BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780172|ref|YP_003064585.1| general L-amino acid transport
system permease protein [Candidatus Liberibacter asiaticus str. psy62]
         (386 letters)

Database: nr 
           13,984,884 sequences; 4,792,584,752 total letters

Searching..................................................done



>gi|209549160|ref|YP_002281077.1| polar amino acid ABC transporter inner membrane subunit [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|209534916|gb|ACI54851.1| polar amino acid ABC transporter, inner membrane subunit [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 384

 Score =  306 bits (783), Expect = 4e-81,   Method: Composition-based stats.
 Identities = 237/383 (61%), Positives = 301/383 (78%)

Query: 4   SCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHW 63
           S  + P+VR  +L    PP  +RG +AWI +N   TPKD++LT L + L+ +++P +++W
Sbjct: 2   SVADKPFVRTSILAAEPPPRGERGAVAWIRRNLLATPKDVILTILAVALIAWAVPHLVNW 61

Query: 64  VFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVF 123
           +F+ AVW G +RT C T  QGGIQP+GW+ ACWAF+  +Y+QFIFG YP+ +RWRP +V 
Sbjct: 62  LFIQAVWSGPDRTFCATTIQGGIQPEGWSGACWAFVSAKYDQFIFGRYPLDERWRPAIVG 121

Query: 124 LTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVI 183
           +   +LL PMLIPS PRK LN+ILLF   PI +F++L+GG GL +VET LWGGL+VTLV+
Sbjct: 122 ILFILLLVPMLIPSAPRKGLNAILLFAALPIIAFWLLHGGYGLEVVETPLWGGLMVTLVL 181

Query: 184 SFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDT 243
           SF GI +S+P GILLALGR S +PV+R  C+TFIE+ RGVPL+TVLFMAS+MLPLFLP  
Sbjct: 182 SFVGIAVSLPCGILLALGRRSKMPVIRMLCVTFIEVIRGVPLITVLFMASVMLPLFLPTG 241

Query: 244 WDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVI 303
           W+VDKLLRAL+GVS F SAY+AEV+RGGLQ+I KGQFE A+SLGL Y QK RLIIMPQ I
Sbjct: 242 WNVDKLLRALIGVSIFTSAYMAEVIRGGLQAIPKGQFEGADSLGLGYWQKTRLIIMPQAI 301

Query: 304 KRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFW 363
           K VIP IVNTFIG FKD+SL++II MFDLLGIV+ NFS++ W S+VTP TGLIF GF+FW
Sbjct: 302 KLVIPSIVNTFIGTFKDTSLVTIIGMFDLLGIVKQNFSDANWASAVTPITGLIFAGFIFW 361

Query: 364 IFCFSISLYSVFIEKTLHKGSKK 386
           +FCF +S YS F+E+ L  G K+
Sbjct: 362 LFCFGMSRYSGFMERHLDTGHKR 384


>gi|241204486|ref|YP_002975582.1| polar amino acid ABC transcriptional regulator inner membrane
           protein [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240858376|gb|ACS56043.1| polar amino acid ABC transporter, inner membrane subunit [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 384

 Score =  304 bits (778), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 239/383 (62%), Positives = 305/383 (79%)

Query: 4   SCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHW 63
           S  + P+VR  +L    PP  +RG +AWI +N   TPKD++LT L + L+ +++P +++W
Sbjct: 2   SVADKPFVRTSILAAEPPPPGERGAVAWIRRNLLATPKDVILTILALALIAWAVPHLVNW 61

Query: 64  VFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVF 123
           +F+ AVW G +RT C T  QGGIQPDGW+ ACWAFI  +Y+QFIFG YP+ +RWRP +V 
Sbjct: 62  LFIQAVWSGPDRTFCATTIQGGIQPDGWSGACWAFISAKYDQFIFGRYPLGERWRPAIVG 121

