVIRAGLQSIPKGLLEAAYSSGLSYFQVLRTIILPLAFRAIIP 198

Query: 309 GIVNTFIGLFKDSSLISIINMFDL 332
            + + F+   K+SSL  ++ + +L
Sbjct: 199 PLGSEFLNNMKNSSLAMVVGVAEL 222


>gi|152997696|ref|YP_001342531.1| polar amino acid ABC transporter inner membrane subunit
           [Marinomonas sp. MWYL1]
 gi|150838620|gb|ABR72596.1| polar amino acid ABC transporter, inner membrane subunit
           [Marinomonas sp. MWYL1]
          Length = 315

 Score =  130 bits (326), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 71/174 (40%), Positives = 105/174 (60%), Gaps = 10/174 (5%)

Query: 165 GLSIVETSLWG------GLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIE 218
           G  +VE   W       GL++TL +S   ++ ++ +G+   L R S  P LRY  +T+IE
Sbjct: 99  GDPLVEVENWNIGPLTWGLVMTLQLSVVSLVFAVVIGLFAGLARISTNPALRYLSVTYIE 158

Query: 219 LFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKG 278
           L RG PL+  +F+       F+    D+D+    +  +S F  AYIAE++R G+QSIS G
Sbjct: 159 LIRGTPLLVQIFI----FYFFIGTVLDLDRFTAGVAALSVFTGAYIAEIVRSGIQSISPG 214

Query: 279 QFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDL 332
           Q EAA SLG++Y+Q M  +I+PQ  KR +P +   FI L KDSSL+S+I++ DL
Sbjct: 215 QMEAARSLGMNYVQAMVNVILPQAFKRTLPPMAGQFINLIKDSSLVSVISITDL 268


>gi|313673773|ref|YP_004051884.1| amino acid abc transporter membrane protein, paat family
           [Calditerrivibrio nitroreducens DSM 19672]
 gi|312940529|gb|ADR19721.1| amino acid ABC transporter membrane protein, PAAT family
           [Calditerrivibrio nitroreducens DSM 19672]
          Length = 315

 Score =  130 bits (326), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 103/157 (65%), Gaps = 4/157 (2%)

Query: 176 GLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIM 235
           GL  TL ISF  I+I++ +GI+  L R S+   L+   +T++EL RG PL+  +F+    
Sbjct: 116 GLWNTLYISFVSILIAIVIGIVTGLCRISSNVALKKLAVTYVELIRGTPLLVQIFI---- 171

Query: 236 LPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMR 295
              F+   + +D++   +  ++ FA AYIAE++R G+QSI KGQ EA+ SLG++Y Q MR
Sbjct: 172 FYFFIGTVFKLDRITSGIAALAIFAGAYIAEIVRAGIQSIPKGQMEASRSLGMNYFQAMR 231

Query: 296 LIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDL 332
            +I+PQ IKR +P +   FI L KDSSL+S+I++ DL
Sbjct: 232 YVILPQAIKRTLPPMAGQFISLIKDSSLVSVISITDL 268


>gi|326797152|ref|YP_004314972.1| polar amino acid ABC transporter inner membrane subunit
           [Marinomonas mediterranea MMB-1]
 gi|326547916|gb|ADZ93136.1| polar amino acid ABC transporter, inner membrane subunit
           [Marinomonas mediterranea MMB-1]
          Length = 315

 Score =  129 bits (324), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 103/157 (65%), Gaps = 4/157 (2%)

Query: 176 GLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIM 235
           GL VT+ ISF  +I S+ LG++  L R S+  VLR   +T++E+ RG PL+  +F+    
Sbjct: 116 GLWVTIKISFISLIFSIILGLIFGLMRISHRQVLRNLAVTYVEVIRGTPLLVQIFI---- 171

Query: 236 LPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMR 295
           +  F+   +D+D+    +  +S F  AY+AE++R G+Q++  GQ EAA SLG++Y+Q M 
Sbjct: 172 VYFFIGTVFDLDRFTAGVAALSIFTGAYVAEIVRAGIQAVPTGQMEAARSLGMNYVQAMC 231

Query: 296 LIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDL 332
            ++MPQ IKR +P +   FI L KDSSL+S+I++ DL
Sbjct: 232 YVVMPQAIKRTLPPLAGQFINLIKDSSLVSVISITDL 268


>gi|326797190|ref|YP_004315010.1| polar amino acid ABC transporter inner membrane subunit
           [Marinomonas mediterranea MMB-1]
 gi|326547954|gb|ADZ93174.1| polar amino acid ABC transporter, inner membrane subunit
           [Marinomonas mediterranea MMB-1]
          Length = 314

 Score =  129 bits (324), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 103/157 (65%), Gaps = 4/157 (2%)

Query: 176 GLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIM 235
           GL VT+ ISF  ++ S+ LG++  L R S+  VLR   +T++E+ RG PL+  +F+    
Sbjct: 115 GLWVTIKISFISLVFSIILGLIFGLMRISHRQVLRNLAVTYVEVIRGTPLLVQIFI---- 170

Query: 236 LPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMR 295
           +  F+   +D+D+    +  +S F  AY+AE++R G+Q++  GQ EAA SLG++Y+Q M 
Sbjct: 171 VYFFIGTVFDLDRFTAGVAALSIFTGAYVAEIVRAGIQAVPTGQMEAARSLGMNYVQAMC 230

Query: 296 LIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDL 332
            +IMPQ IKR +P +   FI L KDSSL+S+I++ DL
Sbjct: 231 YVIMPQAIKRTLPPLAGQFINLIKDSSLVSVISITDL 267


>gi|258406150|ref|YP_003198892.1| polar amino acid ABC transporter, inner membrane subunit
           [Desulfohalobium retbaense DSM 5692]
 gi|257798377|gb|ACV69314.1| polar amino acid ABC transporter, inner membrane subunit
           [Desulfohalobium retbaense DSM 5692]
          Length = 598

 Score =  129 bits (323), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 78/219 (35%), Positives = 126/219 (57%), Gaps = 8/219 (3%)

Query: 170 ETSLWG--GLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVT 227
           E  +WG  GL  +++++   I IS  +G+++ LGR S   +LR  C+ +IE+ RG PL+ 
Sbjct: 383 ENFMWGLGGLSFSILMAVIAISISFFIGLIVGLGRMSKNRILRLPCMVYIEVIRGNPLII 442

Query: 228 VLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLG 287
           V+F     LP+F+    +V     A + ++ F  AYIAE++RGG+Q+I  GQFEAA   G
Sbjct: 443 VIFWVYFFLPIFIKTYLNV--FWSATIALTIFTGAYIAEIVRGGIQNIPPGQFEAAYGTG 500

Query: 288 LSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWIS 347
           L Y   MR I++PQ +K++IP IV  FI +FKD+SL  +I + +L  + +   +    I 
Sbjct: 501 LGYWSTMRHIVLPQALKQMIPAIVGQFIAIFKDTSLAFVIGVLELTFVAQ-GLNNRLMIY 559

Query: 348 SVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
                T    +  +++I C+S+SL +  +E  L   S +
Sbjct: 560 PFEIYTS---VAALYFICCYSMSLMARRLENKLTPASAR 595



 Score = 94.0 bits (232), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 91/160 (56%), Gaps = 6/160 (3%)

Query: 179 VTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPL 238
           VT++IS     I++ LG +  LGR S+          ++E FR  PL+  LF     LP 
Sbjct: 65  VTIIISLISAGIALGLGTVFGLGRLSSFKPFYLFSTWYVEFFRNTPLLVQLFFWYFALPK 124

Query: 239 FLPDT-----WDVD-KLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
            LP+      + +D +   A LG++ + S+++AEV+R G+QSI KG  EAA S GL+Y Q
Sbjct: 125 ALPEAARNFVFSLDYEFWSATLGLAIYTSSFMAEVIRAGVQSIPKGLLEAAYSSGLTYFQ 184

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDL 332
            +R +I+P   + +IP + + F+   K+SSL  ++ + +L
Sbjct: 185 ALRTVILPLAFRAIIPPLGSEFLNNMKNSSLAMVVGVAEL 224


>gi|120603262|ref|YP_967662.1| polar amino acid ABC transporter, inner membrane subunit
           [Desulfovibrio vulgaris DP4]
 gi|120563491|gb|ABM29235.1| amino acid ABC transporter membrane protein 1, PAAT family / amino
           acid ABC transporter membrane protein 2, PAAT family
           [Desulfovibrio vulgaris DP4]
          Length = 596

 Score =  126 bits (317), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 71/208 (34%), Positives = 127/208 (61%), Gaps = 8/208 (3%)

Query: 175 GGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASI 234
           GGL  +L+++   I +S  +G+++ +GR S+  + R  C+ +IEL RG PL+ V+F    
Sbjct: 388 GGLAYSLLMAVIAISVSFFIGLVVGIGRTSDNRICRIPCLLYIELIRGNPLIIVIFWIYF 447

Query: 235 MLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKM 294
            +P+     ++V     A + ++ F  AY+AE++R G+Q+I  GQ EAA S GL+++Q M
Sbjct: 448 FIPVLFNTFFNV--FWSATIALTLFTGAYLAEIVRAGIQNIPAGQVEAAYSTGLTFVQTM 505

Query: 295 RLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVR-VNFSESTWISSVTPTT 353
           R II+PQ +K++IP IV  FI +FKD+SL  ++ + +L  + + +N     +   +  T 
Sbjct: 506 RRIILPQALKQMIPAIVGQFIAIFKDTSLAFVLGVLELTFVAQGINNRLMVYPMEIYGT- 564

Query: 354 GLIFIGFVFWIFCFSISLYSVFIEKTLH 381
               + F+++I C+S+S+Y+  +E+ L 
Sbjct: 565 ----VAFLYFICCWSMSVYAARLERRLS 588



 Score = 98.2 bits (243), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 68/188 (36%), Positives = 104/188 (55%), Gaps = 16/188 (8%)

Query: 154 IFSFFVLYG-GLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYA 212
           +F+    YG  LGL I++     GL VT+ IS     +++ LG +L + R S    LR  
Sbjct: 42  LFTRNTTYGTHLGLEILK-----GLGVTVRISLISSALALGLGTVLGIARLSLFAPLRLT 96

Query: 213 CITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLL--------RALLGVSAFASAYI 264
               +E FR  PL+  LF      P  LP+  ++ +LL         A +G+S + SA++
Sbjct: 97  ATAVVEFFRNTPLLVQLFFWYFAFPAILPE--NIRELLFTGNFEFWCATIGLSVYTSAFM 154

Query: 265 AEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLI 324
           AEV+R GLQSI KG  EAA S GL+Y+Q +R II+P   + +IP + + F+   K+SSL 
Sbjct: 155 AEVIRAGLQSIPKGLLEAAYSSGLNYVQVLRTIILPMAFRAIIPPLGSEFLNNMKNSSLA 214

Query: 325 SIINMFDL 332
            ++ + +L
Sbjct: 215 MVVGVAEL 222


>gi|46579164|ref|YP_009972.1| His/Glu/Gln/Arg/opine ABC transporter permease [Desulfovibrio
           vulgaris str. Hildenborough]
 gi|46448577|gb|AAS95231.1| amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine
           family [Desulfovibrio vulgaris str. Hildenborough]
 gi|311233002|gb|ADP85856.1| polar amino acid ABC transporter, inner membrane subunit
           [Desulfovibrio vulgaris RCH1]
          Length = 596

 Score =  126 bits (317), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 71/208 (34%), Positives = 127/208 (61%), Gaps = 8/208 (3%)

Query: 175 GGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASI 234
           GGL  +L+++   I +S  +G+++ +GR S+  + R  C+ +IEL RG PL+ V+F    
Sbjct: 388 GGLAYSLLMAVIAISVSFFIGLVVGIGRTSDNRICRIPCLLYIELIRGNPLIIVIFWIYF 447

Query: 235 MLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKM 294
            +P+     ++V     A + ++ F  AY+AE++R G+Q+I  GQ EAA S GL+++Q M
Sbjct: 448 FIPVLFNTFFNV--FWSATIALTLFTGAYLAEIVRAGIQNIPAGQVEAAYSTGLTFVQTM 505

Query: 295 RLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVR-VNFSESTWISSVTPTT 353
           R II+PQ +K++IP IV  FI +FKD+SL  ++ + +L  + + +N     +   +  T 
Sbjct: 506 RRIILPQALKQMIPAIVGQFIAIFKDTSLAFVLGVLELTFVAQGINNRLMVYPMEIYGT- 564

Query: 354 GLIFIGFVFWIFCFSISLYSVFIEKTLH 381
               + F+++I C+S+S+Y+  +E+ L 
Sbjct: 565 ----VAFLYFICCWSMSVYAARLERRLS 588



 Score = 98.2 bits (243), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 68/188 (36%), Positives = 104/188 (55%), Gaps = 16/188 (8%)

Query: 154 IFSFFVLYG-GLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYA 212
           +F+    YG  LGL I++     GL VT+ IS     +++ LG +L + R S    LR  
Sbjct: 42  LFTRNTTYGTHLGLEILK-----GLGVTVRISLISSALALGLGTVLGIARLSLFAPLRLT 96

Query: 213 CITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLL--------RALLGVSAFASAYI 264
               +E FR  PL+  LF      P  LP+  ++ +LL         A +G+S + SA++
Sbjct: 97  ATAVVEFFRNTPLLVQLFFWYFAFPAILPE--NIRELLFTGNFEFWCATIGLSVYTSAFM 154

Query: 265 AEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLI 324
           AEV+R GLQSI KG  EAA S GL+Y+Q +R II+P   + +IP + + F+   K+SSL 
Sbjct: 155 AEVIRAGLQSIPKGLLEAAYSSGLNYVQVLRTIILPMAFRAIIPPLGSEFLNNMKNSSLA 214

Query: 325 SIINMFDL 332
            ++ + +L
Sbjct: 215 MVVGVAEL 222


>gi|327399611|ref|YP_004340480.1| polar amino acid ABC transporter inner membrane subunit [Hippea
           maritima DSM 10411]
 gi|327182240|gb|AEA34421.1| polar amino acid ABC transporter, inner membrane subunit [Hippea
           maritima DSM 10411]
          Length = 314

 Score =  126 bits (316), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 71/205 (34%), Positives = 121/205 (59%), Gaps = 9/205 (4%)

Query: 176 GLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIM 235
           GL +T+ +S   II+++ +G ++ L R S+ P+ +   I +IEL RG PL+  +F+    
Sbjct: 115 GLYMTIKVSLLSIIMALVIGFIVGLMRISDNPLFKNLAIVYIELIRGTPLLVQIFI---- 170

Query: 236 LPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMR 295
           +  F+   + + +       ++ F  AYIAE++R G+QSI +GQ EAA +LG++Y Q MR
Sbjct: 171 IYFFIGTIFSMTRFFAGAFALAVFEGAYIAEIIRAGIQSIPRGQTEAAVALGMNYYQVMR 230

Query: 296 LIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGL 355
            IIMPQ IKRV+P +   FI L KDSSL+S+I++ +L         +    S+ +P    
Sbjct: 231 YIIMPQAIKRVLPALAGQFISLIKDSSLLSVISLTEL-----TKAGKEIVSSTFSPFEVW 285

Query: 356 IFIGFVFWIFCFSISLYSVFIEKTL 380
             +  +++I  +++SL   ++E+ L
Sbjct: 286 FSVAALYFIVTYTLSLLDRYLERRL 310


>gi|331005159|ref|ZP_08328559.1| polar amino acid ABC transporter, inner membrane subunit [gamma
           proteobacterium IMCC1989]
 gi|330421039|gb|EGG95305.1| polar amino acid ABC transporter, inner membrane subunit [gamma
           proteobacterium IMCC1989]
          Length = 315

 Score =  126 bits (316), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 64/157 (40%), Positives = 103/157 (65%), Gaps = 4/157 (2%)

Query: 176 GLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIM 235
           G+++T+ ISFF +I ++ +G+++ + R +   +       +IE+ RG PL+  +F+    
Sbjct: 115 GMMMTIYISFFSLIFAIIIGLVVGILRTTKNVIAMNLTTVYIEIIRGTPLLVQIFI---- 170

Query: 236 LPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMR 295
              F+    D+D++   +  +S F+ AYIAE++R G+QSI +GQ E A SLGLSYLQ MR
Sbjct: 171 FYFFIGTVLDLDRMTAGIAALSIFSGAYIAEIVRSGIQSIPQGQTEGAKSLGLSYLQTMR 230

Query: 296 LIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDL 332
           L+I+PQ I++ +P +V  FI L KDSSL+S+I + DL
Sbjct: 231 LVILPQAIRKTLPPMVGQFINLVKDSSLVSVIAITDL 267


>gi|46579380|ref|YP_010188.1| His/Glu/Gln/Arg/opine ABC transporter permease [Desulfovibrio
           vulgaris str. Hildenborough]
 gi|120603064|ref|YP_967464.1| polar amino acid ABC transporter inner membrane protein
           [Desulfovibrio vulgaris DP4]
 gi|46448794|gb|AAS95447.1| amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine
           family [Desulfovibrio vulgaris str. Hildenborough]
 gi|120563293|gb|ABM29037.1| amino acid ABC transporter membrane protein, PAAT family
           [Desulfovibrio vulgaris DP4]
 gi|311233203|gb|ADP86057.1| polar amino acid ABC transporter, inner membrane subunit
           [Desulfovibrio vulgaris RCH1]
          Length = 337

 Score =  125 bits (315), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 72/209 (34%), Positives = 120/209 (57%), Gaps = 11/209 (5%)

Query: 176 GLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIM 235
           GL +TL +S   III + LG++  L R S  P LR+  IT+IE+ RG PL+  +F+   +
Sbjct: 130 GLWITLEVSMLAIIIGIVLGVVTGLARISVNPALRWLAITYIEIIRGSPLLVQVFLWYFV 189

Query: 236 LPLFLPDTWD------VDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLS 289
           +   L   ++      +  L   ++ ++ F  AY+AE++R G+QS+ +GQ EAA SLG+S
Sbjct: 190 VGTLLNALFEKVGLSAIPPLWYGVMALAIFTGAYVAEIVRAGIQSVHRGQMEAARSLGMS 249

Query: 290 YLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSV 349
           Y Q MR +I+PQ  +R++P +   FI L KDSSL+ +I + +L    R   +     +S+
Sbjct: 250 YAQSMRKVILPQAFRRIMPPLAGQFISLVKDSSLLGVIAVRELTKATREVVT-----TSL 304

Query: 350 TPTTGLIFIGFVFWIFCFSISLYSVFIEK 378
            P    I    ++ +  F++SL   ++E+
Sbjct: 305 QPFELWIVCALLYLVLTFTLSLCVQYLER 333


>gi|291288058|ref|YP_003504874.1| polar amino acid ABC transporter, inner membrane subunit
           [Denitrovibrio acetiphilus DSM 12809]
 gi|290885218|gb|ADD68918.1| polar amino acid ABC transporter, inner membrane subunit
           [Denitrovibrio acetiphilus DSM 12809]
          Length = 316

 Score =  125 bits (315), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 65/160 (40%), Positives = 102/160 (63%), Gaps = 4/160 (2%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
           L  GLLVTL IS + I  ++ +G++  L R S  P L+   + +IE+ RG PL+  +F+ 
Sbjct: 113 LLSGLLVTLEISIYSIFFAIIIGVMTGLARISKNPFLKKLSVFYIEIIRGTPLLVQIFI- 171

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
                 F+   ++++++   +  +S F  AYIAE++R G+QS+ KGQ EAA SLG+SY +
Sbjct: 172 ---FYFFIGTVFNLERMTAGVAALSVFTGAYIAEIVRAGIQSVHKGQMEAARSLGMSYPK 228

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDL 332
            M L+I+PQ  +R +P +   FI L KDSSL+S+I++ DL
Sbjct: 229 AMVLVILPQAFRRTLPPMAGQFISLIKDSSLVSVISITDL 268


>gi|78357807|ref|YP_389256.1| amino acid ABC transporter permease [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
 gi|78220212|gb|ABB39561.1| amino acid ABC transporter membrane protein 2, PAAT family / amino
           acid ABC transporter membrane protein 1, PAAT family
           [Desulfovibrio desulfuricans subsp. desulfuricans str.
           G20]
          Length = 596

 Score =  125 bits (315), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 71/207 (34%), Positives = 121/207 (58%), Gaps = 6/207 (2%)

Query: 175 GGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASI 234
           GGL  +L+++   I +S  +G+ + LGR +   + R  C+ +IE+ RG PL+ V+F    
Sbjct: 388 GGLASSLLMALIAISVSFFIGLAVGLGRCARNRIFRLPCLVYIEIIRGNPLIIVIFWIYF 447

Query: 235 MLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKM 294
            LP+     +DV     A + ++ F  AY+AE++R G+Q+I  GQ EAA S GLSY Q M
Sbjct: 448 FLPVVFGAYFDV--FWSATIALTVFTGAYLAEIVRAGVQNIPAGQVEAAYSTGLSYFQTM 505

Query: 295 RLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTG 354
           R I++PQ +K++IP IV  FI +FKD+SL  +I + +L  + +   +       V P   
Sbjct: 506 RRIVLPQALKQMIPAIVGQFIAIFKDTSLAFVIGVLELTFVAQGLDNRLM----VYPFEI 561

Query: 355 LIFIGFVFWIFCFSISLYSVFIEKTLH 381
              +  ++++ C+++S+Y+  +E+ L 
Sbjct: 562 WTTVAVLYFVCCYAMSVYAARLERRLS 588



 Score = 90.1 bits (222), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 59/163 (36%), Positives = 87/163 (53%), Gaps = 6/163 (3%)

Query: 176 GLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIM 235
           GL+ T+ IS     +++ LG +L L R S    LR +    +E FR  PL+  LF     
Sbjct: 60  GLVTTVNISLISSALALGLGTMLGLARLSAFRPLRISASVVVEFFRNTPLLVQLFFWYFA 119

Query: 236 LPLFLPDT---WDVDKLLRALLGVSA---FASAYIAEVLRGGLQSISKGQFEAANSLGLS 289
            P  LP+    W  ++       VSA   +  +++AEV+R GLQSI KG  EAA S GLS
Sbjct: 120 FPNVLPEAARQWVFEQNFEFWCAVSALGVYTGSFMAEVIRAGLQSIPKGLLEAAYSSGLS 179

Query: 290 YLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDL 332
           Y Q +  II+P   + +IP + + F+   K+SSL  +I + +L
Sbjct: 180 YFQVLTRIILPLAFRTIIPPLGSEFLNNMKNSSLAMVIGVAEL 222


>gi|134298596|ref|YP_001112092.1| polar amino acid ABC transporter, inner membrane subunit
           [Desulfotomaculum reducens MI-1]
 gi|134051296|gb|ABO49267.1| amino acid ABC transporter membrane protein, PAAT family
           [Desulfotomaculum reducens MI-1]
          Length = 221

 Score =  125 bits (315), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 77/177 (43%), Positives = 107/177 (60%), Gaps = 15/177 (8%)

Query: 156 SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACIT 215
           +F +L  GL L+I  TSL           FFG II    G+ + LG+ S I +++   IT
Sbjct: 10  AFPILMMGLKLTIQLTSL---------AVFFGCII----GLFVGLGKMSRIKLIKIPAIT 56

Query: 216 FIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSI 275
           +IE FRG PL+  LF+    LP  L     VD+   A+  +S  + AY AE+ R G+QSI
Sbjct: 57  YIEFFRGSPLLVQLFLIYFGLPQILGH--PVDRFWSAVAVLSLNSGAYCAEIFRAGIQSI 114

Query: 276 SKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDL 332
            KGQ EAA SLG++++Q MR +I+PQ  KRVIP + N FI + KD+SL+S+I M +L
Sbjct: 115 EKGQMEAARSLGMTHIQAMRYVILPQAFKRVIPPLGNEFIAMMKDTSLVSVIGMAEL 171


>gi|78356431|ref|YP_387880.1| amino acid ABC transporter permease [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
 gi|78218836|gb|ABB38185.1| amino acid ABC transporter membrane protein, PAAT family
           [Desulfovibrio desulfuricans subsp. desulfuricans str.
           G20]
          Length = 337

 Score =  125 bits (313), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 78/202 (38%), Positives = 110/202 (54%), Gaps = 29/202 (14%)

Query: 176 GLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIM 235
           GL VTL +S   I+  +  G+L  L R S  P L++  IT+IEL RG PL+  +F     
Sbjct: 130 GLWVTLEVSLISIVFGITFGVLTGLARISENPALKWGAITYIELIRGSPLLVQIF----- 184

Query: 236 LPLFLPDTWDVDKLLRALLG-----------VSAFASAYIAEVLRGGLQSISKGQFEAAN 284
           L  F+  T   + L++A LG           +S F  AY+AE++R G+QS+ +GQ EAA 
Sbjct: 185 LWYFVAGTLVNNLLMQAGLGQVPPMWFGVLALSVFTGAYVAEIVRAGIQSVHRGQMEAAR 244

Query: 285 SLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSEST 344
           SLGL+Y Q MR +I+PQ  +R++P +   FI L KDSSL+ +I + +L    R   S   
Sbjct: 245 SLGLNYSQAMRKVILPQAFRRIMPPLAGQFISLVKDSSLLGVIAIRELTKATREVVS--- 301

Query: 345 WISSVTPTTGLIFIGFVFWIFC 366
             SS+ P        F  WI C
Sbjct: 302 --SSLQP--------FELWILC 313


>gi|268678765|ref|YP_003303196.1| polar amino acid ABC transporter inner membrane subunit
           [Sulfurospirillum deleyianum DSM 6946]
 gi|268616796|gb|ACZ11161.1| polar amino acid ABC transporter, inner membrane subunit
           [Sulfurospirillum deleyianum DSM 6946]
          Length = 321

 Score =  124 bits (312), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 75/207 (36%), Positives = 116/207 (56%), Gaps = 9/207 (4%)

Query: 176 GLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIM 235
           GLLVTL IS    I++  +G LLA  R S+   L+     +I + RG PL+  +F+    
Sbjct: 120 GLLVTLEISGLAAILAFSMGALLAFMRISHYQFLKDIATIYIAIIRGTPLLVQIFI---- 175