Query: 124 LTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVI 183
           +   +LL PMLIPS PRK LN+ILLF + P+ +F++L+GGLGL +VET LWGGL+VTLV+
Sbjct: 122 ILFILLLVPMLIPSAPRKGLNAILLFAVLPVIAFWLLHGGLGLEVVETPLWGGLMVTLVL 181

Query: 184 SFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDT 243
           SF GI +S+P+GILLALGR S +PV+R  C+TFIE+ RGVPL+TVLFMAS+MLPLFLP  
Sbjct: 182 SFVGIAVSLPVGILLALGRRSKMPVIRMLCVTFIEVIRGVPLITVLFMASVMLPLFLPTG 241

Query: 244 WDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVI 303
           W+VDKLLRAL+GVS F SAY+AEV+RGGLQ+I KGQFE A+SLGL Y QK RLIIMPQ I
Sbjct: 242 WNVDKLLRALIGVSIFTSAYMAEVIRGGLQAIPKGQFEGADSLGLGYWQKTRLIIMPQAI 301

Query: 304 KRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFW 363
           K VIP IVNTFIG FKD+SL++II MFDLLGIV++NFS++ W S+VTP TGLIF GF+FW
Sbjct: 302 KLVIPSIVNTFIGTFKDTSLVTIIGMFDLLGIVKLNFSDANWASAVTPITGLIFAGFIFW 361

Query: 364 IFCFSISLYSVFIEKTLHKGSKK 386
           +FCF +S YS F+E+ L  G K+
Sbjct: 362 LFCFGMSRYSGFMERHLDTGHKR 384


>gi|116251958|ref|YP_767796.1| general L-amino acid transport system permease protein [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|3182889|sp|Q52814|AAPM_RHIL3 RecName: Full=General L-amino acid transport system permease
           protein AapM
 gi|1154896|emb|CAA57935.1| general amino acid ABC type transporter [Rhizobium leguminosarum]
 gi|115256606|emb|CAK07694.1| General L-amino acid transport system permease protein [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 384

 Score =  303 bits (777), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 238/383 (62%), Positives = 304/383 (79%)

Query: 4   SCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHW 63
           S  + P+VR  +L    PP  +RG +AWI +N   TPKD++LT L + L+ +++P +++W
Sbjct: 2   SVADKPFVRTSILAAEPPPPGERGAVAWIRRNLLATPKDVILTILALALIAWAVPHLVNW 61

Query: 64  VFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVF 123
           +F+ AVW G +RT C T  QGGIQPDGW+ ACWAFI  +Y+QFIFG YP+ +RWRP +V 
Sbjct: 62  LFIQAVWSGPDRTFCATTLQGGIQPDGWSGACWAFISAKYDQFIFGRYPLGERWRPAIVG 121

Query: 124 LTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVI 183
           +   +LL PMLIPS PRK LN+ILLF + P+ +F++L+GG GL +VET LWGGL+VTLV+
Sbjct: 122 ILFILLLVPMLIPSAPRKGLNAILLFAVLPVIAFWLLHGGFGLEVVETPLWGGLMVTLVL 181

Query: 184 SFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDT 243
           SF GI +S+P+GILLALGR S +PV+R  C+TFIE+ RGVPL+TVLFMAS+MLPLFLP  
Sbjct: 182 SFVGIAVSLPVGILLALGRRSRMPVIRMLCVTFIEVIRGVPLITVLFMASVMLPLFLPTG 241

Query: 244 WDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVI 303
           W+VDKLLRAL+GVS F SAY+AEV+RGGLQ+I KGQFE A+SLGL Y QK RLIIMPQ I
Sbjct: 242 WNVDKLLRALIGVSIFTSAYMAEVIRGGLQAIPKGQFEGADSLGLGYWQKTRLIIMPQAI 301

Query: 304 KRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFW 363
           K VIP IVNTFIG FKD+SL++II MFDLLGIV++NFS++ W S+VTP TGLIF GF+FW
Sbjct: 302 KLVIPSIVNTFIGTFKDTSLVTIIGMFDLLGIVKLNFSDANWASAVTPITGLIFAGFIFW 361

Query: 364 IFCFSISLYSVFIEKTLHKGSKK 386
           +FCF +S YS F+E+ L  G K+
Sbjct: 362 LFCFGMSRYSGFMERHLDTGHKR 384


>gi|86357517|ref|YP_469409.1| general L-amino acid ABC transporter, permease protein [Rhizobium
           etli CFN 42]
 gi|86281619|gb|ABC90682.1| general L-amino acid ABC transporter, permease protein [Rhizobium
           etli CFN 42]
          Length = 381

 Score =  297 bits (760), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 240/378 (63%), Positives = 300/378 (79%)

Query: 9   PYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDA 68
            +VR  +L P  PP  ++G +AWI +N   TPKDI+LT L +  +++++   + W+F++A
Sbjct: 4   AFVRSAILAPEPPPSAEKGPVAWIRRNLLATPKDIVLTILALVFVVWALLHALDWLFVEA 63

Query: 69  VWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSI 128
           VW G +RT C T  QGGIQPDGW+ ACWAF+  +++QFIFG YP+ +RWRP LV +   +
Sbjct: 64  VWSGPDRTFCATAVQGGIQPDGWSGACWAFVNAKFDQFIFGRYPLDERWRPTLVGILFVL 123

Query: 129 LLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGI 188
           LL PMLIPS PRK +N++LLFG+ PI SFF+LYGG GL IVET LWGGLLVTLV+SF GI
Sbjct: 124 LLVPMLIPSAPRKGVNALLLFGVLPIISFFLLYGGFGLEIVETPLWGGLLVTLVLSFVGI 183

Query: 189 IISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDK 248
            +S PLGI+LALGR S +PV+R  C+ FIE+ RGVPL+TVLFMAS+MLPLFLP  W VDK
Sbjct: 184 AVSFPLGIILALGRRSQMPVIRTFCVVFIEVVRGVPLITVLFMASVMLPLFLPAGWTVDK 243

Query: 249 LLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIP 308
           LLRA++GVS FASAY+AEV+RGGLQ+I KGQFE A+SLGL Y QKMRL+IMPQ IK VIP
Sbjct: 244 LLRAVIGVSIFASAYMAEVIRGGLQAIPKGQFEGADSLGLGYWQKMRLVIMPQAIKLVIP 303

Query: 309 GIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFS 368
           GIVNTFIG+FKD+SL+SII+MFDLLGIVR+NF +  W ++VTP TGLIF GF FW+FCF 
Sbjct: 304 GIVNTFIGMFKDTSLVSIISMFDLLGIVRLNFVDPNWATAVTPLTGLIFAGFAFWLFCFG 363

Query: 369 ISLYSVFIEKTLHKGSKK 386
           +S YS FIE+ L  G K+
Sbjct: 364 MSRYSAFIERHLDTGHKR 381


>gi|225627245|ref|ZP_03785282.1| amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine family protein [Brucella ceti str.
           Cudo]
 gi|225617250|gb|EEH14295.1| amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine family protein [Brucella ceti str.
           Cudo]
          Length = 387

 Score =  296 bits (758), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 222/387 (57%), Positives = 287/387 (74%), Gaps = 1/387 (0%)

Query: 1   MIDSCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGI 60
           M     +  YVR +++    PP   +GI  W+  N F TP D  LT   + L+++ +P I
Sbjct: 1   MTMENADLQYVRTQMVDGEAPPRSVQGISHWLRVNLFATPVDAALTIFGLVLVVWFVPPI 60

Query: 61  IHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPI 120
           I W+F++A W G++RT C T +QGG QPDGW+ ACWAF+  +YEQF++G YP+++RWR  
Sbjct: 61  IEWLFINAAWTGTSRTACLTAAQGGAQPDGWSGACWAFVNAKYEQFLYGRYPISERWRVD 120