Query: 236 LPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMR 295
               +   +++++     + +  F  AYIAEVLRG +QSI KGQ+EAA SLG++Y Q M 
Sbjct: 176 FYFIIATIFEIERFFAGAISLGLFFGAYIAEVLRGAIQSIDKGQYEAAKSLGMNYPQTML 235

Query: 296 LIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGL 355
            IIMPQ +KR +P +V   I L KDSSL+S+I++ DL  + R         ++ +P    
Sbjct: 236 YIIMPQALKRALPTLVGEMIALVKDSSLVSVISITDLTKVGR-----EIVANTFSPFETW 290

Query: 356 IFIGFVFWIFCFSISLYSVFIEKTLHK 382
           + I  V+++  F ++ +   IE  + K
Sbjct: 291 LIIAAVYFMITFLLTAFGHKIETKMKK 317


>gi|258647026|ref|ZP_05734495.1| glutamine ABC transporter, permease protein [Dialister invisus DSM
           15470]
 gi|260404467|gb|EEW98014.1| glutamine ABC transporter, permease protein [Dialister invisus DSM
           15470]
          Length = 215

 Score =  124 bits (311), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 78/198 (39%), Positives = 114/198 (57%), Gaps = 9/198 (4%)

Query: 172 SLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFM 231
           +++ GL V+  I  F I++S+PLG+LLA+ R S + + R A   +I L RG PL+  +  
Sbjct: 10  NMFSGLGVSAQIFIFTIVLSLPLGMLLAMVRISKVGLFRQAAGAYIYLMRGTPLMLQIMF 69

Query: 232 ASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYL 291
               LPL       +     A+L   A  +AY AE+ RGG+QSISKGQ+E A  LG +Y 
Sbjct: 70  IYYGLPLIF--DLQISDFPAAILAFVANYAAYFAEIFRGGIQSISKGQYEGAKVLGFTYK 127

Query: 292 QKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTP 351
           Q M  II+PQV+KRVIP + N  I L KD+SL+ I+ M DL+ + R       ++     
Sbjct: 128 QTMWHIILPQVVKRVIPPLGNETITLLKDTSLVYILAMNDLMRVTR------AFVQRDFD 181

Query: 352 TTGLIFIGFVFWIFCFSI 369
           TT  +  G VF++ C ++
Sbjct: 182 TTPFLVAG-VFYLVCTAV 198


>gi|223933890|ref|ZP_03625854.1| polar amino acid ABC transporter, inner membrane subunit
           [Streptococcus suis 89/1591]
 gi|253751333|ref|YP_003024474.1| putative amino acid ABC transporter permease protein [Streptococcus
           suis SC84]
 gi|253753234|ref|YP_003026374.1| amino acid ABC transporter permease protein [Streptococcus suis
           P1/7]
 gi|253755057|ref|YP_003028197.1| amino acid ABC transporter permease protein [Streptococcus suis
           BM407]
 gi|330832340|ref|YP_004401165.1| polar amino acid ABC transporter inner membrane subunit
           [Streptococcus suis ST3]
 gi|223897448|gb|EEF63845.1| polar amino acid ABC transporter, inner membrane subunit
           [Streptococcus suis 89/1591]
 gi|251815622|emb|CAZ51208.1| putative amino acid ABC transporter permease protein [Streptococcus
           suis SC84]
 gi|251817521|emb|CAZ55265.1| putative amino acid ABC transporter permease protein [Streptococcus
           suis BM407]
 gi|251819479|emb|CAR45008.1| putative amino acid ABC transporter permease protein [Streptococcus
           suis P1/7]
 gi|292557906|gb|ADE30907.1| permease protein [Streptococcus suis GZ1]
 gi|319757618|gb|ADV69560.1| polar amino acid ABC transporter, inner membrane subunit
           [Streptococcus suis JS14]
 gi|329306563|gb|AEB80979.1| polar amino acid ABC transporter, inner membrane subunit
           [Streptococcus suis ST3]
          Length = 229

 Score =  124 bits (310), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 72/216 (33%), Positives = 120/216 (55%), Gaps = 11/216 (5%)

Query: 176 GLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIM 235
           G +VTL+I+FF +     LG+LLA  + S   VL +    ++ +FRG P++  + +A  M
Sbjct: 16  GAIVTLIIAFFSVFFGSILGVLLAFAQRSKYKVLAWTANIYVWIFRGTPMIVQIMIAFAM 75

Query: 236 LPLFLPD------TWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLS 289
                P       T D+ +L+  ++ +S  + AY++E +R G+ ++ KGQ EAA SLG+ 
Sbjct: 76  THFVAPTFQLGILTVDLTRLIPGIIVISMNSGAYVSETVRAGINAVPKGQLEAAYSLGIR 135

Query: 290 YLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSV 349
             Q MR +IMPQ IK ++P + N F+ + KDSSL+S I + +L      N +++   +S 
Sbjct: 136 PKQAMRYVIMPQAIKNILPALGNEFVTIVKDSSLLSTIGVMELW-----NGAQTVQSTSY 190

Query: 350 TPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSK 385
            P T L+F    + I    +++     EK L+KG +
Sbjct: 191 IPLTPLVFAASYYLIMTTVLTVIIQSFEKKLNKGGQ 226


>gi|25809422|emb|CAD57654.1| general L-amino acid transport system permease protein AapM
           [Rhizobium etli]
          Length = 109

 Score =  123 bits (309), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 74/104 (71%)

Query: 10  YVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAV 69
           +VR  +L P  PP  ++G +AWI +N   TPKDI+LT L +  +++++   + W+F++AV
Sbjct: 5   FVRSAILAPEPPPSAEKGPVAWIRRNLLATPKDIVLTILALVFVVWALLHALDWLFVEAV 64

Query: 70  WIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPM 113
           W G +RT C T  QGGIQPDGW+ ACWAF+  +++QFIFG YP+
Sbjct: 65  WSGPDRTFCATAVQGGIQPDGWSGACWAFVNAKFDQFIFGRYPL 108


>gi|315181927|gb|ADT88840.1| hypothetical amino acid ABC transporter, permease protein [Vibrio
           furnissii NCTC 11218]
          Length = 314

 Score =  123 bits (309), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 63/157 (40%), Positives = 99/157 (63%), Gaps = 4/157 (2%)

Query: 176 GLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIM 235
           GL VT+ ISF  +I ++ LG++  L R +     R   +T++EL RG PL+  +F+    
Sbjct: 115 GLWVTIEISFISLIFAVLLGLIFGLMRVAKNQTARNLALTYVELIRGTPLLVQIFI---- 170

Query: 236 LPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMR 295
           +  F+    D D+    ++ +S F  AY+AE++R G+Q+I  GQ EAA SLG++Y + MR
Sbjct: 171 VYFFIGTVLDFDRFTAGVVALSVFTGAYVAEIVRAGIQAIPNGQMEAARSLGMTYPKAMR 230

Query: 296 LIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDL 332
            +I+PQ +KR +P +   FI L KDSSL+S+I++ DL
Sbjct: 231 YVILPQALKRTLPPLAGQFINLIKDSSLVSVISITDL 267


>gi|255281311|ref|ZP_05345866.1| amino acid ABC transporter, amino acid-binding/permease protein
           [Bryantella formatexigens DSM 14469]
 gi|255268268|gb|EET61473.1| amino acid ABC transporter, amino acid-binding/permease protein
           [Bryantella formatexigens DSM 14469]
          Length = 230

 Score =  123 bits (309), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 75/228 (32%), Positives = 123/228 (53%), Gaps = 12/228 (5%)

Query: 166 LSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPL 225
           LS     LW G  +TL+IS   II+ +  G L+A  R S  PVLR     ++E  RG P+
Sbjct: 8   LSTYRVLLWNGTKITLLISVMTIILGLICGTLMAFMRISKSPVLRSIAAAYVEFIRGTPV 67

Query: 226 VTVLF-------MASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKG 278
           +  +F       M  I +P  +    D+ +LL   + +S  ++AYI E++R G+QSI  G
Sbjct: 68  LVQIFIVYYGLPMMGIEIPSIMFGGVDISRLLSGTVALSVNSTAYICEIVRSGIQSIDIG 127

Query: 279 QFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRV 338
           Q E A +LGL+  ++M  +I+PQ IK +IP + N F+ + K SS +S+I + +L+     
Sbjct: 128 QTEGAMALGLNGRRRMWYVILPQAIKNIIPALANEFVTVIKTSSQVSVIGIAELM----- 182

Query: 339 NFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
             +++    S  P   L+ +  +++I  FS+S     IEK + + S+ 
Sbjct: 183 YAADTIRGISFRPMEPLLIVAVIYFIITFSLSCVIRRIEKNMRRSSRS 230


>gi|260769396|ref|ZP_05878329.1| amino acid ABC transporter permease protein [Vibrio furnissii CIP
           102972]
 gi|260614734|gb|EEX39920.1| amino acid ABC transporter permease protein [Vibrio furnissii CIP
           102972]
          Length = 314

 Score =  123 bits (308), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 63/157 (40%), Positives = 99/157 (63%), Gaps = 4/157 (2%)

Query: 176 GLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIM 235
           GL VT+ ISF  +I ++ LG++  L R +     R   +T++EL RG PL+  +F+    
Sbjct: 115 GLWVTIEISFISLIFAVLLGLIFGLMRVAKNQTARNLALTYVELIRGTPLLVQIFI---- 170

Query: 236 LPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMR 295
           +  F+    D D+    ++ +S F  AY+AE++R G+Q+I  GQ EAA SLG++Y + MR
Sbjct: 171 VYFFIGTVLDFDRFTAGVVALSVFTGAYVAEIVRAGIQAIPNGQMEAARSLGMTYPKAMR 230

Query: 296 LIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDL 332
            +I+PQ +KR +P +   FI L KDSSL+S+I++ DL
Sbjct: 231 YVILPQALKRTLPPLAGQFINLIKDSSLVSVISITDL 267


>gi|187929543|ref|YP_001900030.1| polar amino acid ABC transporter inner membrane subunit [Ralstonia
           pickettii 12J]
 gi|241663662|ref|YP_002982022.1| polar amino acid ABC transporter inner membrane subunit [Ralstonia
           pickettii 12D]
 gi|309781682|ref|ZP_07676415.1| glutamine ABC transporter, permease protein [Ralstonia sp.
           5_7_47FAA]
 gi|187726433|gb|ACD27598.1| polar amino acid ABC transporter, inner membrane subunit [Ralstonia
           pickettii 12J]
 gi|240865689|gb|ACS63350.1| polar amino acid ABC transporter, inner membrane subunit [Ralstonia
           pickettii 12D]
 gi|308919323|gb|EFP64987.1| glutamine ABC transporter, permease protein [Ralstonia sp.
           5_7_47FAA]
          Length = 230

 Score =  122 bits (307), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 68/208 (32%), Positives = 122/208 (58%), Gaps = 10/208 (4%)

Query: 175 GGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASI 234
           GGL +T +++  G+++++P GI+L L R S I  LR+     + + RG PL+ V+F A  
Sbjct: 23  GGLALTFLLASAGLVLALPAGIILGLCRVSPIAALRWPATALVYVVRGTPLLMVIFWAYF 82

Query: 235 MLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKM 294
           +LP         D+    L  +  F  AY+AE++R G+Q + +GQ E+A SLGLSY+Q M
Sbjct: 83  LLPSV--TGQRTDQFSTMLTALVIFDGAYLAEIVRAGIQGLPRGQMESARSLGLSYMQAM 140

Query: 295 RLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTG 354
           R +I+PQ ++ ++P +VN  +   K++SL  II++ +      V+F      ++V   + 
Sbjct: 141 RRVILPQALRNMLPSLVNQLVSTIKETSLGYIISLPE------VSFVAGQISTAVMVKSA 194

Query: 355 LIF--IGFVFWIFCFSISLYSVFIEKTL 380
            ++  +G  ++I CFS++  + ++E+ L
Sbjct: 195 EVYGLLGISYFIMCFSLTRVAFYLERRL 222


>gi|89897620|ref|YP_521107.1| hypothetical protein DSY4874 [Desulfitobacterium hafniense Y51]
 gi|89337068|dbj|BAE86663.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 224

 Score =  122 bits (307), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 72/165 (43%), Positives = 100/165 (60%), Gaps = 7/165 (4%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
           L  G L+TL ++   + I + +G+ +AL R SN  +LR   I +I+ FRG PL+  L M 
Sbjct: 15  LLKGTLITLELTAGAVGIGIVIGLFMALMRLSNSRILRGLSIAYIDFFRGTPLLVQLLMV 74

Query: 233 SIMLPLFL----PDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGL 288
              LP  L    PD +   + + A+  +   + AYIAE+ R G+QSI KGQ EAA SLG+
Sbjct: 75  YFALPQLLNFQVPDNY---QFIAAITAMGLNSGAYIAEIFRAGIQSIDKGQGEAARSLGM 131

Query: 289 SYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLL 333
           +  Q MR +I+PQ  KRVIP + N FI L KDSSL+S I + DL+
Sbjct: 132 TQGQAMRHVILPQAFKRVIPPLGNEFIALLKDSSLVSFIALQDLM 176


>gi|219670551|ref|YP_002460986.1| polar amino acid ABC transporter inner membrane subunit
           [Desulfitobacterium hafniense DCB-2]
 gi|219540811|gb|ACL22550.1| polar amino acid ABC transporter, inner membrane subunit
           [Desulfitobacterium hafniense DCB-2]
          Length = 219

 Score =  122 bits (307), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 74/168 (44%), Positives = 104/168 (61%), Gaps = 4/168 (2%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
           +  G  VTL + F  I++S+PLG++L+LGR S   VLR A   +I +FRG PL+  L   
Sbjct: 11  MLNGTAVTLKMFFVTIVMSVPLGLMLSLGRISRFGVLRSAIGVYIWVFRGTPLMLQLLFV 70

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFA---SAYIAEVLRGGLQSISKGQFEAANSLGLS 289
              LP F+P   ++  L      + AF    +AY AE+ R G+QSI +GQ+E A +LG++
Sbjct: 71  YFGLP-FIPVIGEILILTDFQAAILAFVLNYAAYFAEIFRAGIQSIERGQYEGARALGMT 129

Query: 290 YLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVR 337
           Y Q MR II+PQV+KRV+P + N  I L KD+SLI ++ M DLL   R
Sbjct: 130 YGQLMRRIILPQVVKRVLPPVSNETITLVKDTSLIYVLAMNDLLRTTR 177


>gi|242279192|ref|YP_002991321.1| polar amino acid ABC transporter inner membrane subunit
           [Desulfovibrio salexigens DSM 2638]
 gi|242122086|gb|ACS79782.1| polar amino acid ABC transporter, inner membrane subunit
           [Desulfovibrio salexigens DSM 2638]
          Length = 337

 Score =  122 bits (306), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 70/211 (33%), Positives = 120/211 (56%), Gaps = 11/211 (5%)

Query: 176 GLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIM 235
           GL VTL +S   I+ ++ LG+   L R S  P L+ + IT+IEL RG PL+  +F+   +
Sbjct: 129 GLFVTLKVSAIAIVFAIILGLFTGLARISQNPALKLSAITYIELIRGTPLLVQMFIWYFV 188

Query: 236 LPLFLPD---TWDVDKLLRALLGVSA---FASAYIAEVLRGGLQSISKGQFEAANSLGLS 289
           L   + +    +D+ ++     G+++   FA AY+AE++R G+QS+ +GQ EAA SLG+S
Sbjct: 189 LGTLVNNMLAKYDISQIPPLWFGIASLAIFAGAYVAEIVRAGIQSVHRGQMEAARSLGMS 248

Query: 290 YLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSV 349
               M+ II+PQ  +R++P +   FI + KDSSL+ +I + +L    R   S     +S+
Sbjct: 249 KYYAMKHIILPQAFRRILPPLAGQFISMIKDSSLLGVIAIRELTKGTREAVS-----TSL 303

Query: 350 TPTTGLIFIGFVFWIFCFSISLYSVFIEKTL 380
            P         ++ +  F+ S++  ++EK +
Sbjct: 304 QPFELWFLCALLYLVLTFAFSMFVQYLEKKM 334


>gi|138897015|ref|YP_001127468.1| amino acid ABC transporter permease [Geobacillus
           thermodenitrificans NG80-2]
 gi|196249837|ref|ZP_03148533.1| polar amino acid ABC transporter, inner membrane subunit
           [Geobacillus sp. G11MC16]
 gi|134268528|gb|ABO68723.1| Amino acid ABC transporter (permease) [Geobacillus
           thermodenitrificans NG80-2]
 gi|196210713|gb|EDY05476.1| polar amino acid ABC transporter, inner membrane subunit
           [Geobacillus sp. G11MC16]
          Length = 218

 Score =  122 bits (305), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 80/217 (36%), Positives = 122/217 (56%), Gaps = 15/217 (6%)

Query: 168 IVETS--LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPL 225
           IVE +   W GLLVT+ +S  GI+  + LG+ + LG+ S  P++R     +I  FRG PL
Sbjct: 8   IVEYAPYFWKGLLVTIGVSLAGIVFGLILGLFIGLGKMSRHPLIRLPFTWYINFFRGTPL 67

Query: 226 VTVLFMASI-MLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAAN 284
           V  + +     +PL L +    + L+  ++ +S  ++AY+AE+ R G+QSI KGQ EAA 
Sbjct: 68  VVQILLVHFGAMPLLLAEP---NALVSLVVSLSLNSAAYVAEIFRAGIQSIDKGQMEAAR 124

Query: 285 SLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLL--GIVRVNFSE 342
           SLG+++ Q MR II+PQ +KR+IP   N FI L KDSSL  II   +++  G        
Sbjct: 125 SLGMTHAQAMRYIILPQALKRMIPPFANEFIVLIKDSSLGMIIAAPEIMYWGKAAAGEYY 184

Query: 343 STWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKT 379
             W   +T       + F++ I   S+S  S ++E+ 
Sbjct: 185 RVWEPYLT-------VAFIYLILTLSLSKLSHYLERK 214


>gi|303246865|ref|ZP_07333142.1| polar amino acid ABC transporter, inner membrane subunit
           [Desulfovibrio fructosovorans JJ]
 gi|302491882|gb|EFL51762.1| polar amino acid ABC transporter, inner membrane subunit
           [Desulfovibrio fructosovorans JJ]
          Length = 231

 Score =  122 bits (305), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 75/213 (35%), Positives = 123/213 (57%), Gaps = 8/213 (3%)

Query: 175 GGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASI 234
           GGL +T++++  GI  +  LG+   L R S  P+LR+  + +IE+ RG+PL+ V+F    
Sbjct: 24  GGLAMTVLLAVGGIFGAFWLGLGCGLLRISKKPLLRWPALIYIEIIRGIPLLMVVFWFYF 83

Query: 235 MLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKM 294
           + P+    T  + +   AL+ +  F SAYIAE++R G+Q++ KGQ EAA   GLS+ Q M
Sbjct: 84  LAPVLFGHT--LPEAQSALIALIVFTSAYIAEIVRAGVQALPKGQMEAARGTGLSHFQAM 141

Query: 295 RLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLL-GIVRVNFSESTWISSVTPTT 353
             +I+PQ +  +IP  VN F+ L KD+SL  II + +L     +VN    T      PT 
Sbjct: 142 THVILPQALFNMIPSFVNQFVSLTKDTSLAFIIGVNELTKAATQVNNRTLT-----APTE 196

Query: 354 GLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
             I I  ++++ CF ++  S ++EK +++   +
Sbjct: 197 IFITIALLYFVICFCLTELSRWLEKHINRYQAR 229


>gi|261420187|ref|YP_003253869.1| polar amino acid ABC transporter inner membrane subunit
           [Geobacillus sp. Y412MC61]
 gi|297529844|ref|YP_003671119.1| polar amino acid ABC transporter inner membrane protein
           [Geobacillus sp. C56-T3]
 gi|319766999|ref|YP_004132500.1| polar amino acid ABC transporter inner membrane protein
           [Geobacillus sp. Y412MC52]
 gi|261376644|gb|ACX79387.1| polar amino acid ABC transporter, inner membrane subunit
           [Geobacillus sp. Y412MC61]
 gi|297253096|gb|ADI26542.1| polar amino acid ABC transporter, inner membrane subunit
           [Geobacillus sp. C56-T3]
 gi|317111865|gb|ADU94357.1| polar amino acid ABC transporter, inner membrane subunit
           [Geobacillus sp. Y412MC52]
          Length = 216

 Score =  122 bits (305), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 75/205 (36%), Positives = 119/205 (58%), Gaps = 7/205 (3%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
           L  G LVTL ++F  I++S   GI++ + R + IPVL       +E  R +PL+ ++F  
Sbjct: 15  LLQGFLVTLEVAFISIVLSFVFGIIIGVIRYTKIPVLSQLLAVLVETIRNLPLLLIIFFT 74

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
              LP        +DKL  A+  +  F SA ++E++R GLQSI KGQ EAA S GL+Y+Q
Sbjct: 75  YFALP---EVGLKLDKLYAAISALVIFESAMLSEIVRSGLQSIDKGQIEAARSSGLTYVQ 131

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPT 352
            +  II+PQ ++R++P IV+ FI L KD+SL  +I++ +L+            ++ V P 
Sbjct: 132 TLWYIILPQALRRMVPPIVSQFISLLKDTSLAIVISLPELMN--HAQIINGRNVNFVIPI 189

Query: 353 TGLIFIGFVFWIFCFSISLYSVFIE 377
              I + F+++I  +S+SL S  +E
Sbjct: 190 --FILVAFMYFIVNYSLSLLSRRLE 212


>gi|56421989|ref|YP_149307.1| amino acid ABC transporter permease [Geobacillus kaustophilus
           HTA426]
 gi|56381831|dbj|BAD77739.1| amino acid ABC transporter (permease) [Geobacillus kaustophilus
           HTA426]
          Length = 218

 Score =  122 bits (305), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 72/163 (44%), Positives = 100/163 (61%), Gaps = 6/163 (3%)

Query: 168 IVETS--LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPL 225
           IVE +   W GLLVT+ +S  GI+  + LG+ + LG+ S+ P++R     +I  FRG PL
Sbjct: 8   IVEYAPYFWQGLLVTIGVSLAGIVFGLILGLFIGLGKMSSNPIIRLPFSWYINFFRGTPL 67

Query: 226 VTVLFMASI-MLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAAN 284
           V  + +     +PLF      V  L  +L   S  ++AY+AE+ R G+QSI KGQ EAA 
Sbjct: 68  VVQILLVHFGAMPLFFAQPNAVASLAVSL---SLNSAAYVAEIFRAGIQSIDKGQMEAAR 124

Query: 285 SLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISII 327
           SLG+++ Q MR II+PQ +KR+IP   N FI L KDSSL  +I
Sbjct: 125 SLGMTHAQAMRYIILPQALKRMIPPFANEFIVLIKDSSLGMVI 167


>gi|323498512|ref|ZP_08103505.1| polar amino acid ABC transporter inner membrane subunit [Vibrio
           sinaloensis DSM 21326]
 gi|323316401|gb|EGA69419.1| polar amino acid ABC transporter inner membrane subunit [Vibrio
           sinaloensis DSM 21326]
          Length = 315

 Score =  121 bits (304), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 61/157 (38%), Positives = 104/157 (66%), Gaps = 4/157 (2%)

Query: 176 GLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIM 235
           G++ T+ IS + ++I++ LG+++ L R S+ P L+   I +IE+ RG PL+  +F+    
Sbjct: 116 GVITTVKISLWSLVIALALGLVIGLMRISSNPALKKLSIVYIEIIRGTPLLVQIFI---- 171

Query: 236 LPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMR 295
           +  F+    D+++    ++ +S F +AY+AE++R G+QSI KGQ EAA SLG++Y + M 
Sbjct: 172 VYFFIGTVLDLERFTAGVIALSVFTAAYVAEIVRSGIQSIPKGQMEAARSLGMNYPKAMI 231

Query: 296 LIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDL 332
            +I+PQ  K+ +P +   FI L KDSSL+S+I++ DL
Sbjct: 232 YVILPQAFKQTLPPLAGQFINLIKDSSLVSVISITDL 268


>gi|56420514|ref|YP_147832.1| glutamine ABC transporter permease [Geobacillus kaustophilus
           HTA426]
 gi|56380356|dbj|BAD76264.1| glutamine ABC transporter (permease) [Geobacillus kaustophilus
           HTA426]
          Length = 216

 Score =  121 bits (304), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 74/205 (36%), Positives = 119/205 (58%), Gaps = 7/205 (3%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
           L  G LVTL ++F  I++S   GI++ + R + IPVL       +E  R +PL+ ++F  
Sbjct: 15  LLQGFLVTLEVAFISIVLSFVFGIIIGVIRYTKIPVLSQLLAVLVETIRNLPLLLIIFFT 74

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
              LP        +DK+  A+  +  F SA ++E++R GLQSI KGQ EAA S GL+Y+Q
Sbjct: 75  YFALP---EVGLKLDKMYAAISALVIFESAMLSEIVRSGLQSIDKGQIEAARSSGLTYMQ 131

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPT 352
            +  II+PQ ++R++P IV+ FI L KD+SL  +I++ +L+            ++ V P 
Sbjct: 132 TLWYIILPQALRRMVPPIVSQFISLLKDTSLAIVISLPELMN--HAQIINGRNVNFVIPI 189

Query: 353 TGLIFIGFVFWIFCFSISLYSVFIE 377
              I + F+++I  +S+SL S  +E
Sbjct: 190 --FILVAFMYFIVNYSLSLLSRRLE 212


>gi|239909115|ref|YP_002955857.1| amino acid ABC transporter permease protein [Desulfovibrio
           magneticus RS-1]
 gi|239798982|dbj|BAH77971.1| amino acid ABC transporter permease protein [Desulfovibrio
           magneticus RS-1]
          Length = 231

 Score =  121 bits (304), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 74/209 (35%), Positives = 122/209 (58%), Gaps = 8/209 (3%)

Query: 175 GGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASI 234
           GGL +T++++  GI  +  LG+ + L R S  P LR+  + FIE+ RG PL+ V+F    
Sbjct: 24  GGLAMTVILAVGGIFGAFWLGLGVGLMRISKKPSLRWPAMGFIEIIRGTPLLMVVFWFYF 83

Query: 235 MLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKM 294
           + P+    T  + +   AL+ +  F SAYIAE++R G++++ KGQ EAA   GLS+ Q M
Sbjct: 84  LAPVVFGHT--LPEAESALIALIVFTSAYIAEIVRAGVEALPKGQMEAARGTGLSHFQAM 141

Query: 295 RLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLL-GIVRVNFSESTWISSVTPTT 353
             II+PQ +  +IP  VN F+ L KD+SL  II + +L     +VN    T      PT 
Sbjct: 142 THIILPQALFNMIPSFVNQFVSLTKDTSLAFIIGVNELTKAATQVNNRTLT-----APTE 196

Query: 354 GLIFIGFVFWIFCFSISLYSVFIEKTLHK 382
             I I  ++++ C+ ++ +S ++E+ +++
Sbjct: 197 IFITIAVLYFVICYCLTEFSRYLERRINR 225


>gi|89896132|ref|YP_519619.1| hypothetical protein DSY3386 [Desulfitobacterium hafniense Y51]
 gi|89335580|dbj|BAE85175.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 224

 Score =  121 bits (304), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 74/168 (44%), Positives = 104/168 (61%), Gaps = 4/168 (2%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
           +  G  VTL + F  I++S+PLG++L+LGR S   VLR A   +I +FRG PL+  L   
Sbjct: 16  MLNGTGVTLKMFFVTIVMSVPLGLMLSLGRISRFGVLRSAIGVYIWVFRGTPLMLQLLFV 75

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFA---SAYIAEVLRGGLQSISKGQFEAANSLGLS 289
              LP F+P   ++  L      + AF    +AY AE+ R G+QSI +GQ+E A +LG++
Sbjct: 76  YFGLP-FIPVIGEILILTDFQAAILAFVLNYAAYFAEIFRAGIQSIERGQYEGARALGMT 134

Query: 290 YLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVR 337
           Y Q MR II+PQV+KRV+P + N  I L KD+SLI ++ M DLL   R
Sbjct: 135 YGQLMRRIILPQVVKRVLPPVSNETITLVKDTSLIYVLAMNDLLRTTR 182


>gi|323702153|ref|ZP_08113820.1| polar amino acid ABC transporter, inner membrane subunit
           [Desulfotomaculum nigrificans DSM 574]
 gi|323532840|gb|EGB22712.1| polar amino acid ABC transporter, inner membrane subunit
           [Desulfotomaculum nigrificans DSM 574]
          Length = 221

 Score =  120 bits (302), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 67/154 (43%), Positives = 95/154 (61%), Gaps = 6/154 (3%)

Query: 179 VTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPL 238
           +T +  FFG II    G+ +AL R S I +L+   + + E FRG PL+  LFM    LP 
Sbjct: 24  LTALAVFFGCII----GLFIALARISGIGILKSLAVAYTEFFRGTPLLVQLFMVFFGLPQ 79

Query: 239 FLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLII 298
            +     V+    A++  S  + AY+AE+ R G+QSI +GQ EAA SLG++Y Q MR II
Sbjct: 80  LIGH--PVNAFSVAVVACSLNSGAYVAEIFRAGIQSIERGQMEAARSLGMTYAQAMRYII 137

Query: 299 MPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDL 332
           +PQ  KRVIP + N FI + KD+SL+S+I + +L
Sbjct: 138 LPQAFKRVIPPLGNEFIAMMKDTSLVSVIGLAEL 171


>gi|323490820|ref|ZP_08096021.1| polar amino acid ABC transporter, inner membrane subunit
           [Planococcus donghaensis MPA1U2]
 gi|323395532|gb|EGA88377.1| polar amino acid ABC transporter, inner membrane subunit
           [Planococcus donghaensis MPA1U2]
          Length = 219

 Score =  120 bits (302), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 70/209 (33%), Positives = 114/209 (54%), Gaps = 7/209 (3%)

Query: 176 GLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIM 235
           G+  TL   FF II+   LG LLAL +  +I  LR+    +  +FRG PL+  L +    
Sbjct: 18  GIWATLKFVFFAIILGSILGTLLALFKIGSIKPLRWFADAYTSIFRGTPLILQLMIIYFS 77

Query: 236 LPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMR 295
            P      +D+   L A+L     +SAYI+E++R G+Q++ KGQ EAA +LG+ Y   M+
Sbjct: 78  TPQL--TGYDISAFLSAILAFGLNSSAYISEIIRAGIQAVDKGQMEAAQALGVPYRAMMK 135

Query: 296 LIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGL 355
            II+PQ +K ++P ++N FI L K+S+++S I   DL+   R     +    +  P   L
Sbjct: 136 DIILPQALKNILPALMNEFITLTKESAIVSTIGYLDLMR--RAQVVGADLFRNFEP---L 190

Query: 356 IFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
           +F+GF++W     +++     E+ L +  
Sbjct: 191 LFVGFIYWCLVMGLTMIGRVFERRLKQSD 219


>gi|34556717|ref|NP_906532.1| ABC transporter permease [Wolinella succinogenes DSM 1740]
 gi|34482431|emb|CAE09432.1| PERMEASE OF ABC TRANSPORTER [Wolinella succinogenes]
          Length = 321

 Score =  120 bits (302), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 78/228 (34%), Positives = 124/228 (54%), Gaps = 13/228 (5%)

Query: 159 VLYGGLGLSIVETSLWG----GLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACI 214
           ++Y G  L+  E    G    GL +T+ IS    +I+  +G +LAL + S   V R    
Sbjct: 98  IIYPGEALAKKEEYKAGPLLLGLWMTIKISLISGVIAFFIGAILALMKISKAQVFRDIAT 157

Query: 215 TFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQS 274
            +IE+ RG PL+  +F+        +   +++D      + ++ F  AYIAEVLRG +QS
Sbjct: 158 VYIEVIRGTPLLVQIFI----FYFIIATIFEIDSFYAGAISLAIFYGAYIAEVLRGAIQS 213

Query: 275 ISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLG 334
           I KGQ EAA SLG++Y Q M LII+PQ +KR +P +    I L KDSSL+S+I++ DL  
Sbjct: 214 IDKGQQEAALSLGMNYFQTMTLIIIPQALKRSLPSLTGEMIALIKDSSLVSVISVTDLTK 273

Query: 335 IVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHK 382
           + R   +     ++ +P    I +  +++    S+SL +  +E  + K
Sbjct: 274 VGREMVA-----NTFSPFETWIVVAIMYFAITSSLSLLAHRLEDNMKK 316


>gi|256829598|ref|YP_003158326.1| polar amino acid ABC transporter, inner membrane subunit
           [Desulfomicrobium baculatum DSM 4028]
 gi|256578774|gb|ACU89910.1| polar amino acid ABC transporter, inner membrane subunit
           [Desulfomicrobium baculatum DSM 4028]
          Length = 334

 Score =  120 bits (302), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 72/215 (33%), Positives = 120/215 (55%), Gaps = 23/215 (10%)

Query: 176 GLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFM---- 231
           GLL+TL +S   I+  + LG+   L R S+ P LR+  I +IEL RG PL+  +F+    
Sbjct: 128 GLLLTLEVSALAIVFGILLGLFTGLARISDNPALRWGAIAYIELIRGSPLLVQIFLWYFV 187

Query: 232 ----ASIMLPLF----LPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAA 283
                + ML  +    +P  W        ++ ++ F  AY AE++R G+QS+ +GQ EAA
Sbjct: 188 VGTVINSMLSQYGIGQIPPLW------FGVMALAIFTGAYTAEIVRAGIQSVHRGQMEAA 241

Query: 284 NSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSES 343
            SLG++Y + MR +I+PQ  +R++P +   FI L KDSSL+ +I++ +L    R   S  
Sbjct: 242 RSLGMTYNKAMRKVILPQAFRRILPPLAGQFISLVKDSSLLGVISIRELTKASREVVS-- 299

Query: 344 TWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEK 378
              SS+ P    I    ++ +  F++S++  ++E+
Sbjct: 300 ---SSLQPFEIWIVCAILYLVLTFTLSMFVQYLER 331


>gi|315640218|ref|ZP_07895336.1| His/Glu/Gln/Arg/opine ABC superfamily ATP binding cassette
           transporter permease [Enterococcus italicus DSM 15952]
 gi|315484007|gb|EFU74485.1| His/Glu/Gln/Arg/opine ABC superfamily ATP binding cassette
           transporter permease [Enterococcus italicus DSM 15952]
          Length = 236

 Score =  120 bits (301), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 73/219 (33%), Positives = 124/219 (56%), Gaps = 14/219 (6%)

Query: 172 SLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFM 231
           + W G +VT+ ++   +II   +G+L  + + S+   LR+    + ++ RG PL+  LFM
Sbjct: 20  TFWQGTIVTVALAIMTVIIGSLIGLLATIMKQSSFAPLRWLAKAYTQVVRGTPLLLQLFM 79

Query: 232 ---------ASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEA 282
                     SI     L D +   + L A++ +S  + AYI E+LRGGL+SI KGQ EA
Sbjct: 80  WLYGFPIIGISIPPIPLLGDVFGSREFLTAVVALSINSGAYICELLRGGLESIDKGQMEA 139

Query: 283 ANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSE 342
             SLGLS  Q M+ II+PQ ++ V+PG+ N FI + K+SS++S++ +FD++     N  +
Sbjct: 140 GRSLGLSRWQTMKAIIIPQAVRVVLPGLGNEFIMMIKESSIVSVVGVFDVM--YTYNIVK 197

Query: 343 STWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
           ++  S   P   LI +G ++++    ++     +EK +H
Sbjct: 198 ASTYSIFEP---LIVVGIIYFLLTAGLTSLMSMLEKRMH 233


>gi|310639892|ref|YP_003944650.1| glutamine abc transporter permease protein [Paenibacillus polymyxa
           SC2]
 gi|309244842|gb|ADO54409.1| Glutamine ABC transporter permease protein [Paenibacillus polymyxa
           SC2]
          Length = 216

 Score =  120 bits (301), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 79/209 (37%), Positives = 123/209 (58%), Gaps = 13/209 (6%)

Query: 176 GLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIM 235
           G L+TL ++ + II S  LGI+  + R + IPVL       I+L R +PL+ ++F   ++
Sbjct: 18  GFLLTLEVAIYSIIFSFALGIVFGILRYTRIPVLSQVAAFIIDLIRNLPLLLIIFFIGMV 77

Query: 236 LP---LFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
           LP   L +   W       A+ G+S F  A IAE++R GL S+ KGQ EAA S GLSY Q
Sbjct: 78  LPSIGLSISLKWA------AITGLSIFEGAMIAEIVRSGLNSVHKGQLEAARSSGLSYSQ 131

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPT 352
            +  II+PQ ++R++P IV+ FI LFKD+SL  II++ +L   +++   ++   S V P 
Sbjct: 132 TLWHIILPQALRRMVPPIVSQFISLFKDTSLAVIISLPELTHNIQIVGGQNQ--SFVIP- 188

Query: 353 TGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
             L+F  F+++   +S+SL +  +E   H
Sbjct: 189 -ALLFAAFLYFAVNYSMSLIARRLEVRTH 216


>gi|330830267|ref|YP_004393219.1| amino acid ABC transporter permease [Aeromonas veronii B565]
 gi|328805403|gb|AEB50602.1| Amino acid ABC transporter, permease protein [Aeromonas veronii
           B565]
          Length = 319

 Score =  120 bits (301), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 64/157 (40%), Positives = 96/157 (61%), Gaps = 4/157 (2%)

Query: 176 GLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIM 235
           G+ VT+ +S    I ++ LG L  L R S  P LR   IT++EL RG PL+  +F+    
Sbjct: 120 GVWVTVKLSLVAGIFAILLGTLAGLARLSPNPALRNLAITYVELIRGTPLLVQIFI---- 175

Query: 236 LPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMR 295
           +  F+    ++D+    +  ++ F  AY+AE++R G+ SI KGQ EA  SLG++  Q MR
Sbjct: 176 VYFFIGTVLNLDRFTAGVAALAVFTGAYVAEIVRAGISSIHKGQMEAGRSLGMTSAQTMR 235

Query: 296 LIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDL 332
            +I+PQ  KRV+P +   FI L KDSSL+S+I++ DL
Sbjct: 236 YVILPQAFKRVLPPLAGQFINLIKDSSLVSVISITDL 272


>gi|259047505|ref|ZP_05737906.1| His/Glu/Gln/Arg/opine family amino acid ABC superfamily ATP binding
           cassette transporter, permease protein [Granulicatella
           adiacens ATCC 49175]
 gi|259035696|gb|EEW36951.1| His/Glu/Gln/Arg/opine family amino acid ABC superfamily ATP binding
           cassette transporter, permease protein [Granulicatella
           adiacens ATCC 49175]
          Length = 213

 Score =  120 bits (301), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 68/206 (33%), Positives = 119/206 (57%), Gaps = 9/206 (4%)

Query: 176 GLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIM 235
           G   T+++SFF +++ +  G L+AL R S+  VL  A   +I++ RG PL+  L++    
Sbjct: 14  GATTTILLSFFSVVVGVGCGTLMALARLSSHKVLSNAAKVYIDIIRGTPLLVQLYLVYFG 73

Query: 236 LPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMR 295
           L   L    D++  L  ++ VS   +AYIAE++R G+QS+ KGQ EAA S+G+     MR
Sbjct: 74  LATIL----DLNDFLSGVIAVSVNTTAYIAEIIRSGIQSVDKGQMEAARSMGMPKGMAMR 129

Query: 296 LIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGL 355
            II+PQ +K ++P I N F  L K++S++S+I + DL+       S++   ++ T    L
Sbjct: 130 QIILPQAMKNILPAIGNEFATLIKETSIVSLIGIHDLM-----YSSDTVRGATFTVFIPL 184

Query: 356 IFIGFVFWIFCFSISLYSVFIEKTLH 381
           +   F++++   +I+ +   +E+ L 
Sbjct: 185 LMTAFLYFVMTTTIAFFMDKLERKLQ 210


>gi|116492898|ref|YP_804633.1| ABC-type amino acid transport system, permease and periplasmic
           component [Pediococcus pentosaceus ATCC 25745]
 gi|116103048|gb|ABJ68191.1| amino acid ABC transporter membrane protein, PAAT family / amino
           acid ABC transporter substrate-binding protein, PAAT
           family [Pediococcus pentosaceus ATCC 25745]
          Length = 488

 Score =  120 bits (300), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 76/208 (36%), Positives = 116/208 (55%), Gaps = 9/208 (4%)

Query: 176 GLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIM 235
           G+  T++IS  G+I     G LLAL R S+  VLR     ++E  RG PL+  L      
Sbjct: 290 GVGYTILISILGVIFGFITGTLLALLRLSDNKVLRGLSAAYVEFVRGTPLMVQLMFVYFG 349

Query: 236 LPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMR 295
           L LF+    ++  L   ++ VS  + AY+AEV+RGG+ S+  GQ EAA SLGL+   +MR
Sbjct: 350 LGLFV----NLPALTAGIIAVSLNSGAYVAEVIRGGINSVDDGQREAAESLGLNKRDRMR 405

Query: 296 LIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGL 355
            +IMPQ +K + P + N FI L K+SS++SII + DL  I ++   +S     V P   +
Sbjct: 406 FVIMPQALKNIWPALGNEFISLIKESSIVSIIGVTDL--IYQLKIVQSDTYRGVAP---I 460

Query: 356 IFIGFVFWIFCFSISLYSVFIEKTLHKG 383
           +    ++++  FS+S    F E+  + G
Sbjct: 461 VVAMILYFVMTFSLSRLLKFYERKFNNG 488


>gi|117620284|ref|YP_857306.1| amino acid ABC transporter, permease protein [Aeromonas hydrophila
           subsp. hydrophila ATCC 7966]
 gi|117561691|gb|ABK38639.1| amino acid ABC transporter, permease protein [Aeromonas hydrophila
           subsp. hydrophila ATCC 7966]
          Length = 326

 Score =  120 bits (300), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 63/157 (40%), Positives = 96/157 (61%), Gaps = 4/157 (2%)

Query: 176 GLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIM 235
           G+ VT+ +S    I ++ LG L  L R S  P LR   +T++EL RG PL+  +F+    
Sbjct: 127 GVWVTVKLSLVAGIFAILLGTLAGLARLSPNPALRNLAVTYVELIRGTPLLVQIFI---- 182

Query: 236 LPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMR 295
           +  F+    ++D+    +  ++ F  AY+AE++R G+ SI KGQ EA  SLG++  Q MR
Sbjct: 183 VYFFIGTVLNLDRFTAGVAALAVFTGAYVAEIVRAGISSIHKGQMEAGRSLGMTSAQTMR 242

Query: 296 LIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDL 332
            +I+PQ  KRV+P +   FI L KDSSL+S+I++ DL
Sbjct: 243 YVILPQAFKRVLPPLAGQFINLIKDSSLVSVISITDL 279


>gi|145298524|ref|YP_001141365.1| ABC-type amino acid transporter, permease protein [Aeromonas
           salmonicida subsp. salmonicida A449]
 gi|142851296|gb|ABO89617.1| ABC-type amino acid transporter, permease protein [Aeromonas
           salmonicida subsp. salmonicida A449]
          Length = 319

 Score =  120 bits (300), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 63/157 (40%), Positives = 96/157 (61%), Gaps = 4/157 (2%)

Query: 176 GLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIM 235
           G+ VT+ +S    + ++ LG L  L R S  P LR   +T++EL RG PL+  +F+    
Sbjct: 120 GVWVTVKLSLVAGVFAILLGTLAGLARLSPNPALRNLAVTYVELIRGTPLLVQIFI---- 175

Query: 236 LPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMR 295
           +  F+    ++D+    +  ++ F  AY+AE++R G+ SI KGQ EA  SLGL+  Q MR
Sbjct: 176 VYFFIGTVLNLDRFTAGVAALAVFTGAYVAEIVRAGISSIHKGQMEAGRSLGLTSAQTMR 235

Query: 296 LIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDL 332
            +I+PQ  KRV+P +   FI L KDSSL+S+I++ DL
Sbjct: 236 YVILPQAFKRVLPPLAGQFINLIKDSSLVSVISITDL 272


>gi|326790343|ref|YP_004308164.1| polar amino acid ABC transporter inner membrane protein
           [Clostridium lentocellum DSM 5427]
 gi|326541107|gb|ADZ82966.1| polar amino acid ABC transporter, inner membrane subunit
           [Clostridium lentocellum DSM 5427]
          Length = 240

 Score =  120 bits (300), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 67/212 (31%), Positives = 121/212 (57%), Gaps = 10/212 (4%)

Query: 176 GLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIM 235
           G  +TL +S  G+++++ LG+L  +  ++    L+     +IE+F+  PLV  +F     
Sbjct: 23  GFSMTLRVSIVGLLVAIMLGVLFGVLYSTKRKPLKLIARVYIEIFQNTPLVIQIFFYYSC 82

Query: 236 LPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMR 295
           LP  +     VDK L  ++GV  +  AY+AEV+R G++++ KGQ EAANS G SY+Q MR
Sbjct: 83  LPYLIGGR--VDKFLLGVMGVGIYHGAYVAEVIRTGIEAVPKGQLEAANSQGFSYIQAMR 140

Query: 296 LIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTP--TT 353
            II+PQ IK ++P + N  + L K++S+++++   DL+      +   +W SS     T 
Sbjct: 141 YIILPQTIKIIMPPLANQALNLVKNTSVLAMVAGLDLM------YFADSWASSSGGHYTQ 194

Query: 354 GLIFIGFVFWIFCFSISLYSVFIEKTLHKGSK 385
           G +    ++++ CF ++  + ++E+   +  K
Sbjct: 195 GYLVCAAMYFVICFPLASLARYLERKAKEPPK 226


>gi|219670747|ref|YP_002461182.1| polar amino acid ABC transporter inner membrane subunit
           [Desulfitobacterium hafniense DCB-2]
 gi|219541007|gb|ACL22746.1| polar amino acid ABC transporter, inner membrane subunit
           [Desulfitobacterium hafniense DCB-2]
          Length = 224

 Score =  120 bits (300), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 71/168 (42%), Positives = 100/168 (59%), Gaps = 13/168 (7%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
           L  G L+TL ++   + + + +G+ +AL R SN  +LR   I +I+ FRG PL+  + M 
Sbjct: 15  LLKGTLITLELTAGAVAMGIVIGLFMALMRLSNSRILRGFAIAYIDFFRGTPLLVQILMV 74

Query: 233 SIMLPLFL----PDTWDVDKLLRALLGVSAF---ASAYIAEVLRGGLQSISKGQFEAANS 285
              +P  L    PD +        + G+SA    + AYIAE+ R G+QSI KGQ EAA S
Sbjct: 75  YFAVPQLLNFQIPDNYQF------IAGISAMGLNSGAYIAEIFRAGIQSIDKGQGEAARS 128

Query: 286 LGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLL 333
           LG++  Q MR +I+PQ  KRVIP + N FI L KDSSL+S I + DL+
Sbjct: 129 LGMTQGQAMRHVILPQAFKRVIPPLGNEFIALLKDSSLVSFIALQDLM 176


>gi|295398454|ref|ZP_06808493.1| amino acid ABC superfamily ATP binding cassette transporter
           [Aerococcus viridans ATCC 11563]
 gi|294973318|gb|EFG49106.1| amino acid ABC superfamily ATP binding cassette transporter
           [Aerococcus viridans ATCC 11563]
          Length = 514

 Score =  120 bits (300), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 98/160 (61%), Gaps = 6/160 (3%)

Query: 174 WGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPL-VTVLFMA 232
           W G+  TL+I+   I   M LGI LAL R +N PVL++    +IE  RG PL + VLFM 
Sbjct: 312 WDGIKTTLIIAGVSIFFGMILGIFLALMRLTNNPVLKFLATAYIEFVRGTPLMIQVLFMF 371

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
             +  +F    W    +   L+ VS  + AYIAE++RGG+QS+ KGQ EAA SLGL Y Q
Sbjct: 372 LGVGSIF---GWST--MTAGLVSVSMNSGAYIAEIIRGGIQSVDKGQAEAARSLGLGYWQ 426

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDL 332
            MR +I PQ ++ + P + N FI L K+SS++S I + +L
Sbjct: 427 TMRKVIFPQSLRSIWPSLGNEFITLIKESSIVSTIGVAEL 466


>gi|91224517|ref|ZP_01259779.1| hypothetical amino acid ABC transporter, permease protein [Vibrio
           alginolyticus 12G01]
 gi|269968272|ref|ZP_06182298.1| conserved hypothetical protein [Vibrio alginolyticus 40B]
 gi|91190859|gb|EAS77126.1| hypothetical amino acid ABC transporter, permease protein [Vibrio
           alginolyticus 12G01]
 gi|269827129|gb|EEZ81437.1| conserved hypothetical protein [Vibrio alginolyticus 40B]
          Length = 315

 Score =  119 bits (299), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 59/157 (37%), Positives = 104/157 (66%), Gaps = 4/157 (2%)

Query: 176 GLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIM 235
           G++ T+ IS + +II++ LG+++ L R S+ P L+   + ++E+ RG PL+  +F+    
Sbjct: 116 GVVTTIKISLWSLIIALALGLVVGLMRISSNPALKKLALVYVEVIRGTPLLVQIFI---- 171

Query: 236 LPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMR 295
           +  F+    D+++    ++ +S F +AY+AE++R G+QSI +GQ EAA SLG++Y + M 
Sbjct: 172 VYFFIGTVLDLERFTAGVIALSVFTAAYVAEIVRSGIQSIPRGQMEAARSLGMNYPKAMI 231

Query: 296 LIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDL 332
            +I+PQ  K+ +P +   FI L KDSSL+S+I++ DL
Sbjct: 232 YVILPQAFKQTLPPLAGQFINLIKDSSLVSVISITDL 268


>gi|15643358|ref|NP_228402.1| amino acid ABC transporter, permease protein [Thermotoga maritima
           MSB8]
 gi|4981111|gb|AAD35677.1|AE001734_4 amino acid ABC transporter, permease protein [Thermotoga maritima
           MSB8]
          Length = 216

 Score =  119 bits (299), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 69/211 (32%), Positives = 116/211 (54%), Gaps = 12/211 (5%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
           L  G L TL ++   ++I + +GI + +GR S   ++RY    ++E  RG PL+  LF+ 
Sbjct: 15  LLKGALRTLQLTSLAVLIGLAIGIFVGMGRLSKYRIIRYPSSVYVEFLRGTPLMVQLFLV 74

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
              LP       + D+   A++ +   + AY+AE++R G+QS+ KGQ+EAA SLG+S+ Q
Sbjct: 75  YFGLPEL---GLEFDRFTAAVIALGINSGAYVAEIVRAGIQSVPKGQYEAARSLGMSHAQ 131

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPT 352
            M  +I+PQ  + ++P + N FI L KDSSL  +I   +L+         + +I S T  
Sbjct: 132 AMIYVILPQAFRHILPALGNEFIALAKDSSLAMVIGTVELM-------RSAQYIVSRTFM 184

Query: 353 TGLIF--IGFVFWIFCFSISLYSVFIEKTLH 381
           +  I+  +  +++   FS+S    F+E  L 
Sbjct: 185 SFPIYGGVALIYFAITFSVSRLVKFVEGRLK 215


>gi|170288144|ref|YP_001738382.1| polar amino acid ABC transporter, inner membrane subunit
           [Thermotoga sp. RQ2]
 gi|281411812|ref|YP_003345891.1| polar amino acid ABC transporter, inner membrane subunit
           [Thermotoga naphthophila RKU-10]
 gi|170175647|gb|ACB08699.1| polar amino acid ABC transporter, inner membrane subunit
           [Thermotoga sp. RQ2]
 gi|281372915|gb|ADA66477.1| polar amino acid ABC transporter, inner membrane subunit
           [Thermotoga naphthophila RKU-10]
          Length = 216

 Score =  119 bits (299), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 69/211 (32%), Positives = 116/211 (54%), Gaps = 12/211 (5%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
           L  G L TL ++   ++I + +GI + +GR S   ++RY    ++E  RG PL+  LF+ 
Sbjct: 15  LLKGALSTLQLTSLAVLIGLAIGIFVGMGRLSKYRIIRYPSSVYVEFLRGTPLMVQLFLV 74