Query: 121 LVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLV 179
           L  L  + LL P+LIP  P+K LN+IL F +FP+   F ++ G  GL  VET LWGGLLV
Sbjct: 121 LTALIFAALLVPLLIPKIPKKGLNAILFFLVFPVVAFFLLVGGWFGLPYVETPLWGGLLV 180

Query: 180 TLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLF 239
           TLV+SF GI +S+PLGI+LALGR S +PV++   I FIE+ RGVPLVTVLFMAS+MLPLF
Sbjct: 181 TLVLSFVGIAVSLPLGIVLALGRRSKLPVIKTLSIIFIEMVRGVPLVTVLFMASVMLPLF 240

Query: 240 LPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIM 299
           LP     DKLLRAL+GV+ FASAY+AEV+RGGLQ+I +GQ+E A++LGLSY QK  L+++
Sbjct: 241 LPPGVTFDKLLRALIGVALFASAYMAEVVRGGLQAIPRGQYEGADALGLSYWQKTGLVVL 300

Query: 300 PQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIG 359
           PQ +K VIPGIVNTFIGLFKD+SL+ II MFDLLGIVR NFS++ W S  TP TGLIF G
Sbjct: 301 PQALKLVIPGIVNTFIGLFKDTSLVYIIGMFDLLGIVRQNFSDANWASPQTPATGLIFAG 360

Query: 360 FVFWIFCFSISLYSVFIEKTLHKGSKK 386
           FVFWIFCF++S YS+F+E+ L  G K+
Sbjct: 361 FVFWIFCFAMSRYSIFMERRLDTGHKR 387


>gi|23501631|ref|NP_697758.1| amino acid ABC transporter permease [Brucella suis 1330]
 gi|161618714|ref|YP_001592601.1| His/Glu/Gln/Arg/opine amino acid ABC transporter permease [Brucella
           canis ATCC 23365]
 gi|254704070|ref|ZP_05165898.1| His/Glu/Gln/Arg/opine amino acid ABC transporter permease [Brucella
           suis bv. 3 str. 686]
 gi|260566682|ref|ZP_05837152.1| polar amino acid ABC transporter [Brucella suis bv. 4 str. 40]
 gi|261754728|ref|ZP_05998437.1| polar amino acid ABC transporter [Brucella suis bv. 3 str. 686]
 gi|23347548|gb|AAN29673.1| amino acid ABC transporter, permease protein [Brucella suis 1330]
 gi|161335525|gb|ABX61830.1| amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine family [Brucella canis ATCC 23365]
 gi|260156200|gb|EEW91280.1| polar amino acid ABC transporter [Brucella suis bv. 4 str. 40]
 gi|261744481|gb|EEY32407.1| polar amino acid ABC transporter [Brucella suis bv. 3 str. 686]
          Length = 385

 Score =  296 bits (758), Expect = 4e-78,   Method: Composition-based stats.
 Identities = 221/382 (57%), Positives = 287/382 (75%), Gaps = 1/382 (0%)

Query: 6   KEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVF 65
            +  YVR +++    PP   +GI  W+  N F TP D  LT   + L+++ +P II W+F
Sbjct: 4   ADLQYVRTQMVDGEAPPRSVQGISHWLRVNLFATPVDAALTIFGLVLVVWFVPPIIEWLF 63

Query: 66  LDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLT 125
           ++A W G++RT C T +QGG QPDGW+ ACWAF+  +YEQF++G YP+++RWR  L  L 
Sbjct: 64  INAAWTGTSRTACLTAAQGGAQPDGWSGACWAFVNAKYEQFLYGRYPISERWRVDLTALI 123

Query: 126 GSILLTPMLIPSFPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVIS 184
            + LL P+LIP  P+K LN+IL F +FP+   F ++ G  GL  VET LWGGLLVTLV+S
Sbjct: 124 FAALLVPLLIPKIPKKGLNAILFFLVFPVVAFFLLVGGWFGLPYVETPLWGGLLVTLVLS 183