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
              LP       + D+   A++ +   + AY+AE++R G+QS+ KGQ+EAA SLG+S+ Q
Sbjct: 75  YFGLPEL---GLEFDRFTAAVIALGINSGAYVAEIVRAGIQSVPKGQYEAARSLGMSHAQ 131

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPT 352
            M  +I+PQ  + ++P + N FI L KDSSL  +I   +L+         + +I S T  
Sbjct: 132 AMIYVILPQAFRHILPALGNEFIALAKDSSLAMVIGTVELM-------RSAQYIVSRTFM 184

Query: 353 TGLIF--IGFVFWIFCFSISLYSVFIEKTLH 381
           +  I+  +  +++   FS+S    F+E  L 
Sbjct: 185 SFPIYGGVALIYFAITFSVSRLVKFVEGRLK 215


>gi|222099044|ref|YP_002533612.1| Amino acid ABC transporter, permease protein [Thermotoga
           neapolitana DSM 4359]
 gi|221571434|gb|ACM22246.1| Amino acid ABC transporter, permease protein [Thermotoga
           neapolitana DSM 4359]
          Length = 216

 Score =  119 bits (299), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 69/211 (32%), Positives = 116/211 (54%), Gaps = 12/211 (5%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
           L  G L TL ++   ++I + +GI + +GR S   ++RY    ++E  RG PL+  LF+ 
Sbjct: 15  LLKGALRTLQLTSLAVLIGLAIGIFVGMGRLSKYRIIRYPSSVYVEFIRGTPLMVQLFLV 74

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
              LP       + D+   A++ +   + AY+AE++R G+QS+ KGQ+EAA SLG+S+ Q
Sbjct: 75  YFGLPEL---GLEFDRFTAAVVALGINSGAYVAEIVRAGIQSVPKGQYEAARSLGMSHFQ 131

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPT 352
            M  +I+PQ  + ++P + N FI L KDSSL  +I   +L+         + +I S T  
Sbjct: 132 AMVHVILPQAFRHILPALGNEFIALAKDSSLAMVIGTVELM-------RSAQYIVSRTFM 184

Query: 353 TGLIF--IGFVFWIFCFSISLYSVFIEKTLH 381
           +  I+  +  +++   FS+S    F+E  L 
Sbjct: 185 SFPIYGGVALIYFAITFSVSRLVRFVEGRLK 215


>gi|269104573|ref|ZP_06157269.1| amino acid ABC transporter permease protein [Photobacterium
           damselae subsp. damselae CIP 102761]
 gi|268161213|gb|EEZ39710.1| amino acid ABC transporter permease protein [Photobacterium
           damselae subsp. damselae CIP 102761]
          Length = 280

 Score =  119 bits (298), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 69/157 (43%), Positives = 100/157 (63%), Gaps = 4/157 (2%)

Query: 176 GLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIM 235
           GLL+TL IS   +I ++ LG++ AL R S+  V R     +IEL R  PL+  +++   +
Sbjct: 79  GLLITLKISAVSLIFTLGLGLITALLRLSDSIVGRALARGYIELIRNTPLLVQIYILYFV 138

Query: 236 LPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMR 295
           L   L    D+++   A+L +S F  AY AE+ R GL +I KGQFEAA SLGLS  Q  R
Sbjct: 139 LGPIL----DLERFTTAVLALSLFQGAYTAEIFRAGLNAIPKGQFEAAASLGLSQWQMYR 194

Query: 296 LIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDL 332
            +I+PQVIKR++P + N  + L K+SS++SI+ +FDL
Sbjct: 195 FVILPQVIKRILPPLTNETVSLVKNSSIVSIMAIFDL 231


>gi|148269470|ref|YP_001243930.1| polar amino acid ABC transporter, inner membrane subunit
           [Thermotoga petrophila RKU-1]
 gi|147735014|gb|ABQ46354.1| polar amino acid ABC transporter, inner membrane subunit
           [Thermotoga petrophila RKU-1]
          Length = 216

 Score =  119 bits (298), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 69/211 (32%), Positives = 116/211 (54%), Gaps = 12/211 (5%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
           L  G L TL ++   ++I + +GI + +GR S   ++RY    ++E  RG PL+  LF+ 
Sbjct: 15  LLKGALRTLQLTSLAVLIGLAIGIFVGMGRLSKYRIIRYPSSIYVEFLRGTPLMVQLFLV 74

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
              LP       + D+   A++ +   + AY+AE++R G+QS+ KGQ+EAA SLG+S+ Q
Sbjct: 75  YFGLPEL---GLEFDRFTAAVVALGINSGAYVAEIVRAGIQSVPKGQYEAARSLGMSHAQ 131

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPT 352
            M  +I+PQ  + ++P + N FI L KDSSL  +I   +L+         + +I S T  
Sbjct: 132 AMIYVILPQAFRHILPALGNEFIALAKDSSLAMVIGTVELM-------RSAQYIVSRTFM 184

Query: 353 TGLIF--IGFVFWIFCFSISLYSVFIEKTLH 381
           +  I+  +  +++   FS+S    F+E  L 
Sbjct: 185 SFPIYGGVALIYFAITFSVSRLVKFVEGRLK 215


>gi|320334506|ref|YP_004171217.1| polar amino acid ABC transporter inner membrane subunit
           [Deinococcus maricopensis DSM 21211]
 gi|319755795|gb|ADV67552.1| polar amino acid ABC transporter, inner membrane subunit
           [Deinococcus maricopensis DSM 21211]
          Length = 404

 Score =  119 bits (298), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 74/208 (35%), Positives = 128/208 (61%), Gaps = 15/208 (7%)

Query: 175 GGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASI 234
           GGL ++L+++  G+++S+P G+   +GR S +P+LR     +IELFRG+P +TV+F   I
Sbjct: 192 GGLALSLILAVLGLLLSLPFGLFFGIGRVSALPLLRAVSTVYIELFRGLPFITVIFWFFI 251

Query: 235 MLPLFLPDT---WDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYL 291
            +P  L +    W V      +L ++ F  AY+AE++R G++++ +GQ EAA +LGLS  
Sbjct: 252 FVPYVLGEGTQFWAV------ILALALFTGAYVAEIVRAGIRALPRGQDEAARALGLSGT 305

Query: 292 QKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTP 351
             M  +I+PQ ++ +IP +V  FI LFKD+SL+SII + +L G  R+  +       VT 
Sbjct: 306 HTMLSVILPQALRNMIPPLVGQFISLFKDTSLVSIIGLIELAGAARITGNR-----VVTA 360

Query: 352 TTGL-IFIGFVFWIFCFSISLYSVFIEK 378
           T  + + +  +++IF +++S  +  +E 
Sbjct: 361 TFEIYLTVAVLYFIFAYALSSAARRLEA 388


>gi|121535518|ref|ZP_01667327.1| polar amino acid ABC transporter, inner membrane subunit
           [Thermosinus carboxydivorans Nor1]
 gi|121305937|gb|EAX46870.1| polar amino acid ABC transporter, inner membrane subunit
           [Thermosinus carboxydivorans Nor1]
          Length = 221

 Score =  119 bits (298), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 71/219 (32%), Positives = 116/219 (52%), Gaps = 17/219 (7%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
           L  G  +T+ I+   + I + +G+ + + R SNI +LR A   +++  RG PL+  +F+ 
Sbjct: 15  LLAGAGITVQITAISVGIGLLIGMFVGMARLSNIWLLRAAATVYVDFLRGTPLLVQIFII 74

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
              +P+ +     +D  + A+      + AY+AE+ R G+QSI KGQ EA  SLG+S+ Q
Sbjct: 75  YFAIPIVIGQR--IDPFIAAITACGINSGAYVAEIFRAGIQSIDKGQMEAGRSLGMSWAQ 132

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDL-----LGIVRVNFSESTWIS 347
            MR II+PQ  KR+IP + N FI + KDSSL+S+I   +L     L I R   S   W++
Sbjct: 133 TMRYIILPQAFKRIIPPLGNEFIAMLKDSSLVSVIGFEELTRRGQLIIARTYGSFEIWLT 192

Query: 348 SVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
                     + F++ +   +IS    ++E+      K 
Sbjct: 193 ----------VAFIYLVMTLTISRLVDYLERRYKIDDKH 221


>gi|309790934|ref|ZP_07685476.1| polar amino acid ABC transporter, inner membrane subunit
           [Oscillochloris trichoides DG6]
 gi|308227048|gb|EFO80734.1| polar amino acid ABC transporter, inner membrane subunit
           [Oscillochloris trichoides DG6]
          Length = 266

 Score =  119 bits (297), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 70/203 (34%), Positives = 119/203 (58%), Gaps = 6/203 (2%)

Query: 146 ILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSN 205
           +++ G+    +F ++   L   I  T L G L  TL ++    I ++  G+ L LGR ++
Sbjct: 29  VIILGIIAFMAFRIMTDPLHQGIFNTILQG-LGTTLYVTAVSFIFALIFGLFLGLGRVAS 87

Query: 206 IPVLRYACITFIELFRGVPLVTVLFMASI-MLPLFLPDTWDVDKLL----RALLGVSAFA 260
            P++R   IT+IE  RGVP++ ++F  S  ++PLF       +  +    RA++ +    
Sbjct: 88  NPIIRNLTITYIEFIRGVPMLVLIFTISFAVVPLFAESFGLANNAISLTTRAIIALVLIY 147

Query: 261 SAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKD 320
            AYIAE+ R G++SIS+GQ EAA SLG+S  Q M  +I+PQ ++ V+P + N  I L KD
Sbjct: 148 GAYIAEIFRAGIESISRGQSEAARSLGMSRAQAMFYVILPQAVRNVMPALGNDLIALLKD 207

Query: 321 SSLISIINMFDLLGIVRVNFSES 343
           +SL+S++ + ++  + R++ S S
Sbjct: 208 TSLVSVLGVREMTQVARLSVSTS 230


>gi|149909833|ref|ZP_01898484.1| hypothetical amino acid ABC transporter, permease protein
           [Moritella sp. PE36]
 gi|149807165|gb|EDM67121.1| hypothetical amino acid ABC transporter, permease protein
           [Moritella sp. PE36]
          Length = 315

 Score =  119 bits (297), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 107/178 (60%), Gaps = 7/178 (3%)

Query: 158 FVLYGGLGLSIVETS---LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACI 214
           FV  G +  S+ + S   L  GLL+T+ +S   +  ++ +G++ AL R S  P  R    
Sbjct: 95  FVFSGDVISSVNQRSMGVLLQGLLMTIKLSLISLFFAVIIGLVAALMRISTNPFSRNFAF 154

Query: 215 TFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQS 274
            ++E+ RG PL+  +F+    +  FL   +D+D+    +  +S F  AYIAE++R G+QS
Sbjct: 155 LYVEVIRGTPLLVQIFI----VYFFLGTIFDLDRFTAGIAALSVFTGAYIAEIIRSGIQS 210

Query: 275 ISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDL 332
           IS GQ EAA SLG+SY + M  +I+PQ  KR +P +   FI L KDSSL+S+I++ DL
Sbjct: 211 ISPGQMEAARSLGMSYPKAMIYVILPQAFKRTLPPMAGQFINLIKDSSLVSVISITDL 268


>gi|224372630|ref|YP_002607002.1| amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine
           family [Nautilia profundicola AmH]
 gi|223589466|gb|ACM93202.1| amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine
           family [Nautilia profundicola AmH]
          Length = 272

 Score =  119 bits (297), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 74/215 (34%), Positives = 115/215 (53%), Gaps = 15/215 (6%)

Query: 175 GGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASI 234
           GGL +T +++   I  S  +G +  + R S+I +++   I +IEL R  PL+ V+F    
Sbjct: 62  GGLALTFILAITSIFFSFIIGSIFGIARWSSIKIIKIPAILYIELLRATPLLMVIFWVFF 121

Query: 235 MLPLF----LPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSY 290
            +P+F          V   + A++  + F SAY+AE++R G+ SI KGQFEAA SLG + 
Sbjct: 122 AIPVFSMAFFHTQAHVSPTVAAIIAFTLFTSAYVAEIVRAGINSIPKGQFEAAKSLGFNS 181

Query: 291 LQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSL---ISIINMFDLLGIVRVNFSESTWIS 347
            Q    II+PQ  +++IP  V+ F+ LFKD+SL   I +I  F    I+      S  I 
Sbjct: 182 TQTFIYIILPQAYRKMIPAFVSQFVALFKDTSLAYTIGVIEFFRAATIINNRLYLSFEIF 241

Query: 348 SVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHK 382
           S        F+  V++   FS+S +S  +EK + K
Sbjct: 242 S--------FVALVYFSIAFSMSKFSHMLEKKVEK 268


>gi|323142137|ref|ZP_08076982.1| glutamine ABC transporter, permease protein GlnP
           [Phascolarctobacterium sp. YIT 12067]
 gi|322413397|gb|EFY04271.1| glutamine ABC transporter, permease protein GlnP
           [Phascolarctobacterium sp. YIT 12067]
          Length = 216

 Score =  118 bits (296), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 69/211 (32%), Positives = 114/211 (54%), Gaps = 17/211 (8%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
           L  G  +T+ I+   +   + +G ++ + R  +I  LRY    +++  RG PL+  +F+ 
Sbjct: 13  LLAGAAITVEITAMSVTFGLLIGCMIGIARLCSIKPLRYFANVYVDFIRGTPLLVQIFLV 72

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
              LP  +     VD  + A+   S  + AY+AE+ R G+QSI KGQ EA  SLG+++ Q
Sbjct: 73  YFALPNIIGS--RVDPFVAAISACSINSGAYVAEIFRAGIQSIDKGQMEAGRSLGMTWAQ 130

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDL-----LGIVRVNFSESTWIS 347
            MR IIMPQ  KR+IP + N FI + KDSSL+S+I   +L     L I R   S   W++
Sbjct: 131 TMRYIIMPQAFKRIIPPLGNEFIAMLKDSSLVSVIGFEELTRRGQLIIARTYASFEIWMA 190

Query: 348 SVTPTTGLIFIGFVFWIFCFSISLYSVFIEK 378
                     +  ++ I  F+++ ++ ++E+
Sbjct: 191 ----------VAIIYLIMTFAVARFTGYLER 211


>gi|290968268|ref|ZP_06559811.1| ABC transporter, permease protein [Megasphaera genomosp. type_1
           str. 28L]
 gi|290781750|gb|EFD94335.1| ABC transporter, permease protein [Megasphaera genomosp. type_1
           str. 28L]
          Length = 216

 Score =  118 bits (296), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 75/207 (36%), Positives = 116/207 (56%), Gaps = 7/207 (3%)

Query: 172 SLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFM 231
           ++  GL VTL I    II+S+P G+LL++GR S I  +R     +I + RG PL+  +  
Sbjct: 10  AIGAGLQVTLKIFCITIILSLPFGVLLSVGRTSRIWGIRKIIGIYIYIMRGTPLMLQILF 69

Query: 232 ASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYL 291
               LP FL D   +     A++      +AY AE+ RGG+QSI +GQ+E A  LG++Y 
Sbjct: 70  IYYGLP-FLVDGLRLPPFGAAIIAFVLNYAAYFAEIFRGGIQSIGRGQYEGAKVLGMTYG 128

Query: 292 QKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTP 351
           Q MR I++PQV+K V+P + N  I L KD+SL+ I+ M D+L I R      + +     
Sbjct: 129 QTMRRIVLPQVVKCVLPPVANETINLLKDTSLVYILAMNDILRITR------SIVQRDFD 182

Query: 352 TTGLIFIGFVFWIFCFSISLYSVFIEK 378
           TT  +     + +F F ++   +++EK
Sbjct: 183 TTAFLVAAVFYLVFTFILTRVFMYLEK 209


>gi|261416889|ref|YP_003250572.1| polar amino acid ABC transporter, inner membrane subunit
           [Fibrobacter succinogenes subsp. succinogenes S85]
 gi|261373345|gb|ACX76090.1| polar amino acid ABC transporter, inner membrane subunit
           [Fibrobacter succinogenes subsp. succinogenes S85]
 gi|302326258|gb|ADL25459.1| amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine
           family [Fibrobacter succinogenes subsp. succinogenes
           S85]
          Length = 219

 Score =  118 bits (295), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 71/212 (33%), Positives = 115/212 (54%), Gaps = 9/212 (4%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPL---VTVL 229
           LWGG   TL I    ++ S+PLG+L+A+ + S   ++RY    +I + RG PL   +  +
Sbjct: 11  LWGGFCTTLAIFALTLLFSIPLGLLVAVLKMSRYRIVRYPVSFYISVMRGTPLLLQIVAI 70

Query: 230 FMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLS 289
           +  S  L  +    +  D+    ++  S   +AY AE+ RGG+QSI KGQ+EAA  LGL+
Sbjct: 71  YFGSYYLSEYTGVEFSFDRFPAVIVAFSINYAAYFAEIFRGGIQSIPKGQYEAAAMLGLT 130

Query: 290 YLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSV 349
             Q    II+PQV+KRV+P   N  I L KD+SL  +I + +L  + +    +    +S+
Sbjct: 131 RGQTFYRIILPQVVKRVVPASANEVITLVKDTSLAQVIAVTELFALAK---KQQAAYASI 187

Query: 350 TPTTGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
            P   L   G  ++I    +S+   ++E+ L+
Sbjct: 188 YP---LFVAGVFYYIANLLLSVLFAYVERKLN 216


>gi|307130487|ref|YP_003882503.1| amino acid ABC transporter permease [Dickeya dadantii 3937]
 gi|306528016|gb|ADM97946.1| amino acid ABC transporter permease [Dickeya dadantii 3937]
          Length = 256

 Score =  118 bits (295), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 65/196 (33%), Positives = 116/196 (59%), Gaps = 6/196 (3%)

Query: 175 GGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASI 234
           GG+L TL+IS   +++S PLG+L+ L R S    LR+A   ++   RG+PL+ V+F    
Sbjct: 26  GGVLCTLLISLLAVVLSFPLGVLVGLARLSPWRGLRWAATAWVYTLRGIPLMMVVFWTYF 85

Query: 235 MLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKM 294
            +PL +    ++      L  +  + SAYIAE++RGG+Q++  GQ+EA+ +LG+SYL+ +
Sbjct: 86  CVPLLIGQ--NISGFSTMLCTLVIYESAYIAEIVRGGIQALPHGQYEASRALGMSYLKTL 143

Query: 295 RLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTG 354
           RL+++PQ +   +P +V+  + + KDS+L  +IN+ +L      N   +  ++   P   
Sbjct: 144 RLVVLPQALFNSLPSLVSQLVSIIKDSTLGYVINVPEL--TYAANQVSNQLLTK--PFQV 199

Query: 355 LIFIGFVFWIFCFSIS 370
              +   ++I CFS++
Sbjct: 200 FAIVALSYYIICFSLT 215


>gi|319795336|ref|YP_004156976.1| polar amino acid ABC transporter, inner membrane subunit
           [Variovorax paradoxus EPS]
 gi|315597799|gb|ADU38865.1| polar amino acid ABC transporter, inner membrane subunit
           [Variovorax paradoxus EPS]
          Length = 241

 Score =  118 bits (295), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 66/198 (33%), Positives = 116/198 (58%), Gaps = 10/198 (5%)

Query: 187 GIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDV 246
           G+++++PLGI+L L R S    LR+    F+ + RG+PL+ V+F A   LP         
Sbjct: 35  GLVLALPLGIVLGLARVSPWRWLRWPVTGFVFVVRGLPLLMVIFWAYFFLPSL--TGVKT 92

Query: 247 DKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRV 306
           D+    L+ +  F +AY+AE++R G+Q + +GQ E A +LGLSY + MRL+++PQ ++ +
Sbjct: 93  DQFTTMLIALVIFDAAYLAEIVRAGIQGLPRGQMETARALGLSYFRAMRLVVLPQALRSM 152

Query: 307 IPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSV--TPTTGLIFIGFVFWI 364
           +P +VN F+   K++SL  II      G+  V+F  +   + V   P    + +G  ++I
Sbjct: 153 LPSLVNQFVSTIKETSLGYII------GLAEVSFIATQINTQVFTKPAQIYLILGGTYFI 206

Query: 365 FCFSISLYSVFIEKTLHK 382
            CF +S ++ ++E+ L +
Sbjct: 207 LCFGLSRFAYWLERRLAR 224


>gi|308067187|ref|YP_003868792.1| ABC-type amino acid transport system, permease component
           [Paenibacillus polymyxa E681]
 gi|305856466|gb|ADM68254.1| ABC-type amino acid transport system, permease component
           [Paenibacillus polymyxa E681]
          Length = 216

 Score =  117 bits (294), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 76/209 (36%), Positives = 123/209 (58%), Gaps = 13/209 (6%)

Query: 176 GLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIM 235
           G L+TL ++ + I+ S  LGIL  + R + +PV+       I+L R +PL+ ++F   ++
Sbjct: 18  GFLLTLEVAIYSIVFSFALGILFGILRYTRLPVISQVAAFIIDLIRNLPLLLIIFFIGMV 77

Query: 236 LP---LFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
           LP   + +   W       A+ G+S F  A IAE++R GL S+ KGQ EAA S GLSY Q
Sbjct: 78  LPSIGISISIKWA------AITGLSIFEGAMIAEIVRSGLNSVHKGQVEAARSSGLSYSQ 131

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPT 352
            +  II+PQ ++R++P IV+ FI LFKD+SL  II++ +L   +++   ++   S V P 
Sbjct: 132 TLWHIILPQALRRMVPPIVSQFISLFKDTSLAVIISLPELTHNIQIVGGQNQ--SFVIP- 188

Query: 353 TGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
             L+F  F+++   +S+SL +  +E   H
Sbjct: 189 -ALLFAAFLYFAVNYSMSLIARRLEVRTH 216


>gi|302391067|ref|YP_003826887.1| amino acid ABC transporter membrane protein [Acetohalobium
           arabaticum DSM 5501]
 gi|302203144|gb|ADL11822.1| amino acid ABC transporter membrane protein, PAAT family
           [Acetohalobium arabaticum DSM 5501]
          Length = 217

 Score =  117 bits (294), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 65/160 (40%), Positives = 99/160 (61%), Gaps = 3/160 (1%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
           L  G ++T+ I+   + + + LG +L L R S  P++      +IE+FRG PL+  LF+ 
Sbjct: 12  LLKGSVMTIKITTIAVGMGIILGNVLGLARVSKNPIIGGVAKGYIEIFRGTPLLVQLFIL 71

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
              LP       ++   + A+LG+   + AY+ E++RGG++SI KGQ EAA S+G+SY Q
Sbjct: 72  YYGLPSL---GINLTPYIAAVLGLGLNSGAYVGEIVRGGIESIDKGQMEAARSVGMSYAQ 128

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDL 332
            MR II+PQ  K ++P + N FI L KDSSL+S+I + DL
Sbjct: 129 SMRYIILPQAFKSIVPALGNEFIALLKDSSLVSVIAVKDL 168


>gi|217967440|ref|YP_002352946.1| polar amino acid ABC transporter, inner membrane subunit
           [Dictyoglomus turgidum DSM 6724]
 gi|217336539|gb|ACK42332.1| polar amino acid ABC transporter, inner membrane subunit
           [Dictyoglomus turgidum DSM 6724]
          Length = 218

 Score =  117 bits (293), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 73/213 (34%), Positives = 118/213 (55%), Gaps = 10/213 (4%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
           L  G +VTL +S   +   + LG+ L L R S   +LR     ++E+ RG PL+  L + 
Sbjct: 15  LLKGAVVTLRLSVISVAFGIILGLFLGLARISKNYLLRIPSTIYVEVIRGTPLLMQLLII 74

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
              LP F     ++  +  A++G+S  ++AY  E+ R G+QSI KGQ EAA SLG++Y Q
Sbjct: 75  YYALPSF---GINLGAITAAIVGLSLNSAAYTGEIFRSGIQSIDKGQMEAARSLGMTYFQ 131

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSV-TP 351
            MR II+PQ  +R++P + N F+ + K+SSL S + + +LL   R       W ++V +P
Sbjct: 132 AMRYIILPQAFRRILPPLTNEFVSMLKESSLASTLAVTELL---RAGREIVAWKANVFSP 188

Query: 352 TTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
             G   +  ++ +    ++  SV++EK L  G 
Sbjct: 189 FLG---VTLIYLLMTLPLTRLSVWLEKRLKTGD 218


>gi|323698192|ref|ZP_08110104.1| polar amino acid ABC transporter, inner membrane subunit
           [Desulfovibrio sp. ND132]
 gi|323458124|gb|EGB13989.1| polar amino acid ABC transporter, inner membrane subunit
           [Desulfovibrio desulfuricans ND132]
          Length = 336

 Score =  117 bits (293), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 75/214 (35%), Positives = 121/214 (56%), Gaps = 21/214 (9%)

Query: 176 GLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIM 235
           G L+T+ +S   I   + +G+   L R S+ P L+ + IT+IEL RG PL     +  IM
Sbjct: 128 GTLITIEVSIISIFFGILIGLFTGLSRISSNPFLKMSAITYIELIRGTPL-----LVQIM 182

Query: 236 LPLFLPDTWDVDKLLRALL--------GVSA---FASAYIAEVLRGGLQSISKGQFEAAN 284
           +  F+  T   + L++A L        GV++   FA AY+AE++R G+QSI KGQ EAA 
Sbjct: 183 IWYFVLGTILNNLLIKAGLFQIPELWFGVASLAIFAGAYVAEIVRAGIQSIHKGQMEAAR 242

Query: 285 SLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSEST 344
           SLG++ +  MR II+PQ  KR++P +   FI L KDSSL+ ++ + +L    R   +   
Sbjct: 243 SLGMTKVTAMRKIILPQAFKRILPPLAGQFISLIKDSSLLGVMAIRELTKATREAVT--- 299

Query: 345 WISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEK 378
             +S+ P       G ++ +  F++S++  ++EK
Sbjct: 300 --TSLMPYELWFVCGVLYLVITFTLSMFVQYLEK 331


>gi|323697578|ref|ZP_08109490.1| polar amino acid ABC transporter, inner membrane subunit
           [Desulfovibrio sp. ND132]
 gi|323457510|gb|EGB13375.1| polar amino acid ABC transporter, inner membrane subunit
           [Desulfovibrio desulfuricans ND132]
          Length = 587

 Score =  117 bits (293), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 69/189 (36%), Positives = 115/189 (60%), Gaps = 9/189 (4%)

Query: 194 LGILLALGRNSNIPVLRYACITFIELFRGVPLVTVL--FMASIMLPLFLPDTWDVDKLLR 251
           +G+++ +GR ++  V R  C+ +IEL RGVPL+ V+  F  +I+  +F     DV     
Sbjct: 397 IGLVVGMGRTAHNRVFRIPCLLYIELIRGVPLILVILWFYQAILEFVF---KVDVQAFWA 453

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
           A + ++ F  AYIAE +RGG+++I  GQ EAA + GL+YLQ MR I++PQ +K+++P +V
Sbjct: 454 ATIAMTFFFGAYIAETVRGGIENIPPGQVEAAKASGLTYLQTMRKIVLPQALKQMLPALV 513

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISL 371
             FI  FKD+SL  II + +L    R  ++ +  I  V P      +  ++++F + +SL
Sbjct: 514 GMFIAAFKDTSLAYIIGVMEL---TRAAYAINNRI-MVYPFEIYTTVAVLYFVFSYFMSL 569

Query: 372 YSVFIEKTL 380
           Y+  +E+ L
Sbjct: 570 YAKRLERKL 578



 Score = 88.6 bits (218), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 55/178 (30%), Positives = 97/178 (54%), Gaps = 11/178 (6%)

Query: 161 YGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELF 220
           YG +G  ++      G+  TL I+ +   I++ +G +  L R S+   + +    ++ELF
Sbjct: 48  YGHMGHLML-----NGINTTLTITVYSAAIALVMGTVFGLARLSSFKPVYWFSTCYVELF 102

Query: 221 RGVPLVTVLFMASIMLPLFLPDT-----WDVD-KLLRALLGVSAFASAYIAEVLRGGLQS 274
           R  PL+  LF  +  LP   P+      +D++ +   A +G   F  A++AE++R G+QS
Sbjct: 103 RNTPLLIQLFFWNFALPYAFPEELRLKLFDMNFEFWCATVGCGIFTGAFMAEIIRAGIQS 162

Query: 275 ISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDL 332
           I KG  EAA S GL++ Q +R +I+P   + +IP + + F+   K++SL   I + +L
Sbjct: 163 IPKGLLEAAYSSGLTFPQTLRKVILPLAFREIIPPLGSEFLNNMKNTSLAMTIGVTEL 220


>gi|282856520|ref|ZP_06265795.1| polar amino acid ABC transporter, inner membrane subunit
           [Pyramidobacter piscolens W5455]
 gi|282585641|gb|EFB90934.1| polar amino acid ABC transporter, inner membrane subunit
           [Pyramidobacter piscolens W5455]
          Length = 217

 Score =  117 bits (293), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 64/159 (40%), Positives = 96/159 (60%), Gaps = 3/159 (1%)

Query: 174 WGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMAS 233
           W G+ VT+  SFFG++    LGI +   R      LRY   T+I + RG PL+  LF+  
Sbjct: 16  WKGVCVTIQASFFGVLFGSALGIFIGSFRVMPFKPLRYLMATYIYVLRGTPLMIQLFLIY 75

Query: 234 IMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQK 293
             LP       ++D     +LG+   +S Y+ E++RGG++ + KGQ+EAA  LGLSY Q 
Sbjct: 76  FGLPAL---GVNLDAATAGILGIGINSSGYVGEIVRGGIEGVPKGQWEAAKMLGLSYWQT 132

Query: 294 MRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDL 332
           M+ II+PQ I+ ++P I N F+ L K+SSL+S++ + DL
Sbjct: 133 MKSIILPQAIRHMLPAIGNEFVTLIKESSLLSVLAISDL 171


>gi|295702500|ref|YP_003595575.1| glutamine ABC transporter permease GlnP [Bacillus megaterium DSM
           319]
 gi|294800159|gb|ADF37225.1| glutamine ABC transporter, permease protein GlnP [Bacillus
           megaterium DSM 319]
          Length = 216

 Score =  117 bits (292), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 68/205 (33%), Positives = 122/205 (59%), Gaps = 7/205 (3%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
           L  G  VTL ++F  I++S  +G ++ + R + IPVL +     +E+ R +PL+ ++F  
Sbjct: 15  LMEGFWVTLKVAFISIVLSFLIGSIVGILRYARIPVLSHVLAFIVEIIRNLPLLLIIFFT 74

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
              LP       D++    A++ ++ F SA I+E++R GL+SI KGQ EAA S GL+Y Q
Sbjct: 75  YFALP---EIGIDMEITSAAIVALTVFESAMISEIIRSGLKSIEKGQIEAARSSGLNYYQ 131

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPT 352
            +R +++PQ ++R++P +V+ FI L KD+SL  +I + DLL   ++ + +    S V P 
Sbjct: 132 TLRFVVLPQALRRMVPPLVSQFISLLKDTSLAVVIALPDLLHNAQIIYGQKQ--SYVVPM 189

Query: 353 TGLIFIGFVFWIFCFSISLYSVFIE 377
              + I  +++I  +++S+ +  +E
Sbjct: 190 --FLIIAMMYFIVNYALSIIARRLE 212


>gi|239817010|ref|YP_002945920.1| polar amino acid ABC transporter inner membrane subunit [Variovorax
           paradoxus S110]
 gi|239803587|gb|ACS20654.1| polar amino acid ABC transporter, inner membrane subunit
           [Variovorax paradoxus S110]
          Length = 240

 Score =  117 bits (292), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 67/200 (33%), Positives = 117/200 (58%), Gaps = 14/200 (7%)

Query: 187 GIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDV 246
           G+++++PLGI+L L R S    LR+    F+ + RG+PL+ V+F A      FLP    V
Sbjct: 35  GLVLALPLGIVLGLARVSPWRWLRWPVTGFVFVVRGLPLLMVIFWAY----FFLPSVTGV 90

Query: 247 --DKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIK 304
             D+    L+ +  F +AY+AE++R G+Q + +GQ E A +LGL Y + MRL+++PQ ++
Sbjct: 91  KTDQFTTMLIALVVFDAAYLAEIVRAGIQGLPRGQMETARALGLDYGRAMRLVVLPQALR 150

Query: 305 RVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSV--TPTTGLIFIGFVF 362
            ++P +VN F+   K++SL  II      G+  V+F  +   + V   P    + +G  +
Sbjct: 151 SMLPSLVNQFVSTIKETSLGYII------GLAEVSFIATQINTQVFTKPAQIYLILGLTY 204

Query: 363 WIFCFSISLYSVFIEKTLHK 382
           +I CF +S ++ ++E+ L +
Sbjct: 205 FILCFGLSRFAYWLERRLAR 224


>gi|296274225|ref|YP_003656856.1| polar amino acid ABC transporter inner membrane subunit [Arcobacter
           nitrofigilis DSM 7299]
 gi|296098399|gb|ADG94349.1| polar amino acid ABC transporter, inner membrane subunit
           [Arcobacter nitrofigilis DSM 7299]
          Length = 321

 Score =  117 bits (292), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 68/177 (38%), Positives = 105/177 (59%), Gaps = 9/177 (5%)

Query: 175 GGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASI 234
            GL +TL ISFF  +++  +GI++A  + S I  ++     ++ + RG PL+  +F+   
Sbjct: 118 NGLWITLKISFFAAVLTFFIGIIVAFMKLSPIVFIKDLATVYVTIVRGTPLLVQIFL--- 174

Query: 235 MLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKM 294
                + + ++ D+ +  +L +  F  AY+AE+LRG +QSI KGQ EA+ SLG+S  Q M
Sbjct: 175 -FYFIVANIFEFDRFVAGVLSLGIFFGAYMAEILRGAIQSIDKGQLEASKSLGISNFQAM 233

Query: 295 RLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLG----IVRVNFSE-STWI 346
           R II+PQ  KR +P ++   I L KDSSL+S+I++ DL      IV   FS   TWI
Sbjct: 234 RYIILPQAFKRALPTLIGEMIALVKDSSLVSVISITDLTKVGKEIVANTFSPFETWI 290


>gi|167628305|ref|YP_001678804.1| glutamine abc transporter, glutamine-binding protein, putative
           [Heliobacterium modesticaldum Ice1]
 gi|167591045|gb|ABZ82793.1| glutamine abc transporter, glutamine-binding protein, putative
           [Heliobacterium modesticaldum Ice1]
          Length = 220

 Score =  117 bits (292), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 71/214 (33%), Positives = 119/214 (55%), Gaps = 14/214 (6%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
           L  GL  T+ ++   I +S   GI++   R S  P LRY    ++E  R +PL+ ++F  
Sbjct: 18  LMTGLQWTIELALISIALSFFFGIVICALRISRYPFLRYPAFLYVESLRNLPLILLIFFT 77

Query: 233 SIMLP---LFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLS 289
              LP   L LP  W       A++  + F SA +AE++RGG+QS+ KGQ+EAA + G +
Sbjct: 78  YFALPKIGLGLPKFWA------AVVAFTIFTSALVAEIIRGGIQSVPKGQWEAARAQGFT 131

Query: 290 YLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSV 349
           YL+ M  II+PQ ++++IP +++ FI L KD+S  SII + +L    ++ F E       
Sbjct: 132 YLETMVYIILPQALRKMIPPLISQFITLTKDTSYASIIGLTELTEHGKLIFIEHN----- 186

Query: 350 TPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKG 383
            P     F+  ++++  F++S   +++EK +  G
Sbjct: 187 NPVQVFFFVACIYFVVNFTLSRLGMYMEKRMAIG 220


>gi|118473444|ref|YP_889564.1| glutamine ABC transporter permease/substrate-binding protein
           [Mycobacterium smegmatis str. MC2 155]
 gi|118174731|gb|ABK75627.1| glutamine ABC transporter, permease/substrate-binding protein
           [Mycobacterium smegmatis str. MC2 155]
          Length = 468

 Score =  117 bits (292), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 73/212 (34%), Positives = 120/212 (56%), Gaps = 17/212 (8%)

Query: 176 GLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIM 235
           GL +TL+++   I I++ LG++  L R S   VLR    T++++FRG PL+   F     
Sbjct: 269 GLRMTLILTVVSIAIALVLGVIFGLLRVSRSVVLRAIGTTYVDIFRGTPLLVQAFFIYFG 328

Query: 236 LPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMR 295
           +P  L   + +  L   ++ +S  A AY+ E++RGG+QS+ KGQ EAA SLG+ YL  MR
Sbjct: 329 IPSALG--FQMSALTAGIITLSLNAGAYMTEIVRGGIQSVDKGQMEAARSLGIGYLPTMR 386

Query: 296 LIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRV----NFSEST-WISSVT 350
            +I+PQ I+ +IP  +N F+   KD+S++S+I + +L    R+    NF   T W     
Sbjct: 387 KVILPQAIRTMIPSYINQFVITLKDTSILSVIGIAELTQTGRIIIARNFQSFTMW----- 441

Query: 351 PTTGLIFIGFVFWIFCFSISLYSVFIEKTLHK 382
                + IG ++++   +++  S  +EK L K
Sbjct: 442 -----LIIGIIYFVVIMALTKLSDRVEKRLVK 468


>gi|291280398|ref|YP_003497233.1| amino acid ABC transporter permease [Deferribacter desulfuricans
           SSM1]
 gi|290755100|dbj|BAI81477.1| amino acid ABC transporter, permease [Deferribacter desulfuricans
           SSM1]
          Length = 313

 Score =  117 bits (292), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 99/157 (63%), Gaps = 4/157 (2%)

Query: 176 GLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIM 235
           GL VTL +S   I  ++ +GI+  L R S  P L+   IT+IEL RG PL+  +F+    
Sbjct: 114 GLYVTLKLSIISIFFAIIIGIITGLMRISENPALKKLAITYIELIRGTPLLVQIFI---- 169

Query: 236 LPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMR 295
              F+     +++    +  ++ FA AY+AE++R G+QSI +GQ EAA SLG++Y Q MR
Sbjct: 170 FYFFIGTVLQLNRFTAGVAALAVFAGAYVAEIVRAGIQSIHRGQTEAARSLGMNYFQTMR 229

Query: 296 LIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDL 332
            II+PQ +KR IP +   FI L KDSSL+S+I++ DL
Sbjct: 230 YIILPQALKRTIPPMAGQFISLIKDSSLVSVISITDL 266


>gi|294497134|ref|YP_003560834.1| glutamine ABC transporter permease GlnP [Bacillus megaterium QM
           B1551]
 gi|294347071|gb|ADE67400.1| glutamine ABC transporter, permease protein GlnP [Bacillus
           megaterium QM B1551]
          Length = 216

 Score =  117 bits (292), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 68/205 (33%), Positives = 122/205 (59%), Gaps = 7/205 (3%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
           L  G  VTL ++F  I++S  +G ++ + R + IPVL +     +E+ R +PL+ ++F  
Sbjct: 15  LMEGFWVTLKVAFISIVLSFLIGSIVGILRYARIPVLSHVLAFVVEIIRNLPLLLIIFFT 74

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
              LP       D++    A++ ++ F SA I+E++R GL+SI KGQ EAA S GL+Y Q
Sbjct: 75  YFALP---EIGIDMEITSAAIVALTVFESAMISEIIRSGLKSIEKGQIEAARSSGLNYYQ 131

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPT 352
            +R +++PQ ++R++P +V+ FI L KD+SL  +I + DLL   ++ + +    S V P 
Sbjct: 132 TLRFVVLPQALRRMVPPLVSQFISLLKDTSLAVVIALPDLLHNAQIIYGQKQ--SYVVPM 189

Query: 353 TGLIFIGFVFWIFCFSISLYSVFIE 377
              + I  +++I  +++S+ +  +E
Sbjct: 190 --FLIIAMMYFIVNYALSIIARRLE 212


>gi|251790177|ref|YP_003004898.1| polar amino acid ABC transporter inner membrane subunit [Dickeya
           zeae Ech1591]
 gi|247538798|gb|ACT07419.1| polar amino acid ABC transporter, inner membrane subunit [Dickeya
           zeae Ech1591]
          Length = 256

 Score =  116 bits (291), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 67/197 (34%), Positives = 117/197 (59%), Gaps = 8/197 (4%)

Query: 175 GGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASI 234
           GG+L TL+IS   ++ S PLG+L+ L R S    LR+A   ++   RG+PL+ V+F    
Sbjct: 26  GGVLCTLLISLLAVVFSFPLGVLIGLARLSPWRGLRWAATAWVYTLRGIPLMMVVFWTYF 85

Query: 235 MLPLFL-PDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQK 293
            +PL +  +T     +L  L+    + SAYIAE++RGG+Q++  GQ+EA+ +LG+SYL+ 
Sbjct: 86  CVPLLIGQNTSGFSTMLCTLV---IYESAYIAEIVRGGIQALPHGQYEASRALGMSYLKT 142

Query: 294 MRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTT 353
           +RL+++PQ +   +P +V+  + + KDS+L  +IN+ +L      N   +  ++   P  
Sbjct: 143 LRLVVLPQALFNSLPSLVSQLVSIIKDSTLGYVINVPEL--TYAANQVSNQLLTK--PFQ 198

Query: 354 GLIFIGFVFWIFCFSIS 370
               +   ++I CFS++
Sbjct: 199 VFAIVALSYYIICFSLT 215


>gi|289450823|ref|YP_003475334.1| putative arginine ABC transporter permease ArtQ [Clostridiales
           genomosp. BVAB3 str. UPII9-5]
 gi|289185370|gb|ADC91795.1| putative arginine ABC transporter, permease protein ArtQ
           [Clostridiales genomosp. BVAB3 str. UPII9-5]
          Length = 229

 Score =  116 bits (291), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 63/167 (37%), Positives = 103/167 (61%), Gaps = 7/167 (4%)

Query: 174 WGGL-----LVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTV 228
           WGG+     L TL +SFFG++    LG+ +A  R S  P L      +I++FRG PL+  
Sbjct: 14  WGGMYLHGTLTTLQLSFFGVLFGFILGLFIAFMRGSRSPFLSVPAKIYIQIFRGTPLLVQ 73

Query: 229 LFMASIMLPLFLPDTWDVDK--LLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSL 286
           + +A       +P+ ++  K  L+ +L+ +   +SAY++EV+R G+ S+ +GQFEAA+SL
Sbjct: 74  VLIAYYGFASVIPNEYNYLKNPLVLSLIAICMNSSAYVSEVIRSGINSVDRGQFEAASSL 133

Query: 287 GLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLL 333
           G+   Q M  II+PQ IK V+P + N FI L K+S++++ + + DL+
Sbjct: 134 GMKKKQIMYYIILPQAIKTVLPALGNEFITLIKESAIVAFVGIGDLM 180


>gi|125624757|ref|YP_001033240.1| glutamate ABC transporter permease protein [Lactococcus lactis
           subsp. cremoris MG1363]
 gi|124493565|emb|CAL98550.1| glutamate ABC transporter permease protein [Lactococcus lactis
           subsp. cremoris MG1363]
 gi|300071557|gb|ADJ60957.1| glutamate ABC transporter permease protein [Lactococcus lactis
           subsp. cremoris NZ9000]
          Length = 228

 Score =  116 bits (291), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 73/220 (33%), Positives = 126/220 (57%), Gaps = 16/220 (7%)

Query: 176 GLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVL-----F 230
           G++VT+ IS F ++I   LGI+ AL + S I  LR+    +IE+FRG P++  +      
Sbjct: 16  GMIVTIFISAFVVLIGTLLGIVTALAKISKIAPLRWLANIYIEIFRGTPMLVQIMLGFGL 75

Query: 231 MASIMLPLFLPD--TWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGL 288
           M SI LP F       D+ +L+  ++ +S  + AY+AE++R G++++  GQ EAA SLG+
Sbjct: 76  MGSISLPTFQVGILQQDLGRLIPGIIVISLNSGAYMAEIVRAGIEAVPLGQKEAAYSLGI 135

Query: 289 SYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISS 348
              Q M  +I+PQ ++ ++P + N F+ + KDSSL+  I + ++       F+ +  +++
Sbjct: 136 RPRQAMTTVILPQALRNILPAVGNEFVTIIKDSSLLYTIGVMEV-------FNGAQTVAN 188

Query: 349 VTPTT--GLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
           +T  T   +IF+   +++  F +S   V  EK L KG  K
Sbjct: 189 LTYQTISPMIFVALYYFVVTFVVSRLLVLFEKKLGKGYAK 228


>gi|118475005|ref|YP_892321.1| amino acid ABC transporter, permease protein PEB1 [Campylobacter
           fetus subsp. fetus 82-40]
 gi|118414231|gb|ABK82651.1| amino acid ABC transporter, permease protein PEB1 [Campylobacter
           fetus subsp. fetus 82-40]
          Length = 229

 Score =  116 bits (291), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 70/208 (33%), Positives = 116/208 (55%), Gaps = 8/208 (3%)

Query: 176 GLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIM 235
           GL  TL +S   +I++  +G++  +     I +LRY    ++E+F+  PLV  LF     
Sbjct: 25  GLGFTLGVSILALILAGVIGVISGMMATGKIAILRYCSRIYVEVFQNTPLVIQLFFLYFA 84

Query: 236 LPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMR 295
           LP   P   ++D     +LG+ A+  AY++EV+R G+ SI KGQFEAA S G SY+++M 
Sbjct: 85  LP---PMGINLDVFTIGVLGIGAYHGAYMSEVVRSGINSIPKGQFEAATSQGFSYIEQMM 141

Query: 296 LIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGL 355
            II+PQ IK ++P   N  + L K+SS++ II   +L+ +     S+S    S+   T  
Sbjct: 142 YIILPQSIKIILPPATNQAVNLIKNSSVLLIIAGAELMYM-----SDSYASDSLNYATSY 196

Query: 356 IFIGFVFWIFCFSISLYSVFIEKTLHKG 383
              G +++I CF +++++   E+ L   
Sbjct: 197 SVAGILYFIMCFPLAMWARNYEEKLKNA 224


>gi|206900671|ref|YP_002250772.1| glutamine ABC transporter, permease protein [Dictyoglomus
           thermophilum H-6-12]
 gi|206739774|gb|ACI18832.1| glutamine ABC transporter, permease protein [Dictyoglomus
           thermophilum H-6-12]
          Length = 218

 Score =  116 bits (291), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 77/217 (35%), Positives = 120/217 (55%), Gaps = 18/217 (8%)

Query: 173 LWGGLLVTLVIS----FFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTV 228
           L  G +VTL +S    FFGII    LG+ L L R S    LR     ++E+ RG PL+  
Sbjct: 15  LLKGAVVTLRLSVVSVFFGII----LGLFLGLARISKNYFLRIPSTIYVEVIRGTPLLMQ 70

Query: 229 LFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGL 288
           L +    LP F     ++  +  A++G+S  ++AY  E+ R G+QSI KGQ EAA SLG+
Sbjct: 71  LLIIYYALPSF---GINLGAITAAIVGLSLNSAAYTGEIFRSGIQSIEKGQMEAARSLGM 127

Query: 289 SYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISS 348
           +Y Q MR +I+PQ  +R++P + N F+ + K+SSL S + + +LL   R       W ++
Sbjct: 128 TYFQAMRYVILPQAFRRILPPLTNEFVSMLKESSLASTLAVTELL---RAGREIVAWKAN 184

Query: 349 V-TPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
           V +P  G   +  ++ +    ++  SV++EK L  G 
Sbjct: 185 VFSPFLG---VTLIYLLMTLPLTRLSVWLEKRLKTGD 218


>gi|303256934|ref|ZP_07342948.1| glutamine ABC transporter, permease protein [Burkholderiales
           bacterium 1_1_47]
 gi|330998815|ref|ZP_08322542.1| glutamine ABC transporter, permease protein GlnP [Parasutterella
           excrementihominis YIT 11859]
 gi|302860425|gb|EFL83502.1| glutamine ABC transporter, permease protein [Burkholderiales
           bacterium 1_1_47]
 gi|329576029|gb|EGG57548.1| glutamine ABC transporter, permease protein GlnP [Parasutterella
           excrementihominis YIT 11859]
          Length = 223

 Score =  116 bits (291), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 74/231 (32%), Positives = 123/231 (53%), Gaps = 20/231 (8%)

Query: 164 LGLSIVETSL---WGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELF 220
           L LSI+  +L     G  +TL I+   + + + +G+ + + + S+  ++R     +++  
Sbjct: 5   LNLSIITENLPLLLKGAGITLEITALSVGLGLLIGMFVGVAKLSDNRLIRGLASVYVDCI 64

Query: 221 RGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQF 280
           RG PL+  +F+    LP  +     +D  + A+   S  + AY+AE+ R G+QSI KGQ 
Sbjct: 65  RGTPLLVQIFLVYFALPQIIGHR--IDPFVAAVGACSINSGAYVAEIFRAGIQSIDKGQM 122

Query: 281 EAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDL-----LGI 335
           EA+ +LGL++ Q MR +IMPQ  KR+IP + N FI + KDSSL+S+I   +L     L I
Sbjct: 123 EASRALGLNWFQAMRFVIMPQAFKRIIPPLGNEFIAMLKDSSLVSVIGFEELTRTGQLII 182

Query: 336 VRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
            R   +   W          I +  ++ I   +IS +   +EK   KG++K
Sbjct: 183 SRTYAAFEIW----------IVVALLYLIMTLAISRFVALLEKRFSKGTRK 223


>gi|57242094|ref|ZP_00370034.1| amino acid ABC transporter, permease protein [Campylobacter
           upsaliensis RM3195]
 gi|57017286|gb|EAL54067.1| amino acid ABC transporter, permease protein [Campylobacter
           upsaliensis RM3195]
          Length = 250

 Score =  116 bits (290), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 76/245 (31%), Positives = 131/245 (53%), Gaps = 9/245 (3%)

Query: 140 RKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLA 199
           R+F NS+ L+    I S F L+  L       +   G + TL +S   ++I++  G +  
Sbjct: 12  REFFNSLGLYDEESI-SPFALWKFLDTLEQTQTFMDGFIYTLQVSVLALLIAVVFGTIGG 70

Query: 200 LGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAF 259
           +   S I VLR     ++E+F+  PLV  +F     LP       ++D  +  +LG+ A+
Sbjct: 71  VMATSKIAVLRAYTRIYVEIFQNTPLVIQIFFLYYGLPHL---GINLDLFVIGVLGIGAY 127

Query: 260 ASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFK 319
             AY++EV+R G+ ++ KGQFEA+ S G +Y Q+MR II+PQ IK ++P + N  I L K
Sbjct: 128 HGAYVSEVVRSGILAVPKGQFEASASQGFTYTQQMRYIIVPQTIKIILPPMSNQMINLIK 187

Query: 320 DSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKT 379
           ++S++ I+   +L+       S +    +  P    IF  F+++I C+ ++ ++ F E+ 
Sbjct: 188 NTSVLLIVGGVELMSTAD---SYAADYGNYAP--AYIFAAFLYFIVCYPLAYFAKFYEEK 242

Query: 380 LHKGS 384
           L K  
Sbjct: 243 LKKAH 247


>gi|150020367|ref|YP_001305721.1| ectoine/hydroxyectoine ABC transporter, permease protein EhuC
           [Thermosipho melanesiensis BI429]
 gi|149792888|gb|ABR30336.1| Ectoine/hydroxyectoine ABC transporter, permease protein EhuC
           [Thermosipho melanesiensis BI429]
          Length = 216

 Score =  116 bits (290), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 70/204 (34%), Positives = 113/204 (55%), Gaps = 12/204 (5%)

Query: 180 TLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLF 239
           TL ++FF ++I + LG  + +GR S I  +      ++E  RG PL+  + +    LP  
Sbjct: 21  TLKLTFFSVLIGLVLGTFIGMGRLSKIKAINIPSTVYVEFLRGTPLLVQISIVYFGLPQL 80

Query: 240 LPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIM 299
                 ++    A++ +   + AYIAE++R G+QSI KGQ+EAA SLG+++ Q MR II+
Sbjct: 81  ---GIQLEAYPAAIVALGLNSGAYIAEIVRAGIQSIPKGQYEAARSLGMTHFQTMRYIIL 137