Query: 185 FFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTW 244
           F GI +S+PLGI+LALGR S +PV++   I+FIE+ RGVPLVTVLFMAS+MLPLFLP   
Sbjct: 184 FVGIAVSLPLGIVLALGRRSKLPVIKTLSISFIEMVRGVPLVTVLFMASVMLPLFLPPGV 243

Query: 245 DVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIK 304
             DKLLRAL+GV+ FASAY+AEV+RGGLQ+I +GQ+E A++LGLSY QK  L+++PQ +K
Sbjct: 244 TFDKLLRALIGVALFASAYMAEVVRGGLQAIPRGQYEGADALGLSYWQKTGLVVLPQALK 303

Query: 305 RVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWI 364
            VIPGIVNTFIGLFKD+SL+ II MFDLLGIVR NFS++ W S  TP TGLIF GFVFWI
Sbjct: 304 LVIPGIVNTFIGLFKDTSLVYIIGMFDLLGIVRQNFSDANWASPQTPATGLIFAGFVFWI 363

Query: 365 FCFSISLYSVFIEKTLHKGSKK 386
           FCF++S YS+F+E+ L  G K+
Sbjct: 364 FCFAMSRYSIFMERRLDTGHKR 385


>gi|306842007|ref|ZP_07474680.1| amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine family [Brucella sp. BO2]
 gi|306287848|gb|EFM59268.1| amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine family [Brucella sp. BO2]
          Length = 387

 Score =  296 bits (757), Expect = 4e-78,   Method: Composition-based stats.
 Identities = 222/387 (57%), Positives = 287/387 (74%), Gaps = 1/387 (0%)

Query: 1   MIDSCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGI 60
           M     +  YVR +++    PP   +GI  W+  N F TP D  LT   + L+++ +P I
Sbjct: 1   MTMENADLQYVRTQMVDGEAPPRSVQGISHWLRVNLFATPVDAALTIFGLVLVVWFVPPI 60

Query: 61  IHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPI 120
           I W+F++A W G++RT C T +QGG QPDGW+ ACWAF+  +YEQF++G YP+++RWR  
Sbjct: 61  IEWLFINAAWTGTSRTACLTAAQGGAQPDGWSGACWAFVNAKYEQFLYGRYPISERWRID 120

Query: 121 LVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLV 179
           L  L  + LL P+LIP  P+K LN+IL F +FP+   F ++ G  GL  VET LWGGLLV
Sbjct: 121 LTALIFAALLVPLLIPKVPKKGLNAILFFLVFPVVAFFLLVGGWFGLPYVETPLWGGLLV 180

Query: 180 TLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLF 239
           TLV+SF GI +S+PLGI+LALGR S +PV++   I FIE+ RGVPLVTVLFMAS+MLPLF
Sbjct: 181 TLVLSFVGIAVSLPLGIVLALGRRSKLPVIKTLSIIFIEMVRGVPLVTVLFMASVMLPLF 240

Query: 240 LPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIM 299
           LP     DKLLRAL+GV+ FASAY+AEV+RGGLQ+I +GQ+E A++LGLSY QK  L+++
Sbjct: 241 LPPGVTFDKLLRALIGVALFASAYMAEVVRGGLQAIPRGQYEGADALGLSYWQKTGLVVL 300

Query: 300 PQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIG 359
           PQ +K VIPGIVNTFIGLFKD+SL+ II MFDLLGIVR NFS++ W S  TP TGLIF G
Sbjct: 301 PQALKLVIPGIVNTFIGLFKDTSLVYIIGMFDLLGIVRQNFSDANWASPQTPATGLIFAG 360

Query: 360 FVFWIFCFSISLYSVFIEKTLHKGSKK 386
           FVFWIFCF++S YS+F+E+ L  G K+
Sbjct: 361 FVFWIFCFAMSRYSIFMERRLDTGHKR 387


>gi|239831567|ref|ZP_04679896.1| amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine family [Ochrobactrum intermedium
           LMG 3301]
 gi|239823834|gb|EEQ95402.1| amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine family [Ochrobactrum intermedium
           LMG 3301]
          Length = 387