Query: 300 PQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIG 359
           PQ  K ++P + N FI L KDSSL SII + +L+           ++ + T  T  I+ G
Sbjct: 138 PQAFKNILPALGNEFITLTKDSSLASIIGVTELM-------RRGQFVITRTFQTFSIYFG 190

Query: 360 --FVFWIFCFSISLYSVFIEKTLH 381
              ++++  F+IS    F EK + 
Sbjct: 191 IALIYFVMTFTISRLVRFAEKRME 214


>gi|260881503|ref|ZP_05404565.2| glutamine ABC transporter, permease protein [Mitsuokella multacida
           DSM 20544]
 gi|260848606|gb|EEX68613.1| glutamine ABC transporter, permease protein [Mitsuokella multacida
           DSM 20544]
          Length = 221

 Score =  116 bits (290), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 70/216 (32%), Positives = 113/216 (52%), Gaps = 17/216 (7%)

Query: 176 GLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIM 235
           G  VT+ I+   + + + +G+ + + R S I +LR     +++ FRG PL+  +F+    
Sbjct: 18  GAGVTIKITALSVALGVVIGLFVGIARISRIKLLRVLAAIYVDFFRGTPLLVQIFLVYFA 77

Query: 236 LPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMR 295
           LP+       VD  + A+      + AY+AE+ R G+QSI KGQ EA  SLG++++Q MR
Sbjct: 78  LPVITGQR--VDPFVAAIGSCGINSGAYVAEIFRAGIQSIDKGQMEAGRSLGMTWVQTMR 135

Query: 296 LIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDL-----LGIVRVNFSESTWISSVT 350
            II+PQ  KRVIP + N FI L KDSSL+S+I   +L     L I +   S   W+S   
Sbjct: 136 YIIVPQAFKRVIPPLGNEFIALLKDSSLVSVIGFEELTRRGQLIIAKTYGSLEIWLS--- 192

Query: 351 PTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
                  +  ++     +IS +  ++E+      + 
Sbjct: 193 -------VAVIYLAMTLTISRFVAYLERRYKTDDRH 221


>gi|283853863|ref|ZP_06371079.1| polar amino acid ABC transporter, inner membrane subunit
           [Desulfovibrio sp. FW1012B]
 gi|283570738|gb|EFC18782.1| polar amino acid ABC transporter, inner membrane subunit
           [Desulfovibrio sp. FW1012B]
          Length = 231

 Score =  116 bits (290), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 72/211 (34%), Positives = 123/211 (58%), Gaps = 12/211 (5%)

Query: 175 GGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASI 234
           GGL +T++++  GI  +  LG+ + L R S +  LR+  + +IE+ RG PL+ V+F    
Sbjct: 24  GGLAMTVLLAVGGIFGAFWLGLGIGLFRISKLRRLRWPAMVYIEIIRGTPLLMVVFWFYF 83

Query: 235 MLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKM 294
           + P+ L  T  + +   AL+ +  F SAYIAE++R G++++ KGQ EAA   GL++ Q M
Sbjct: 84  LAPVLLGKT--LPEAQSALIALIVFTSAYIAEIVRAGVEALPKGQMEAARGTGLNHFQTM 141

Query: 295 RLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVT---P 351
             +I+PQ +  +IP  VN F+ L KD+SL  II + +L          +T ++S T   P
Sbjct: 142 THVILPQALFNMIPSFVNQFVSLTKDTSLAFIIGVNELT-------KAATQVNSRTLTAP 194

Query: 352 TTGLIFIGFVFWIFCFSISLYSVFIEKTLHK 382
           T   I I  ++++ C+ ++  S  +EK +++
Sbjct: 195 TEIFITIALLYFVICYCLTELSRRLEKHINR 225


>gi|255659183|ref|ZP_05404592.1| L-cystine ABC transporter, permease protein [Mitsuokella multacida
           DSM 20544]
 gi|260848634|gb|EEX68641.1| L-cystine ABC transporter, permease protein [Mitsuokella multacida
           DSM 20544]
          Length = 214

 Score =  116 bits (290), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 72/165 (43%), Positives = 99/165 (60%), Gaps = 9/165 (5%)

Query: 176 GLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIM 235
           G  +TL I F  ++I++PLG++ ALGR S    L      +I L RG PL+  L      
Sbjct: 14  GSEITLEIFFVTLVIALPLGMMAALGRLSKWRPLSAFMEFYIWLMRGTPLMLQLLFVYFA 73

Query: 236 LPLF---LPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
           LP+    LPD      +  ALL  +   +AY AE+ R G+QS+ KGQ+EAA +LG++Y Q
Sbjct: 74  LPMIGIRLPD------IAAALLAFTLNYAAYFAEIFRAGIQSVPKGQYEAARTLGMNYTQ 127

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVR 337
            MR II+PQVI+ V+P + N  I L KD+SLI I+ M DLL + R
Sbjct: 128 TMRRIILPQVIRIVLPPVSNETINLVKDTSLIYILAMNDLLRVAR 172


>gi|310827296|ref|YP_003959653.1| hypothetical protein ELI_1704 [Eubacterium limosum KIST612]
 gi|308739030|gb|ADO36690.1| hypothetical protein ELI_1704 [Eubacterium limosum KIST612]
          Length = 221

 Score =  116 bits (290), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 70/185 (37%), Positives = 108/185 (58%), Gaps = 8/185 (4%)

Query: 170 ETSLWG---GLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLV 226
           +T LW    G +VTL I+   II     G+++ALGR S   +       +I  FRG PL+
Sbjct: 4   QTQLWAIFDGTIVTLEIAVVAIIFGAIFGVVIALGRISKNKIFNGLSWFYIWFFRGTPLL 63

Query: 227 TVLFMASIMLPLFLPD----TWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEA 282
             LF+    +P+   D    T+++D ++ A +  S  ++AY+AE++R  ++SI  GQ EA
Sbjct: 64  LQLFIIFYAVPIVYLDMTGATFEIDPMICAFITFSLNSTAYLAEIIRAAIESIDHGQMEA 123

Query: 283 ANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSE 342
           A +LG+SY Q M  II+PQ  KR++  + N  I L KD+SL+S I +FDLL  V+   S 
Sbjct: 124 AKALGMSYKQAMGKIIIPQTFKRLVAPVGNELIMLLKDTSLVSTIALFDLLRTVKTMASA 183

Query: 343 S-TWI 346
           + +W+
Sbjct: 184 TGSWV 188


>gi|154249738|ref|YP_001410563.1| polar amino acid ABC transporter, inner membrane subunit
           [Fervidobacterium nodosum Rt17-B1]
 gi|154153674|gb|ABS60906.1| polar amino acid ABC transporter, inner membrane subunit
           [Fervidobacterium nodosum Rt17-B1]
          Length = 216

 Score =  116 bits (290), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 73/203 (35%), Positives = 115/203 (56%), Gaps = 12/203 (5%)

Query: 180 TLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLF 239
           TL ++ F + I + LG  + +GR S I ++ Y C  ++E  RG PL+  + +    LP  
Sbjct: 21  TLKLTAFSVGIGLILGTFIGMGRLSKIKLINYPCTAYVEFLRGTPLLVQISIVYFGLPQL 80

Query: 240 LPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIM 299
                     + AL G+++   AYIAE++R G+QSI KGQ+EAA SLGL++ Q MR +I+
Sbjct: 81  GIQLAPYPAAITAL-GLNS--GAYIAEIVRAGIQSIPKGQYEAARSLGLTHWQAMRYVIL 137

Query: 300 PQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIG 359
           PQ  + ++P + N FI L KDSSL S+I + +L+           ++ S T  T  I+ G
Sbjct: 138 PQAFRNILPALGNEFITLTKDSSLASVIGVSELM-------RSGQFVISRTFQTFSIYFG 190

Query: 360 --FVFWIFCFSISLYSVFIEKTL 380
             F+++I  F IS    +IE+ +
Sbjct: 191 IAFIYFIMTFVISRLVRYIERRM 213


>gi|282882686|ref|ZP_06291296.1| arginine transport system permease protein ArtQ [Peptoniphilus
           lacrimalis 315-B]
 gi|300814297|ref|ZP_07094569.1| putative arginine ABC transporter, permease protein ArtQ
           [Peptoniphilus sp. oral taxon 836 str. F0141]
 gi|281297499|gb|EFA89985.1| arginine transport system permease protein ArtQ [Peptoniphilus
           lacrimalis 315-B]
 gi|300511564|gb|EFK38792.1| putative arginine ABC transporter, permease protein ArtQ
           [Peptoniphilus sp. oral taxon 836 str. F0141]
          Length = 225

 Score =  116 bits (290), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 68/209 (32%), Positives = 123/209 (58%), Gaps = 7/209 (3%)

Query: 176 GLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIM 235
           G  VT+ +S  G+I+ + +GI+LAL + S   +L++    +IE+ RG P++  + +    
Sbjct: 21  GAGVTIKLSLIGVILGLTIGIVLALMKISKNKLLKFIASAYIEIVRGTPMLVQIMIVYFG 80

Query: 236 LPLFLPDTWDVDK--LLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQK 293
           L   +PD+    K  +L   L +S  ++AY+AE++R G+ S+  GQ EAA SLGL+  Q 
Sbjct: 81  LKKIIPDSLPYLKAPMLLCALSISLNSAAYVAEIIRSGINSVDNGQMEAARSLGLTRSQA 140

Query: 294 MRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTT 353
           MR II+PQ +K ++P +VN FI L K+SS++  + + +L+   + + + +T+  +V P  
Sbjct: 141 MRKIILPQAVKNILPALVNEFITLIKESSIVYTVGVAELMYSGK-SIASATY-QAVRP-- 196

Query: 354 GLIFIGFVFWIFCFSISLYSVFIEKTLHK 382
             I+   +++I  +S+S     +E+ L  
Sbjct: 197 -FIYAAIIYFIMTYSLSKALQVLERRLSN 224


>gi|289550425|ref|YP_003471329.1| Glutamate ABC transporter, periplasmic glutamine-binding protein
           [Staphylococcus lugdunensis HKU09-01]
 gi|289179957|gb|ADC87202.1| Glutamate ABC transporter, periplasmic glutamine-binding protein
           [Staphylococcus lugdunensis HKU09-01]
          Length = 485

 Score =  115 bits (289), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 75/227 (33%), Positives = 122/227 (53%), Gaps = 25/227 (11%)

Query: 156 SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACIT 215
           +FF  YG             G++ T+++S  G+II   LG L+AL + S I ++ +    
Sbjct: 272 NFFTKYGSF--------FVKGIVNTIILSAIGVIIGAVLGTLIALAKLSKIKIISWIAAA 323

Query: 216 FIELFRGVPLVTVLFMASIMLPLFLPDTW----DVDKLLRALLGVSAFASAYIAEVLRGG 271
           +IE+ RG PL+  +F+      +F   T     D+   +  ++ +   +SAYIAE++R G
Sbjct: 324 YIEIIRGTPLLVQVFI------VFFGTTAALGLDISAFICGIIALIINSSAYIAEIIRAG 377

Query: 272 LQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFD 331
           + ++ KGQ EAA  LGL+Y Q M+ +IMPQ IK ++P + N F+ L K+SS++S I    
Sbjct: 378 INAVDKGQTEAAQCLGLNYNQTMKNVIMPQAIKNILPALGNEFVTLIKESSIVSTI---- 433

Query: 332 LLGIVRVNF-SESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIE 377
             G+  V F S+     S  P T L+    ++++  FS+S     IE
Sbjct: 434 --GVSEVMFNSQVVQGISFDPFTPLLLAAGLYFVLTFSLSRIMTLIE 478


>gi|238019979|ref|ZP_04600405.1| hypothetical protein VEIDISOL_01855 [Veillonella dispar ATCC 17748]
 gi|237863503|gb|EEP64793.1| hypothetical protein VEIDISOL_01855 [Veillonella dispar ATCC 17748]
          Length = 218

 Score =  115 bits (289), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 70/168 (41%), Positives = 98/168 (58%), Gaps = 4/168 (2%)

Query: 172 SLWGGLLVTLVISFFGI--IISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVL 229
           ++  GL VT  +S F I  I+S+P GILLAL R S   VL      F+ L RG PL+  +
Sbjct: 11  TIADGLKVT--VSLFCIVWILSIPGGILLALVRLSKFTVLDKIVEAFVYLMRGTPLMLQI 68

Query: 230 FMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLS 289
                 LP+       +D    A+L      +AY+ E+ RGG+QSIS+GQ+E A  LG +
Sbjct: 69  LFVYYALPIITDGAVQMDDATAAVLTFVLNYAAYLCEIFRGGIQSISRGQYEGAKVLGFT 128

Query: 290 YLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVR 337
           Y Q MR II+PQ+ KRV+P + N  I L KD+SL+ ++ M D+L I +
Sbjct: 129 YAQTMRKIILPQMFKRVLPPLANETINLLKDTSLVYVLAMNDILRITK 176


>gi|116512666|ref|YP_811573.1| glutamate ABC transporter permease protein [Lactococcus lactis
           subsp. cremoris SK11]
 gi|116108320|gb|ABJ73460.1| amino acid ABC transporter membrane protein, PAAT family
           [Lactococcus lactis subsp. cremoris SK11]
          Length = 228

 Score =  115 bits (289), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 73/220 (33%), Positives = 126/220 (57%), Gaps = 16/220 (7%)

Query: 176 GLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVL-----F 230
           G++VT+ IS F ++I   LGI+ AL + S I  LR+    +IE+FRG P++  +      
Sbjct: 16  GMIVTIFISAFVVLIGTLLGIVTALAKISKIDPLRWLANIYIEIFRGTPMLVQIMLGFGL 75

Query: 231 MASIMLPLFLPD--TWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGL 288
           M SI LP F       D+ +L+  ++ +S  + AY+AE++R G++++  GQ EAA SLG+
Sbjct: 76  MGSISLPTFQVGILQQDLGRLIPGIILISLNSGAYMAEIVRAGIEAVPLGQKEAAYSLGI 135

Query: 289 SYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISS 348
              Q M  +I+PQ ++ ++P + N F+ + KDSSL+  I + ++       F+ +  +++
Sbjct: 136 RPRQAMTTVILPQALRNILPAVGNEFVTIIKDSSLLYTIGVMEV-------FNGAQTVAN 188

Query: 349 VTPTT--GLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
           +T  T   +IF+   +++  F +S   V  EK L KG  K
Sbjct: 189 LTYQTISPMIFVALYYFVVTFVVSRLLVLFEKRLGKGYAK 228


>gi|315638191|ref|ZP_07893373.1| amino acid ABC superfamily ATP binding cassette transporter,
           membrane protein [Campylobacter upsaliensis JV21]
 gi|315481727|gb|EFU72349.1| amino acid ABC superfamily ATP binding cassette transporter,
           membrane protein [Campylobacter upsaliensis JV21]
          Length = 250

 Score =  115 bits (289), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 76/245 (31%), Positives = 130/245 (53%), Gaps = 9/245 (3%)

Query: 140 RKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLA 199
           R+F NS+ L+    I S F L+  L       +   G + TL +S   ++I++  G +  
Sbjct: 12  REFFNSLGLYDEESI-SPFALWKFLDTLEQTQTFMDGFIYTLQVSVLALLIAVVFGTIGG 70

Query: 200 LGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAF 259
           +   S I VLR     ++E+F+  PLV  +F     LP       ++D     +LG+ A+
Sbjct: 71  VMATSKIAVLRAYTRIYVEIFQNTPLVIQIFFLYYGLPHL---GINLDLFTIGVLGIGAY 127

Query: 260 ASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFK 319
             AY++EV+R G+ ++ KGQFEA+ S G +Y Q+MR II+PQ IK ++P + N  I L K
Sbjct: 128 HGAYVSEVVRSGILAVPKGQFEASASQGFTYTQQMRYIIVPQTIKIILPPMSNQMINLIK 187

Query: 320 DSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKT 379
           ++S++ I+   +L+       S +    +  P    IF  F+++I C+ ++ ++ F E+ 
Sbjct: 188 NTSVLLIVGGVELMSTAD---SYAADYGNYAP--AYIFAAFLYFIVCYPLAYFAKFYEEK 242

Query: 380 LHKGS 384
           L K  
Sbjct: 243 LKKAH 247


>gi|294793049|ref|ZP_06758195.1| amino acid ABC transporter, permease protein [Veillonella sp.
           6_1_27]
 gi|294794912|ref|ZP_06760047.1| amino acid ABC transporter, permease protein [Veillonella sp.
           3_1_44]
 gi|294454274|gb|EFG22648.1| amino acid ABC transporter, permease protein [Veillonella sp.
           3_1_44]
 gi|294455994|gb|EFG24358.1| amino acid ABC transporter, permease protein [Veillonella sp.
           6_1_27]
          Length = 238

 Score =  115 bits (289), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 67/168 (39%), Positives = 100/168 (59%), Gaps = 4/168 (2%)

Query: 172 SLWGGLLVTLVISFFGI--IISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVL 229
           ++  GL VT  +S F I  I+S+P GIL+A+ R S +P++      F+ L RG PL+  +
Sbjct: 31  TIADGLKVT--VSLFCIVWILSIPGGILMAMLRLSKLPLVDKLVDAFVYLMRGTPLMLQI 88

Query: 230 FMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLS 289
                 LP+       +D    A+L      +AY+ E+ RGG+QSIS+GQ+E A  LG +
Sbjct: 89  LFVYYALPIITDGAIQMDDATAAVLTFVLNYAAYLCEIFRGGIQSISRGQYEGAKVLGFT 148

Query: 290 YLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVR 337
           Y Q MR II+PQ+ KRV+P + N  I L KD+SL+ ++ M D+L I +
Sbjct: 149 YAQTMRKIILPQMFKRVLPPLANETINLLKDTSLVYVLAMNDILRITK 196


>gi|315657916|ref|ZP_07910790.1| amino acid ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus lugdunensis M23590]
 gi|315496952|gb|EFU85273.1| amino acid ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus lugdunensis M23590]
          Length = 497

 Score =  115 bits (289), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 75/227 (33%), Positives = 122/227 (53%), Gaps = 25/227 (11%)

Query: 156 SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACIT 215
           +FF  YG             G++ T+++S  G+II   LG L+AL + S I ++ +    
Sbjct: 284 NFFTKYGSF--------FVKGIVNTIILSAIGVIIGAVLGTLIALAKLSKIKIISWIAAA 335

Query: 216 FIELFRGVPLVTVLFMASIMLPLFLPDTW----DVDKLLRALLGVSAFASAYIAEVLRGG 271
           +IE+ RG PL+  +F+      +F   T     D+   +  ++ +   +SAYIAE++R G
Sbjct: 336 YIEIIRGTPLLVQVFI------VFFGTTAALGLDISAFICGIIALIINSSAYIAEIIRAG 389

Query: 272 LQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFD 331
           + ++ KGQ EAA  LGL+Y Q M+ +IMPQ IK ++P + N F+ L K+SS++S I    
Sbjct: 390 INAVDKGQTEAAQCLGLNYNQTMKNVIMPQAIKNILPALGNEFVTLIKESSIVSTI---- 445

Query: 332 LLGIVRVNF-SESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIE 377
             G+  V F S+     S  P T L+    ++++  FS+S     IE
Sbjct: 446 --GVSEVMFNSQVVQGISFDPFTPLLLAAGLYFVLTFSLSRIMTLIE 490


>gi|154174248|ref|YP_001407878.1| His/Glu/Gln/Arg/opine ABC transporter permease [Campylobacter
           curvus 525.92]
 gi|112803416|gb|EAU00760.1| amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine
           family [Campylobacter curvus 525.92]
          Length = 236

 Score =  115 bits (289), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 73/204 (35%), Positives = 119/204 (58%), Gaps = 15/204 (7%)

Query: 179 VTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPL 238
           VTL ++  GI I + LG LLA  +  NI +L +    +I++ RG P++  L + S+++  
Sbjct: 42  VTLGLTLGGICIGIALGFLLAFLKFLNIKILSFIIDEYIDILRGTPIILQLLIFSVVIF- 100

Query: 239 FLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLII 298
               TW  D    A++ +   +SAY+AE++R G+ S+ KGQ EAA ++GLSY   MR II
Sbjct: 101 ---ATWS-DNFYVAVIALGLNSSAYVAEIVRSGINSVDKGQMEAARAMGLSYSASMREII 156

Query: 299 MPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFI 358
            PQ IK ++P + N FI LFK++S++  I++ D      + F   ++ + +     +IF 
Sbjct: 157 FPQAIKNILPALGNEFISLFKETSVVGYISVMD------ITFQSKSFQAILYNPKPVIFA 210

Query: 359 GFVFWIFCFSISLYSVFIEKTLHK 382
           G V++I   S+ + S F+ KTL K
Sbjct: 211 GVVYYI---SVKILS-FLTKTLEK 230


>gi|294084529|ref|YP_003551287.1| ABC transporter permease [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292664102|gb|ADE39203.1| ABC transporter permease protein [Candidatus Puniceispirillum
           marinum IMCC1322]
          Length = 221

 Score =  115 bits (288), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 60/158 (37%), Positives = 99/158 (62%), Gaps = 2/158 (1%)

Query: 176 GLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIM 235
           GL  TL +    +I+ M LG+ +ALGR S    +R+A   F+E FR  P++  +      
Sbjct: 20  GLGGTLRLFIVCLILGMSLGLFVALGRRSRTKAVRWASTAFVEFFRNTPVLVQILWFYYA 79

Query: 236 LPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMR 295
           LP+  P   ++   + A+LG+S  ++AY AE+ RGG+QSI  GQ+EAA ++G++ LQ +R
Sbjct: 80  LPILAPV--EISPFIAAILGISLNSAAYSAEIYRGGIQSIEPGQWEAAKAIGMNGLQVLR 137

Query: 296 LIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLL 333
            I++PQ I+R++P + N  I +FK S+L S++   ++L
Sbjct: 138 RIVLPQAIRRIVPALTNRGIEIFKMSTLASVVAYVEML 175


>gi|148974813|ref|ZP_01811793.1| amino acid ABC transporter, permease protein [Vibrionales bacterium
           SWAT-3]
 gi|145965322|gb|EDK30571.1| amino acid ABC transporter, permease protein [Vibrionales bacterium
           SWAT-3]
          Length = 265

 Score =  115 bits (288), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 67/168 (39%), Positives = 103/168 (61%), Gaps = 4/168 (2%)

Query: 176 GLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIM 235
           GLLVT+ IS   ++ ++ +G+  AL RNS+  V R    +++EL R  PL+  +++   +
Sbjct: 63  GLLVTINISLISLVATLVIGLTTALLRNSHSVVGRTLATSYVELIRNTPLLVQIYL---L 119

Query: 236 LPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMR 295
             +F P    +D+   A+L ++ F  AY AE+ R GL SISKGQFEAA SLGLS      
Sbjct: 120 YFVFGPVI-GLDRFSTAVLALALFQGAYTAEIFRAGLNSISKGQFEAAQSLGLSKTYTYW 178

Query: 296 LIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSES 343
            +I+PQV++R +P + N  I L K+SS++S++ +FDL    R   SE+
Sbjct: 179 DVILPQVVQRTLPPLTNEVISLIKNSSIVSVMAIFDLTTEARNIVSET 226


>gi|282849230|ref|ZP_06258615.1| ABC transporter, permease protein [Veillonella parvula ATCC 17745]
 gi|282580934|gb|EFB86332.1| ABC transporter, permease protein [Veillonella parvula ATCC 17745]
          Length = 218

 Score =  115 bits (288), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 67/168 (39%), Positives = 100/168 (59%), Gaps = 4/168 (2%)

Query: 172 SLWGGLLVTLVISFFGI--IISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVL 229
           ++  GL VT  +S F I  I+S+P GIL+A+ R S +P++      F+ L RG PL+  +
Sbjct: 11  TIADGLKVT--VSLFCIVWILSIPGGILMAMLRLSKLPLVDKLVDAFVYLMRGTPLMLQI 68

Query: 230 FMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLS 289
                 LP+       +D    A+L      +AY+ E+ RGG+QSIS+GQ+E A  LG +
Sbjct: 69  LFVYYALPIITDGAIQMDDATAAVLTFVLNYAAYLCEIFRGGIQSISRGQYEGAKVLGFT 128

Query: 290 YLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVR 337
           Y Q MR II+PQ+ KRV+P + N  I L KD+SL+ ++ M D+L I +
Sbjct: 129 YAQTMRKIILPQMFKRVLPPLANETINLLKDTSLVYVLAMNDILRITK 176


>gi|258406275|ref|YP_003199017.1| polar amino acid ABC transporter, inner membrane subunit
           [Desulfohalobium retbaense DSM 5692]
 gi|257798502|gb|ACV69439.1| polar amino acid ABC transporter, inner membrane subunit
           [Desulfohalobium retbaense DSM 5692]
          Length = 234

 Score =  115 bits (288), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 71/212 (33%), Positives = 119/212 (56%), Gaps = 14/212 (6%)

Query: 175 GGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLF---- 230
           GGL ++++++  GI  +  +G++  L R S   + R   + +IE+ RG PL+ V+F    
Sbjct: 27  GGLAMSILLALGGIFGAFWVGLVFGLMRLSKKAIFRLPALVYIEIIRGTPLLMVIFWFYF 86

Query: 231 MASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSY 290
           +A I     LP+         AL+    F SAY+AE++R G+QS+ KGQ EAA   GLS+
Sbjct: 87  LAPIAFGKPLPEAAS------ALIAFIVFTSAYVAEIVRAGVQSLPKGQMEAARGSGLSH 140

Query: 291 LQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVT 350
           +Q M+ II+PQ ++ +IP  VN F+ L KD+SL  II + +L        +  T I+   
Sbjct: 141 VQSMQYIILPQALRNMIPSFVNQFVSLTKDTSLAYIIGVNELTRTA-TQVNNRTLIA--- 196

Query: 351 PTTGLIFIGFVFWIFCFSISLYSVFIEKTLHK 382
           PT   I I  ++++ C+ ++  S  +E+ + +
Sbjct: 197 PTEIFITIALIYFVVCYVLTALSRKLERQMSR 228


>gi|15673779|ref|NP_267954.1| glutamate ABC transporter permease protein [Lactococcus lactis
           subsp. lactis Il1403]
 gi|281492390|ref|YP_003354370.1| polar amino acid ABC transporter permease [Lactococcus lactis
           subsp. lactis KF147]
 gi|12724822|gb|AAK05895.1|AE006409_5 glutamate ABC transporter permease protein [Lactococcus lactis
           subsp. lactis Il1403]
 gi|281376054|gb|ADA65545.1| Polar amino acid ABC transporter, permease protein [Lactococcus
           lactis subsp. lactis KF147]
 gi|326407285|gb|ADZ64356.1| polar amino acid ABC transporter, permease protein [Lactococcus
           lactis subsp. lactis CV56]
          Length = 228

 Score =  115 bits (288), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 71/220 (32%), Positives = 127/220 (57%), Gaps = 16/220 (7%)

Query: 176 GLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVL-----F 230
           G++VT++IS F ++I   LGI+ AL + S I  LR+    +IE+FRG P++  +      
Sbjct: 16  GMIVTILISAFVVLIGTLLGIVTALAKISKIAPLRWLANIYIEIFRGTPMLVQIMLGFGL 75

Query: 231 MASIMLPLFLPD--TWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGL 288
           M S+ LP F       D+ +L+  ++ +S  + AY+AE++R G++++  GQ EAA SLG+
Sbjct: 76  MGSLSLPTFQVGILQQDLGRLIPGIIVISLNSGAYMAEIVRAGIEAVPLGQKEAAYSLGI 135

Query: 289 SYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISS 348
              Q M  +I+PQ ++ ++P + N F+ + KDSSL+  I + ++       F+ +  +++
Sbjct: 136 RPRQAMATVILPQALRNILPAVGNEFVTIIKDSSLLYTIGVMEV-------FNGAQTVAN 188

Query: 349 VTPTT--GLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
           +T  T   ++F+   +++  F +S   V  EK L KG  K
Sbjct: 189 LTYQTISPMLFVALYYFVVTFVVSRLLVLFEKKLGKGYAK 228


>gi|120602869|ref|YP_967269.1| polar amino acid ABC transporter, inner membrane subunit
           [Desulfovibrio vulgaris DP4]
 gi|120563098|gb|ABM28842.1| amino acid ABC transporter membrane protein, PAAT family
           [Desulfovibrio vulgaris DP4]
 gi|311233446|gb|ADP86300.1| polar amino acid ABC transporter, inner membrane subunit
           [Desulfovibrio vulgaris RCH1]
          Length = 262

 Score =  115 bits (287), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 66/168 (39%), Positives = 102/168 (60%), Gaps = 4/168 (2%)

Query: 176 GLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIM 235
           G+LVT  ++ F II S+P+G++  LGR S    +     T++E+ RG+PL+  LF     
Sbjct: 61  GILVTFQVTVFSIICSIPIGLITGLGRLSRNRGINLVASTYVEVVRGIPLLVQLFYIYYA 120

Query: 236 LPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMR 295
           L  FL     V  +L A++ +S    AY+ EV R G+++I KGQ EAA SLG + ++ M 
Sbjct: 121 LGRFL----KVPDMLAAIIALSVCYGAYMGEVFRAGIEAIPKGQTEAARSLGFNRVETMF 176

Query: 296 LIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSES 343
           L+++PQ  + ++P + N FI + KD+SL+SII + D+L   R   SES
Sbjct: 177 LVVLPQAWRTILPPVGNEFIAMLKDTSLVSIIAVADILRRGREFASES 224


>gi|269797367|ref|YP_003311267.1| polar amino acid ABC transporter inner membrane subunit
           [Veillonella parvula DSM 2008]
 gi|269093996|gb|ACZ23987.1| polar amino acid ABC transporter, inner membrane subunit
           [Veillonella parvula DSM 2008]
          Length = 218

 Score =  115 bits (287), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 67/168 (39%), Positives = 100/168 (59%), Gaps = 4/168 (2%)

Query: 172 SLWGGLLVTLVISFFGI--IISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVL 229
           ++  GL VT  +S F I  I+S+P GIL+A+ R S +P++      F+ L RG PL+  +
Sbjct: 11  TIADGLKVT--VSLFCIVWILSIPGGILMAMLRLSKLPLVDKFVDAFVYLMRGTPLMLQI 68

Query: 230 FMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLS 289
                 LP+       +D    A+L      +AY+ E+ RGG+QSIS+GQ+E A  LG +
Sbjct: 69  LFVYYALPIITDGAIQMDDATAAVLTFVLNYAAYLCEIFRGGIQSISRGQYEGAKVLGFT 128

Query: 290 YLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVR 337
           Y Q MR II+PQ+ KRV+P + N  I L KD+SL+ ++ M D+L I +
Sbjct: 129 YAQTMRKIILPQMFKRVLPPLANETINLLKDTSLVYVLAMNDILRITK 176


>gi|160933930|ref|ZP_02081317.1| hypothetical protein CLOLEP_02792 [Clostridium leptum DSM 753]
 gi|156866603|gb|EDO59975.1| hypothetical protein CLOLEP_02792 [Clostridium leptum DSM 753]
          Length = 213

 Score =  115 bits (287), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 75/215 (34%), Positives = 123/215 (57%), Gaps = 18/215 (8%)

Query: 164 LGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGV 223
           +   ++ T +  G L+TL I F  ++ ++PLG+L++LGR S I ++ +    FI + RG 
Sbjct: 1   MNYQVLLTEMLQGTLMTLRIFFSTLVFALPLGLLVSLGRMSKIKIINWPVRLFILIMRGT 60

Query: 224 PLV-TVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEA 282
           PL+  +LF+   + PLF      +D+++ A +  +   +AY AE+ RGG++SI  GQ+EA
Sbjct: 61  PLMLQLLFVFYGLKPLF---GIQLDRVIAAQVAFALNYAAYFAEIYRGGIESIPDGQYEA 117

Query: 283 ANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSE 342
           A  LG +  Q    II+PQV+KR+IP + N FI L KD+SL  +I + +LL +       
Sbjct: 118 AKVLGFNKKQTFFRIILPQVVKRIIPPMGNEFITLVKDTSLAQVIAVVELLKVT------ 171

Query: 343 STWISSVTPTTGLIFIGFVFWIF-------CFSIS 370
           + W+SS       + I  VF++        CF+I+
Sbjct: 172 NNWVSSAVSMVPFV-IAAVFYLVMNGVVTRCFTIA 205


>gi|269963237|ref|ZP_06177571.1| amino acid ABC transporter, permease protein [Vibrio harveyi 1DA3]
 gi|269832042|gb|EEZ86167.1| amino acid ABC transporter, permease protein [Vibrio harveyi 1DA3]
          Length = 306

 Score =  115 bits (287), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 84/236 (35%), Positives = 129/236 (54%), Gaps = 46/236 (19%)

Query: 176 GLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVP-----LVTVLF 230
           GL+ TL +S +GII ++ LG LL L R S+   LR     FI+L R +P      +   F
Sbjct: 77  GLISTLRLSLWGIIFALVLGTLLGLARFSDTVWLRTPANAFIQLVRNIPPLVFVFIFYFF 136

Query: 231 MASIMLPL---------------------FLP-DTWDVDKLLRALLGVSAFASAYIAEVL 268
           +++ ++PL                     F P + W+   L   +L V   +SAYIAEV+
Sbjct: 137 ISNQLIPLLGLEDLLRNYRGEPNAVQHFFFGPANLWE--NLASGVLCVGLLSSAYIAEVV 194

Query: 269 RGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIIN 328
           R GLQS+ KGQ+EAA+SLGLS   K R II PQV+K + P +    I L KD+S++S+I+
Sbjct: 195 RAGLQSVDKGQWEAADSLGLSRWVKYRFIIAPQVLKAITPALAGQTISLVKDTSIVSLIS 254

Query: 329 MFDLLGIVRVNFSESTWI-SSVTPTTGLIF-----IGFVFWIFCFSISLYSVFIEK 378
           +            E T++ + +  ++G IF     +GFV+++ CF +S++  +IEK
Sbjct: 255 I-----------QEMTFVGTEMANSSGYIFEIWLIVGFVYFLICFGLSMFFRYIEK 299


>gi|315638556|ref|ZP_07893732.1| His/Glu/Gln/Arg/opine amino acid ABC superfamily ATP binding
           cassette transporter, permease protein [Campylobacter
           upsaliensis JV21]
 gi|315481400|gb|EFU72028.1| His/Glu/Gln/Arg/opine amino acid ABC superfamily ATP binding
           cassette transporter, permease protein [Campylobacter
           upsaliensis JV21]
          Length = 246

 Score =  115 bits (287), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 69/206 (33%), Positives = 115/206 (55%), Gaps = 12/206 (5%)

Query: 179 VTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPL 238
           VT++++F  + I +  G +LAL R S   VL +    FI++ RG P++  L + + ++  
Sbjct: 53  VTILLTFCAVCIGLVFGFILALIRFSPFGVLNFIVDEFIDIIRGTPVILQLMIFAFVIFT 112

Query: 239 FLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLII 298
           FL      D L  A+L +   +SAYIAE++R G+ S+ KGQ EAA ++GL Y   MR II
Sbjct: 113 FL------DNLYAAILALGLNSSAYIAEIVRSGINSVDKGQMEAARAMGLDYQSTMREII 166

Query: 299 MPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFI 358
           +PQ +K ++P + N FI LFK++S++  I++ D      +     +  + +     +IF 
Sbjct: 167 LPQALKNILPALANEFISLFKETSVVGFISVVD------ITMQSKSLQAVLYNPKPIIFT 220

Query: 359 GFVFWIFCFSISLYSVFIEKTLHKGS 384
           G V+++     SL    +EK L+K  
Sbjct: 221 GLVYYVSVKIFSLGVRLLEKRLNKND 246


>gi|313894065|ref|ZP_07827631.1| ABC transporter, permease protein [Veillonella sp. oral taxon 158
           str. F0412]
 gi|313441629|gb|EFR60055.1| ABC transporter, permease protein [Veillonella sp. oral taxon 158
           str. F0412]
          Length = 218

 Score =  115 bits (287), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 67/168 (39%), Positives = 100/168 (59%), Gaps = 4/168 (2%)

Query: 172 SLWGGLLVTLVISFFGI--IISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVL 229
           ++  GL VT  +S F I  I+S+P GIL+A+ R S +P++      F+ L RG PL+  +
Sbjct: 11  TIADGLKVT--VSLFCIVWILSIPGGILMAMLRLSKLPLVDKLVDAFVYLMRGTPLMLQI 68

Query: 230 FMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLS 289
                 LP+       +D    A+L      +AY+ E+ RGG+QSIS+GQ+E A  LG +
Sbjct: 69  LFVYYALPIITDGAIQMDDATAAVLTFVLNYAAYLCEIFRGGIQSISRGQYEGAKVLGFT 128

Query: 290 YLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVR 337
           Y Q MR II+PQ+ KRV+P + N  I L KD+SL+ ++ M D+L I +
Sbjct: 129 YSQTMRKIILPQMFKRVLPPLANETINLLKDTSLVYVLAMNDILRITK 176


>gi|46579648|ref|YP_010456.1| His/Glu/Gln/Arg/opine ABC transporter permease [Desulfovibrio
           vulgaris str. Hildenborough]
 gi|46449063|gb|AAS95715.1| amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine
           family [Desulfovibrio vulgaris str. Hildenborough]
          Length = 256

 Score =  115 bits (287), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 66/168 (39%), Positives = 102/168 (60%), Gaps = 4/168 (2%)

Query: 176 GLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIM 235
           G+LVT  ++ F II S+P+G++  LGR S    +     T++E+ RG+PL+  LF     
Sbjct: 55  GILVTFQVTVFSIICSIPIGLITGLGRLSRNRGINLVASTYVEVVRGIPLLVQLFYIYYA 114

Query: 236 LPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMR 295
           L  FL     V  +L A++ +S    AY+ EV R G+++I KGQ EAA SLG + ++ M 
Sbjct: 115 LGRFL----KVPDMLAAIIALSVCYGAYMGEVFRAGIEAIPKGQTEAARSLGFNRVETMF 170

Query: 296 LIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSES 343
           L+++PQ  + ++P + N FI + KD+SL+SII + D+L   R   SES
Sbjct: 171 LVVLPQAWRTILPPVGNEFIAMLKDTSLVSIIAVADILRRGREFASES 218


>gi|297531646|ref|YP_003672921.1| polar amino acid ABC transporter inner membrane protein
           [Geobacillus sp. C56-T3]
 gi|297254898|gb|ADI28344.1| polar amino acid ABC transporter, inner membrane subunit
           [Geobacillus sp. C56-T3]
          Length = 218

 Score =  115 bits (287), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 75/206 (36%), Positives = 113/206 (54%), Gaps = 13/206 (6%)

Query: 176 GLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASI- 234
           GLL T+ +S  GII  + LG+ + LG+ S   ++R     +I  FRG PLV  + +    
Sbjct: 18  GLLATIGVSLAGIIFGLILGLFIGLGKMSTNRLVRLPFSWYINFFRGTPLVVQILLVHFG 77

Query: 235 MLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKM 294
           ++PLF      +  L  +L   S  ++AY+AE+ R G+QSI KGQ EAA SLG+++ Q M
Sbjct: 78  VMPLFFAQPNGIVSLAVSL---SLNSAAYVAEIFRAGIQSIDKGQMEAARSLGMTHAQAM 134

Query: 295 RLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLL--GIVRVNFSESTWISSVTPT 352
           R II+PQ +KR+IP   N FI L KDSSL  +I   +++  G          W   +T  
Sbjct: 135 RYIILPQALKRMIPPFANEFIVLIKDSSLGMVIAAPEIMYWGKAAAGEYYRVWEPYLT-- 192

Query: 353 TGLIFIGFVFWIFCFSISLYSVFIEK 378
                + F++ I   S+S  S ++E+
Sbjct: 193 -----VAFIYLILTLSLSKLSHYLER 213


>gi|167628827|ref|YP_001679326.1| glutamine abc transporter, permease protein [Heliobacterium
           modesticaldum Ice1]
 gi|167591567|gb|ABZ83315.1| glutamine abc transporter, permease protein [Heliobacterium
           modesticaldum Ice1]
          Length = 221

 Score =  115 bits (287), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 57/153 (37%), Positives = 97/153 (63%), Gaps = 2/153 (1%)

Query: 180 TLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLF 239
           T+ ++   ++I   +G+ +AL R S+  +LR+    + ++ RG PL+  +F+  +  P  
Sbjct: 22  TVKVTAISVMIGTVIGLFIALARLSHWRLLRWVAAIYTDVIRGTPLLVQIFIVHLGAPKL 81

Query: 240 LPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIM 299
           +  +  +  +   L+ +S  + AY+AE+ R G+QSI KGQ EA+ SLG+SY Q MR +I+
Sbjct: 82  IGQS--LPAMTSGLIALSVNSGAYVAEIFRAGIQSIDKGQMEASRSLGMSYGQAMRFVIL 139

Query: 300 PQVIKRVIPGIVNTFIGLFKDSSLISIINMFDL 332
           PQ  +RVIP + N FI + KDSSL+S+I++ +L
Sbjct: 140 PQAFRRVIPPLGNEFIAMLKDSSLVSVISLPEL 172


>gi|292669477|ref|ZP_06602903.1| glutamine ABC superfamily ATP binding cassette transporter,
           membrane protein [Selenomonas noxia ATCC 43541]
 gi|292648930|gb|EFF66902.1| glutamine ABC superfamily ATP binding cassette transporter,
           membrane protein [Selenomonas noxia ATCC 43541]
          Length = 223

 Score =  115 bits (287), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 68/208 (32%), Positives = 112/208 (53%), Gaps = 17/208 (8%)

Query: 176 GLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIM 235
           G  VT+ I+     I   +G+++ + R S++ +LR     ++E FRG PL+  +F+    
Sbjct: 22  GAGVTIQITVLSTAIGFVIGLIVGVARISHVRLLRMLAEVYVEFFRGTPLLVQIFLFYFA 81

Query: 236 LPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMR 295
           LP+       +D  + A+      + AY+AE+ R G+QS+  GQ EA  SLG+++LQ MR
Sbjct: 82  LPVLTGQR--IDPFIAAISACGINSGAYVAEIFRAGIQSVDDGQMEAGRSLGMTWLQTMR 139

Query: 296 LIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDL-----LGIVRVNFSESTWISSVT 350
            II+PQ  KRVIP + N FI + KDSSL+S+I   +L     L I +   S   W+S   
Sbjct: 140 YIIVPQAFKRVIPPLGNEFIAMLKDSSLVSVIGFEELTRRGQLIIAKTYGSFEIWMS--- 196

Query: 351 PTTGLIFIGFVFWIFCFSISLYSVFIEK 378
                  +  ++ +   +IS +  ++E+
Sbjct: 197 -------VAVIYLVMTLTISRFVAYLER 217


>gi|315641164|ref|ZP_07896242.1| glutamine ABC superfamily ATP binding cassette transporter,
           permease protein [Enterococcus italicus DSM 15952]
 gi|315483088|gb|EFU73606.1| glutamine ABC superfamily ATP binding cassette transporter,
           permease protein [Enterococcus italicus DSM 15952]
          Length = 231

 Score =  115 bits (287), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 71/216 (32%), Positives = 120/216 (55%), Gaps = 13/216 (6%)

Query: 176 GLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMAS-- 233
           G ++T++IS   I+     G++LAL + S+I  L++   T+I +FRG P++  + +A+  
Sbjct: 16  GSVITMMISVVTIVFGTVFGVILALMKRSSIAPLKWVASTYIAVFRGTPMLVQILIANGL 75

Query: 234 ----IMLPLFLPDTWDVD--KLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLG 287
               + LP        +D  +L   +L +S  + AY+AE++RGG+ +++ GQFEAA SLG
Sbjct: 76  FHQVVTLPPVTIGVLQIDFSRLFPGILALSLNSGAYVAEIVRGGINAVNSGQFEAARSLG 135

Query: 288 LSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWIS 347
           ++  Q MR II PQ ++ ++P + N FI L KDSSL+S + +++L+     N ++    S
Sbjct: 136 MNGTQTMRYIIFPQALRNILPSLGNEFIVLIKDSSLLSTLGIYELM-----NSAQIVITS 190

Query: 348 SVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKG 383
           S  P   L     +++   F  S      E  L KG
Sbjct: 191 SFIPLKPLYVAAVLYFFMTFVTSQLLKLWENKLGKG 226


>gi|186683156|ref|YP_001866352.1| polar amino acid ABC transporter inner membrane subunit [Nostoc
           punctiforme PCC 73102]
 gi|186465608|gb|ACC81409.1| polar amino acid ABC transporter, inner membrane subunit [Nostoc
           punctiforme PCC 73102]
          Length = 501

 Score =  114 bits (286), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 99/165 (60%), Gaps = 3/165 (1%)

Query: 172 SLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFM 231
           +L  G LVTL ++   ++  +  G L+ + R S I  +R+    +++ FRG PL+  +FM
Sbjct: 288 TLLQGALVTLQLTIISVVFGLIGGSLIGIVRLSRITPVRWLARAYVDFFRGTPLLVQIFM 347

Query: 232 ASIMLPLFLPD---TWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGL 288
               LP    +   T+  D+L   ++ +S   +AY AEV+R G+QSI  GQ EAA SLGL
Sbjct: 348 IYFGLPAISQEIGFTFTFDRLTAGIIALSLNNAAYTAEVVRAGIQSIETGQAEAAQSLGL 407

Query: 289 SYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLL 333
           S +Q M  +I PQ  +R+IP + N FI L KD+SL+S+I + +LL
Sbjct: 408 SSIQTMSYVIFPQAFRRMIPPLGNDFISLLKDTSLVSVIGLEELL 452


>gi|322833421|ref|YP_004213448.1| polar amino acid ABC transporter inner membrane subunit [Rahnella
           sp. Y9602]
 gi|321168622|gb|ADW74321.1| polar amino acid ABC transporter, inner membrane subunit [Rahnella
           sp. Y9602]
          Length = 249

 Score =  114 bits (286), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 67/212 (31%), Positives = 121/212 (57%), Gaps = 6/212 (2%)

Query: 175 GGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASI 234
           GG+L TL+IS   ++ ++P+GILL L R S    L +    ++   RG+PL+ V+F    
Sbjct: 26  GGILCTLLISLLAVLFALPVGILLGLARLSPFRWLSWPAACWVYGLRGIPLLMVVFWTYF 85

Query: 235 MLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKM 294
            +PL +    ++      L  +  + SAYIAE++RGG+Q++  GQ+EAA +LG+SY + +
Sbjct: 86  CVPLLIGH--NISGFSTMLCTLVIYESAYIAEIVRGGIQALPGGQYEAARALGMSYFKTL 143

Query: 295 RLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTG 354
           RLII+PQ +   +P +V+  + + KDS+L  +IN+ +L      N   +  ++       
Sbjct: 144 RLIILPQALYNTLPSLVSQLVSIIKDSTLGYVINVPEL--TFAANQVNNQLLTKPFQVFA 201

Query: 355 LIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
           ++ IG  ++I CFS++  +  +E  + +  + 
Sbjct: 202 IVAIG--YYIICFSLTWLANKLEARITRKRQN 231


>gi|227509839|ref|ZP_03939888.1| glutamine ABC superfamily ATP binding cassette transporter,
           permease protein [Lactobacillus brevis subsp.
           gravesensis ATCC 27305]
 gi|227190763|gb|EEI70830.1| glutamine ABC superfamily ATP binding cassette transporter,
           permease protein [Lactobacillus brevis subsp.
           gravesensis ATCC 27305]
          Length = 235

 Score =  114 bits (286), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 70/213 (32%), Positives = 124/213 (58%), Gaps = 11/213 (5%)

Query: 176 GLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIM 235
           G  VT+++S   I++S   G++L + R   I  L       I++ R +PL+ ++F     
Sbjct: 19  GAWVTILVSVCSIVLSYIFGVILGVTRYVQIKYLSAIVGFVIDIIRNLPLILIIFFTYFG 78

Query: 236 LPL--FLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQK 293
           LP   F PD      +  +++ ++ F +A +AE++R G+ SI  GQ E A + GLSY Q 
Sbjct: 79  LPHLGFKPD-----PIWASVIAMAVFEAAMVAEIVRAGIASIPTGQMEGARANGLSYWQA 133

Query: 294 MRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTT 353
           +  I++PQ I+ +IP IV+ FI L KD+SL +II + DL+   ++ + ++T  +   P  
Sbjct: 134 LWYIVLPQAIRNMIPAIVSQFISLVKDTSLATIIVLPDLMNHAQIIYGQNT--NYTIPM- 190

Query: 354 GLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
             + +  +++I C+S+SL+S ++EK +  G+KK
Sbjct: 191 -FLALAVMYFIVCYSLSLFSKYLEKRIGGGNKK 222


>gi|297619594|ref|YP_003707699.1| polar amino acid ABC transporter, inner membrane subunit
           [Methanococcus voltae A3]
 gi|297378571|gb|ADI36726.1| polar amino acid ABC transporter, inner membrane subunit
           [Methanococcus voltae A3]
          Length = 232

 Score =  114 bits (286), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 82/235 (34%), Positives = 130/235 (55%), Gaps = 21/235 (8%)

Query: 154 IFSFFVLYG--------GLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSN 205
           ++ F VL+G         L +SIV   L+ G L+TL I+ F II+ + LG+ + +GR S+
Sbjct: 1   MYGFLVLFGENMSGFDVNLFISIVP-RLFEGALMTLKITVFSIILGIVLGVFVGVGRISS 59

Query: 206 IPVLRYACITFIELFRGVPLVTVLFMASIMLPLF-LPDTW-DVDKLLRALLGVSAFASAY 263
             + R     +IEL RG P+     +  IM+  F LPD   ++D  L  +L +   + AY
Sbjct: 60  NFIYRSFSSVYIELIRGTPM-----LVQIMIIYFGLPDLGINLDAFLAGVLALGLNSGAY 114

Query: 264 IAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSL 323
           I E+++ G+ S+  GQ EAA SLG++Y Q MR II+PQ  + V+P + N FI L KDSSL
Sbjct: 115 IGEIIKAGILSVHHGQMEAARSLGMNYFQAMRHIILPQAFRNVLPALGNEFIILLKDSSL 174

Query: 324 ISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEK 378
           +S+I + +LL +      +    S+    T L+ +   + +    +S   ++IEK
Sbjct: 175 LSVIAIVELLRV-----GDQVRGSTYNAWTPLLGVALFYLLMTIPLSRLVLYIEK 224


>gi|254509082|ref|ZP_05121185.1| ABC-type glutamine transport system, permease component [Vibrio
           parahaemolyticus 16]
 gi|219548015|gb|EED25037.1| ABC-type glutamine transport system, permease component [Vibrio
           parahaemolyticus 16]
          Length = 246

 Score =  114 bits (286), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 60/158 (37%), Positives = 101/158 (63%), Gaps = 2/158 (1%)

Query: 175 GGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASI 234
            G   T+ +S   ++ +M +G+L+AL   SN P+L+     ++E+ R +P++ +L     
Sbjct: 43  AGFNDTIQVSLLSMLFAMTIGLLVALPALSNSPILKGINRLYVEIIRSIPVLVLLLWVYY 102

Query: 235 MLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKM 294
            +P  L  +  +D     ++ ++   SA++AEV RGG+Q+IS+GQ EAA SLGLSY QKM
Sbjct: 103 GMPTLLDVS--LDHFWAGVIALTVAESAFMAEVFRGGIQAISRGQHEAAESLGLSYWQKM 160

Query: 295 RLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDL 332
           RL+I+PQ  ++++P + N F+ + K SSL+S+I + DL
Sbjct: 161 RLVILPQAFRQILPPLGNQFVYILKMSSLVSVIGLSDL 198


>gi|312797282|ref|YP_004030204.1| glutamate/aspartate transport system permease protein gltK
           [Burkholderia rhizoxinica HKI 454]
 gi|312169057|emb|CBW76060.1| Glutamate/aspartate transport system permease protein gltK
           [Burkholderia rhizoxinica HKI 454]
          Length = 226

 Score =  114 bits (286), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 71/221 (32%), Positives = 124/221 (56%), Gaps = 20/221 (9%)

Query: 172 SLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFM 231
           +LW G ++TL I+   I++ +  G LLAL R S    L +    ++ LFR +PLV VL  
Sbjct: 16  TLWTGAVITLQITVLAIVVGIVWGTLLALMRLSGFKPLEWFARGYVTLFRSIPLVMVLLW 75

Query: 232 ASIMLPLFLPDTWDVD-----KLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSL 286
             +++P  L    DV      +L+ A++  S F +AY +E++R G+Q++ +GQ  AA++L
Sbjct: 76  FFLLVPQLLQRLLDVSPDVDIRLVSAMVAFSLFEAAYYSEIIRAGIQAVPRGQLSAASAL 135

Query: 287 GLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGI-VRVNFSESTW 345
           G++Y Q MRLI++PQ ++ ++P ++   I LF+D+SL+ +I++ D       V   + T 
Sbjct: 136 GMTYGQGMRLIVLPQALRAMVPLLLTQAIVLFQDTSLVYVISVADFFQTAANVGDRDGTI 195

Query: 346 ISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
           +  V      +F G V+++ C         +  +L KG +K
Sbjct: 196 VEMV------LFAGAVYFVVC--------VVASSLVKGLQK 222


>gi|153832989|ref|ZP_01985656.1| amino acid ABC transporter, permease protein [Vibrio harveyi HY01]
 gi|148870710|gb|EDL69616.1| amino acid ABC transporter, permease protein [Vibrio harveyi HY01]
          Length = 306

 Score =  114 bits (286), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 84/243 (34%), Positives = 128/243 (52%), Gaps = 46/243 (18%)

Query: 176 GLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVP----------- 224
           GL+ TL +S +GI+ ++ LG LL L R S+   LR     FI+L R +P           
Sbjct: 77  GLISTLRLSVWGIVFALVLGTLLGLARFSDSVWLRTPANAFIQLVRNIPPLVFVFIFYFF 136

Query: 225 ----LVTVLFMASIMLP-----------LFLP-DTWDVDKLLRALLGVSAFASAYIAEVL 268
               L+ +L +  I+              F P + W+   L   +L V   +SAYIAEV+
Sbjct: 137 ISNQLIPLLGLEDILRNYRGEPNAVQSFFFGPANLWE--NLASGVLCVGLLSSAYIAEVV 194

Query: 269 RGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIIN 328
           R GLQSI KGQ+EAA+SLGLS   K R +I PQV+K + P +    I L KD+S++S+I+
Sbjct: 195 RAGLQSIDKGQWEAADSLGLSSWVKYRFVIAPQVLKAITPALAGQTISLVKDTSIVSLIS 254

Query: 329 MFDLLGIVRVNFSESTWI-SSVTPTTGLIF-----IGFVFWIFCFSISLYSVFIEKTLHK 382
           +            E T++ + +  ++G IF     +GFV+++ CF +S++  +IEK    
Sbjct: 255 I-----------QEMTFVGTEMANSSGYIFEIWLIVGFVYFLICFGLSMFFRYIEKKSES 303

Query: 383 GSK 385
            S 
Sbjct: 304 NSN 306


>gi|319892895|ref|YP_004149770.1| Glutamate ABC transporter, periplasmic glutamine- binding protein
           [Staphylococcus pseudintermedius HKU10-03]
 gi|317162591|gb|ADV06134.1| Glutamate ABC transporter, periplasmic glutamine- binding protein
           [Staphylococcus pseudintermedius HKU10-03]
          Length = 486

 Score =  114 bits (285), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 75/227 (33%), Positives = 122/227 (53%), Gaps = 25/227 (11%)

Query: 156 SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACIT 215
           SF   YG   L+        G+  T+VIS  G+++    G + AL + S I  L++    
Sbjct: 273 SFLTKYGAFFLT--------GIKSTIVISLIGVVLGAVFGSMFALMKISTIRPLKWFASA 324

Query: 216 FIELFRGVPLVTVLFMASIMLPLFLPDTW----DVDKLLRALLGVSAFASAYIAEVLRGG 271
           +IE  RG PL+  +F+      +F   T     D+   +   + +    SAYIAE++R G
Sbjct: 325 YIEFLRGTPLLVQVFL------VFFGTTAVLGLDISAFICGAIALVINCSAYIAEIIRAG 378

Query: 272 LQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFD 331
           + ++ KGQ EAA SLGLSY Q M+ +IMPQ IK+++P + N F+ + K+SS++S+I    
Sbjct: 379 INAVDKGQMEAARSLGLSYSQTMKSVIMPQAIKKILPALGNEFVTVIKESSIVSVI---- 434

Query: 332 LLGIVRVNF-SESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIE 377
             G+  + F ++    +S  P T L+    +F+I  F++S    F+E
Sbjct: 435 --GVSEIMFNAQVVQGASFDPFTPLLIAAVLFFILTFTLSRLMSFLE 479


>gi|116618335|ref|YP_818706.1| ABC-type amino acid transport system, pemease component
           [Leuconostoc mesenteroides subsp. mesenteroides ATCC
           8293]
 gi|116097182|gb|ABJ62333.1| amino acid ABC transporter membrane protein, PAAT family
           [Leuconostoc mesenteroides subsp. mesenteroides ATCC
           8293]
          Length = 219

 Score =  114 bits (285), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 71/154 (46%), Positives = 94/154 (61%), Gaps = 4/154 (2%)

Query: 176 GLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPL-VTVLFMASI 234
           GLL TL+ S  G++     G+++ALGR S  PV+     T+I LFRG PL V +L     
Sbjct: 18  GLLYTLLFSLCGVVFGTIFGLIIALGRMSKNPVISGIFKTYIGLFRGTPLFVQILITNFG 77

Query: 235 MLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKM 294
           ++P     +   +  +   L +S  A+AYIAE  R G+QSIS+GQ EAA +LGLS    M
Sbjct: 78  VVPAIFGHS---NPYIAGALSLSLNAAAYIAETFRSGIQSISEGQREAARTLGLSQFDTM 134

Query: 295 RLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIIN 328
           R II+PQ IK VIP + N FI L KDSSL+S I+
Sbjct: 135 RFIIVPQAIKIVIPALGNEFISLIKDSSLVSAIS 168


>gi|299820601|ref|ZP_07052491.1| amino acid ABC superfamily ATP binding cassette transporter,
           membrane protein [Listeria grayi DSM 20601]
 gi|299818096|gb|EFI85330.1| amino acid ABC superfamily ATP binding cassette transporter,
           membrane protein [Listeria grayi DSM 20601]
          Length = 213

 Score =  114 bits (285), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 68/162 (41%), Positives = 98/162 (60%), Gaps = 3/162 (1%)

Query: 172 SLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFM 231
           +L  GL  TL + F+ +++S+PLG ++ALG  S I  LR+   T++ + RG PL+  L  
Sbjct: 10  ALLEGLKTTLQVFFYTLLLSIPLGAIIALGNVSKIRPLRWIIDTYVWIMRGTPLLLQLIF 69

Query: 232 ASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYL 291
                P F      +++    L       +AY AE+ RGG+ SI KGQ+E+A  LGLSY 
Sbjct: 70  IYYGAPYF---HLILERYEAVLFAFVLNYAAYFAEIFRGGILSIEKGQYESAKVLGLSYG 126

Query: 292 QKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLL 333
           Q +R I++PQVIKRV+P I N  I L KDSSL+ ++ + DLL
Sbjct: 127 QTVRKIVLPQVIKRVLPAIGNEVINLVKDSSLVYVLGLGDLL 168


>gi|90413902|ref|ZP_01221888.1| hypothetical amino acid ABC transporter, permease protein
           [Photobacterium profundum 3TCK]
 gi|90325086|gb|EAS41596.1| hypothetical amino acid ABC transporter, permease protein
           [Photobacterium profundum 3TCK]
          Length = 315

 Score =  114 bits (285), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 97/157 (61%), Gaps = 4/157 (2%)

Query: 176 GLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIM 235
           GL VTL IS   +  ++ +G++  L R SN PV +     ++E+ RG PL+  +F+    
Sbjct: 116 GLWVTLKISVISLFFAVIIGLVAGLMRISNNPVTKNLSFLYVEIIRGTPLLVQIFI---- 171

Query: 236 LPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMR 295
           +  FL   +D+++    ++ +S F  AYIAE++R G+QSI  GQ EAA SLG++Y + M 
Sbjct: 172 VYFFLGTIFDLERFTAGVVALSVFTGAYIAEIIRSGIQSIPPGQMEAARSLGMNYPKAMA 231

Query: 296 LIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDL 332
            +I+PQ  KR +P +    I L KDSSL+S+I++ DL
Sbjct: 232 YVILPQAFKRTLPPMAGQLITLIKDSSLVSVISITDL 268


>gi|317046629|ref|YP_004114277.1| polar amino acid ABC transporter inner membrane subunit [Pantoea
           sp. At-9b]
 gi|316948246|gb|ADU67721.1| polar amino acid ABC transporter, inner membrane subunit [Pantoea
           sp. At-9b]
          Length = 251

 Score =  114 bits (285), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 65/212 (30%), Positives = 120/212 (56%), Gaps = 6/212 (2%)

Query: 175 GGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASI 234
           GG+L TL+IS   ++ + P+GILL L R S    L +    ++ L RG+PL+ V+F    
Sbjct: 26  GGVLCTLLISLLAVLFAFPVGILLGLARLSPWRWLSWPATCWVYLLRGIPLMMVVFWTYF 85

Query: 235 MLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKM 294
            +PL +    ++      L  +  + SAYIAE++RGG+Q++  GQ+EAA +LG+ +++ +
Sbjct: 86  CVPLLIGH--NISGFSTMLCTLVIYESAYIAEIVRGGIQALPHGQYEAARALGMGHIKTL 143

Query: 295 RLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTG 354
           RL+I+PQ +   +P +V+  + + KDS+L  +IN+ +L      N   +  ++   P   
Sbjct: 144 RLVILPQALFNTLPSLVSQLVSIIKDSTLGYVINVPEL--TFAANQVSNQLLTK--PFQV 199

Query: 355 LIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
              +   ++I CFS++  +  +E  L +  ++
Sbjct: 200 FAIVALSYYIICFSLTWLANQLEARLAQKRRQ 231


>gi|261420863|ref|YP_003254545.1| polar amino acid ABC transporter inner membrane subunit
           [Geobacillus sp. Y412MC61]
 gi|319768534|ref|YP_004134035.1| polar amino acid ABC transporter inner membrane protein
           [Geobacillus sp. Y412MC52]
 gi|261377320|gb|ACX80063.1| polar amino acid ABC transporter, inner membrane subunit
           [Geobacillus sp. Y412MC61]
 gi|317113400|gb|ADU95892.1| polar amino acid ABC transporter, inner membrane subunit
           [Geobacillus sp. Y412MC52]
          Length = 218

 Score =  114 bits (284), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 75/206 (36%), Positives = 113/206 (54%), Gaps = 13/206 (6%)

Query: 176 GLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASI- 234
           GLL T+ +S  GII  + LG+ + LG+ S   ++R     +I  FRG PLV  + +    
Sbjct: 18  GLLATIGVSLAGIIFGLILGLFIGLGKMSTNLLVRLPFSWYINFFRGTPLVVQILLVHFG 77

Query: 235 MLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKM 294
           ++PLF      +  L  +L   S  ++AY+AE+ R G+QSI KGQ EAA SLG+++ Q M
Sbjct: 78  VMPLFFAQPNGIVSLAVSL---SLNSAAYVAEIFRAGIQSIDKGQMEAARSLGMTHAQAM 134

Query: 295 RLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLL--GIVRVNFSESTWISSVTPT 352
           R II+PQ +KR+IP   N FI L KDSSL  +I   +++  G          W   +T  
Sbjct: 135 RYIILPQALKRMIPPFANEFIVLIKDSSLGMVIAAPEIMYWGKAAAGEYYRVWEPYLT-- 192

Query: 353 TGLIFIGFVFWIFCFSISLYSVFIEK 378
                + F++ I   S+S  S ++E+
Sbjct: 193 -----VAFIYLILTLSLSKLSHYLER 213


>gi|260888233|ref|ZP_05899496.1| glutamine ABC transporter, permease protein [Selenomonas sputigena
           ATCC 35185]
 gi|330838428|ref|YP_004413008.1| polar amino acid ABC transporter, inner membrane subunit
           [Selenomonas sputigena ATCC 35185]
 gi|260862067|gb|EEX76567.1| glutamine ABC transporter, permease protein [Selenomonas sputigena
           ATCC 35185]
 gi|329746192|gb|AEB99548.1| polar amino acid ABC transporter, inner membrane subunit
           [Selenomonas sputigena ATCC 35185]
          Length = 221

 Score =  114 bits (284), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 76/216 (35%), Positives = 114/216 (52%), Gaps = 17/216 (7%)

Query: 176 GLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIM 235
           G LVT+ I+   + + + +G+++ + R S +  LR   + +I+  RG PL+  +F+    
Sbjct: 18  GALVTIKITAISVALGVVIGLVVGVARISQVKPLRLLAMAYIDFLRGTPLLVQIFLIYFA 77

Query: 236 LPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMR 295
           LP+       VD    A+   S  + AY+AE+ R G+QSI KGQ EA  SLG+++LQ M 
Sbjct: 78  LPVI--SGQRVDPFFAAITACSINSGAYVAEIFRSGIQSIDKGQMEAGRSLGMTWLQTMW 135

Query: 296 LIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDL-----LGIVRVNFSESTWISSVT 350
            II+PQ +KRVIP I N FI L KDSSL+S+I   +L     L I R   S   W     
Sbjct: 136 HIILPQAVKRVIPQIGNEFIALLKDSSLVSVIGFEELTRSGQLIIARTYGSLEIW----- 190

Query: 351 PTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
           P   +I++     +   SIS    ++E+      K 
Sbjct: 191 PCVAIIYL-----VMTLSISQLVAYLERRFRTDDKH 221


>gi|227512776|ref|ZP_03942825.1| glutamine ABC superfamily ATP binding cassette transporter,
           permease protein [Lactobacillus buchneri ATCC 11577]
 gi|227522900|ref|ZP_03952949.1| glutamine ABC superfamily ATP binding cassette transporter,
           permease protein [Lactobacillus hilgardii ATCC 8290]
 gi|227083976|gb|EEI19288.1| glutamine ABC superfamily ATP binding cassette transporter,
           permease protein [Lactobacillus buchneri ATCC 11577]
 gi|227089929|gb|EEI25241.1| glutamine ABC superfamily ATP binding cassette transporter,
           permease protein [Lactobacillus hilgardii ATCC 8290]
          Length = 235

 Score =  114 bits (284), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 70/213 (32%), Positives = 124/213 (58%), Gaps = 11/213 (5%)

Query: 176 GLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIM 235
           G  VT+++S   I++S   G++L + R   I  L       I++ R +PL+ ++F     
Sbjct: 19  GAWVTILVSVCSIVLSYIFGVILGVTRYVQIKYLSAIVGFVIDIIRNLPLILIIFFTYFG 78

Query: 236 LPL--FLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQK 293
           LP   F PD      +  +++ ++ F +A +AE++R G+ SI  GQ E A + GLSY Q 
Sbjct: 79  LPHLGFKPD-----PIWASVIAMAVFEAAMVAEIVRAGIVSIPTGQMEGARANGLSYWQA 133

Query: 294 MRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTT 353
           +  I++PQ I+ +IP IV+ FI L KD+SL +II + DL+   ++ + ++T  +   P  
Sbjct: 134 LWYIVLPQAIRNMIPAIVSQFISLVKDTSLATIIVLPDLMNHAQIIYGQNT--NYTIPM- 190

Query: 354 GLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
             + +  +++I C+S+SL+S ++EK +  G+KK
Sbjct: 191 -FLALAVMYFIVCYSLSLFSKYLEKRIGGGNKK 222


>gi|242280828|ref|YP_002992957.1| polar amino acid ABC transporter inner membrane subunit
           [Desulfovibrio salexigens DSM 2638]
 gi|242123722|gb|ACS81418.1| polar amino acid ABC transporter, inner membrane subunit
           [Desulfovibrio salexigens DSM 2638]
          Length = 593

 Score =  114 bits (284), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 70/211 (33%), Positives = 122/211 (57%), Gaps = 10/211 (4%)

Query: 173 LWG--GLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLF 230
           LWG  GL  ++++S   I +S  +G+++ +GR S   +       +IEL RG PL+ V+F
Sbjct: 381 LWGLGGLSFSIIMSVIAISVSFFIGLIVGIGRTSKNKLFLIPSTLYIELIRGNPLIMVIF 440

Query: 231 MASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSY 290
                +P+      +V     A + ++ F  AY+AE++R G+Q++  GQFEAA S GL+Y
Sbjct: 441 WIYFFIPILTGQFLNV--FWSATIALTVFTGAYLAEIVRSGIQNLPPGQFEAAVSTGLTY 498

Query: 291 LQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVR-VNFSESTWISSV 349
            Q MR +I+PQ +K+++P IV  FI +FKD+SL  +I + +L  + + +N     +   +
Sbjct: 499 WQAMRKVILPQALKQMLPAIVGQFIAIFKDTSLAFVIGVLELTFVAQGLNNRLMIYPFEI 558

Query: 350 TPTTGLIFIGFVFWIFCFSISLYSVFIEKTL 380
             T     + F+++I C+ +SL +  +E+ L
Sbjct: 559 YTT-----VAFLYFICCYLMSLVARRLERKL 584



 Score = 83.2 bits (204), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 59/160 (36%), Positives = 93/160 (58%), Gaps = 6/160 (3%)

Query: 176 GLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIM 235
           GL +T+ IS     I++ LGIL  LGR S    + Y C  ++E FR  PL+  LF     
Sbjct: 60  GLNLTISISLMSSAIALGLGILFGLGRLSQFKPVYYFCTCYVEFFRNTPLLVQLFFWYFA 119

Query: 236 LPLFLPDT-----WDVD-KLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLS 289
           LP+ LP+      +D + ++L A +G+  + S+++AEV+R G+QSI KG  EAA S GL+
Sbjct: 120 LPMGLPEAARNFLFDQNFEMLSATVGLGIYTSSFMAEVIRAGIQSIPKGLLEAAYSSGLT 179

Query: 290 YLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINM 329
             Q +  II+P   + +IP + + F+   K+SSL  ++ +
Sbjct: 180 PFQTLTKIILPLAFRAIIPPLGSEFLNNMKNSSLAMVVGV 219


>gi|54308669|ref|YP_129689.1| amino acid ABC transporter permease [Photobacterium profundum SS9]
 gi|46913098|emb|CAG19887.1| hypothetical amino acid ABC transporter, permease protein
           [Photobacterium profundum SS9]
          Length = 315

 Score =  114 bits (284), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 97/157 (61%), Gaps = 4/157 (2%)

Query: 176 GLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIM 235
           GL VTL IS   +  ++ +G++  L R SN PV +     ++E+ RG PL+  +F+    
Sbjct: 116 GLWVTLKISIISLFFAVIIGLVAGLMRISNNPVTKNLSFLYVEIIRGTPLLIQIFI---- 171

Query: 236 LPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMR 295
           +  FL   +D+++    ++ +S F  AYIAE++R G+QSI  GQ EAA SLG++Y + M 
Sbjct: 172 VYFFLGTIFDLERFTAGVVALSVFTGAYIAEIIRSGIQSIPPGQMEAARSLGMNYPKAMA 231

Query: 296 LIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDL 332
            +I+PQ  KR +P +    I L KDSSL+S+I++ DL
Sbjct: 232 YVILPQAFKRTLPPMAGQLITLIKDSSLVSVISITDL 268


>gi|317153669|ref|YP_004121717.1| polar amino acid ABC transporter inner membrane subunit
           [Desulfovibrio aespoeensis Aspo-2]
 gi|316943920|gb|ADU62971.1| polar amino acid ABC transporter, inner membrane subunit
           [Desulfovibrio aespoeensis Aspo-2]
          Length = 335

 Score =  114 bits (284), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 71/202 (35%), Positives = 114/202 (56%), Gaps = 21/202 (10%)

Query: 186 FGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA---------SIML 236
           FGI+    LG+   L R S+ P L+++ IT+IEL RG PL+  L +A         ++++
Sbjct: 142 FGIV----LGLFTGLARISSNPCLKWSAITYIELIRGSPLLVQLLIAYYVIGTLINNLLV 197

Query: 237 PLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRL 296
              LP    V  +   +  ++ FA AY+AE++R G+QSI KGQ EAA SLG++    MR 
Sbjct: 198 NAGLPQ---VPGMWFGIASLAIFAGAYVAEIVRAGIQSIHKGQSEAARSLGMTKAMAMRK 254

Query: 297 IIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLI 356
           II+PQ  +R++P +   FI L KDSSL+ +I + +L    R   +     +S+ P     
Sbjct: 255 IILPQAFRRILPPLAGQFISLIKDSSLLGVIAIRELTKATREAVT-----TSLMPYELYF 309

Query: 357 FIGFVFWIFCFSISLYSVFIEK 378
             G ++ +  FS+S++  ++EK
Sbjct: 310 VCGLMYLLVTFSLSMFVQYLEK 331


>gi|226307850|ref|YP_002767810.1| glutamine ABC transporter glutamine-binding/permease protein
           [Rhodococcus erythropolis PR4]
 gi|226186967|dbj|BAH35071.1| putative glutamine ABC transporter glutamine-binding/permease
           protein [Rhodococcus erythropolis PR4]
          Length = 482

 Score =  114 bits (284), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 76/238 (31%), Positives = 128/238 (53%), Gaps = 28/238 (11%)

Query: 161 YGGLGLSIVETSLWG-----------GLLVTLVISFFGIIISMPLGILLALGRNSNIPVL 209
           Y G G S  + S+ G           GL +T+V+S   I I++ LG +  L R S    +
Sbjct: 257 YLGQGASTSDNSIIGLIKSTYPQLLKGLWLTIVLSVVSIAIALVLGAIFGLCRVSTNMFV 316

Query: 210 RYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLR 269
           R    T++++FRG PL+   F     +P  L   + +      ++ +S  A AY+AE++R
Sbjct: 317 RGIGTTYVDIFRGTPLLVQAFFIYFGIPAALH--FQMSAFTAGIITLSLNAGAYMAEIVR 374

Query: 270 GGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINM 329
           GG+ S+ KGQ EA+ SLG+SY++ MR +IMPQ I+ +IP  +N F+   KD+S++S+I +
Sbjct: 375 GGILSVDKGQMEASRSLGISYMKSMRKVIMPQAIRTMIPSYINQFVITLKDTSILSVIGL 434

Query: 330 FDLLGIVRV----NFSE-STWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHK 382
            +L    R+    NF   + W          + IG +++I   +++  S  +EK ++K
Sbjct: 435 AELTQTGRIIIARNFQSFNMW----------LIIGVMYFIIIMALTKLSNRLEKRINK 482


>gi|224477394|ref|YP_002635000.1| hypothetical protein Sca_1909 [Staphylococcus carnosus subsp.
           carnosus TM300]
 gi|222422001|emb|CAL28815.1| hypothetical protein SCA_1909 [Staphylococcus carnosus subsp.
           carnosus TM300]
          Length = 235

 Score =  114 bits (284), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 76/228 (33%), Positives = 125/228 (54%), Gaps = 25/228 (10%)

Query: 173 LWGGLL-----VTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVT 227
           + GGL+     +TLV    G+II++      AL R S   +LR     ++ + RG P++ 
Sbjct: 19  MLGGLIKYSIPITLVTFVLGLIIAL----FTALMRISTSKILRGIARVYVSIIRGTPMIV 74

Query: 228 VLFMASIMLPLF------LPDT-WDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQF 280
            LF+    LP         PDT W +  ++ A++G+S    AY +E++RGG+ SI KGQ 
Sbjct: 75  QLFIIFYGLPELGRLVTNNPDTQWTLPSVVAAIIGLSLNVGAYASEIIRGGIISIPKGQS 134

Query: 281 EAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNF 340
           EAA S+G++Y Q ++ II+PQ I+  +P + NTF+ L KD+SL+  I + ++       F
Sbjct: 135 EAAYSIGMNYRQTIQRIILPQAIRVSVPALGNTFLSLLKDTSLLGFILVAEM-------F 187

Query: 341 SESTWISSVTPT--TGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
            ++  ++S T    T  I +  ++W+ CF IS+   F E  L +G + 
Sbjct: 188 RKAQEVASTTYEYLTIYILVALLYWVVCFIISVIQSFYESYLERGYRS 235


>gi|300722325|ref|YP_003711610.1| glutamate/aspartate ABC transporter membrane protein [Xenorhabdus
           nematophila ATCC 19061]
 gi|297628827|emb|CBJ89405.1| glutamate/aspartate transport protein (ABC superfamily, membrane)
           [Xenorhabdus nematophila ATCC 19061]
          Length = 224

 Score =  114 bits (284), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 67/211 (31%), Positives = 125/211 (59%), Gaps = 10/211 (4%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
           L  GL++TL I+   +I+ +  G +LA+ R S+I V+ +    ++ LFR VPLV VL   
Sbjct: 16  LLNGLVITLKITGIAVIVGIIWGTVLAMMRLSSIKVVSWFATLYVNLFRSVPLVMVLLWF 75

Query: 233 SIMLPLFLPDTWDVD-----KLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLG 287
            +++P  L +   +      +L+ A++  S F +AY +E++R G+QS+S+GQ  A+ +LG
Sbjct: 76  YLIVPNLLQNVLGISPQTDIRLISAMVAFSLFEAAYYSEIIRAGIQSVSRGQSSASLALG 135

Query: 288 LSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWIS 347
           ++++Q MRL+I+PQ  + + P ++   I LF+D+SL+ ++++ D       N  E     
Sbjct: 136 MTHMQSMRLVILPQAFRAMTPLLLTQGIVLFQDTSLVYVLSLADFFR-TATNIGERDG-- 192

Query: 348 SVTPTTGLIFIGFVFWIFCFSISLYSVFIEK 378
             T    ++F G V+++F F+ S+   +++K
Sbjct: 193 --TQVEMILFAGAVYFVFSFAASMLVNYLKK 221


>gi|319941415|ref|ZP_08015743.1| hypothetical protein HMPREF9464_00962 [Sutterella wadsworthensis
           3_1_45B]
 gi|319805035|gb|EFW01865.1| hypothetical protein HMPREF9464_00962 [Sutterella wadsworthensis
           3_1_45B]
          Length = 221

 Score =  11