 Score =  296 bits (757), Expect = 5e-78,   Method: Composition-based stats.
 Identities = 225/387 (58%), Positives = 289/387 (74%), Gaps = 1/387 (0%)

Query: 1   MIDSCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGI 60
           M     +  YVR +++    PP   +G+  W+  N F TP D  LT L + ++ + +P I
Sbjct: 1   MTMENADLQYVRTQMVDGEAPPRSVQGLSHWLRVNLFATPVDAALTILGLLVVAWFLPPI 60

Query: 61  IHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPI 120
           I W+F+ AVW G++RT C TV+QGG QP+GW+ ACWAF+  +YEQF++G YP+++RWR  
Sbjct: 61  IEWLFVKAVWTGADRTACLTVAQGGAQPEGWSGACWAFVNAKYEQFLYGRYPISERWRVN 120

Query: 121 LVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLV 179
           L  L  ++LL P+LIP  P+K LN+IL F +FPI   F ++ G  GL  VET LWGGLLV
Sbjct: 121 LTALIFAVLLVPLLIPKAPKKGLNAILFFFVFPIVAFFLLVGGWFGLPYVETPLWGGLLV 180

Query: 180 TLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLF 239
           TLV+SF GI +S+PLGI+LALGR S +PV+R   I FIE+ RGVPLVTVLFMAS+MLPLF
Sbjct: 181 TLVLSFVGIAVSLPLGIVLALGRRSKLPVIRAFSIIFIEMVRGVPLVTVLFMASVMLPLF 240

Query: 240 LPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIM 299
           LP     DKLLRAL+GV+ FASAY+AEV+RGGLQ+I +GQ+E A++LGLSY QK  LII+
Sbjct: 241 LPPGVTFDKLLRALIGVALFASAYMAEVVRGGLQAIPRGQYEGADALGLSYWQKTGLIIL 300

Query: 300 PQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIG 359
           PQ +K VIPGIVNTFIGLFKD+SL+ II MFDLLGIVR NF+++ W S  TP TGLIF G
Sbjct: 301 PQALKLVIPGIVNTFIGLFKDTSLVYIIGMFDLLGIVRQNFADANWASPQTPATGLIFAG 360

Query: 360 FVFWIFCFSISLYSVFIEKTLHKGSKK 386
           FVFWIFCF++S YS+F+E+ L  G K+
Sbjct: 361 FVFWIFCFAMSRYSIFMERRLDTGHKR 387


>gi|254701521|ref|ZP_05163349.1| His/Glu/Gln/Arg/opine amino acid ABC transporter permease [Brucella
           suis bv. 5 str. 513]
 gi|254709862|ref|ZP_05171673.1| His/Glu/Gln/Arg/opine amino acid ABC transporter permease [Brucella
           pinnipedialis B2/94]
 gi|256031354|ref|ZP_05444968.1| His/Glu/Gln/Arg/opine amino acid ABC transporter permease [Brucella
           pinnipedialis M292/94/1]
 gi|256060864|ref|ZP_05451024.1| His/Glu/Gln/Arg/opine amino acid ABC transporter permease [Brucella
           neotomae 5K33]
 gi|256159476|ref|ZP_05457244.1| His/Glu/Gln/Arg/opine amino acid ABC transporter permease [Brucella
           ceti M490/95/1]
 gi|256254762|ref|ZP_05460298.1| His/Glu/Gln/Arg/opine amino acid ABC transporter permease [Brucella
           ceti B1/94]
 gi|260168488|ref|ZP_05755299.1| amino acid ABC transporter, permease protein [Brucella sp. F5/99]
 gi|261221941|ref|ZP_05936222.1| polar amino acid ABC transporter [Brucella ceti B1/94]
 gi|261317403|ref|ZP_05956600.1| polar amino acid ABC transporter [Brucella pinnipedialis B2/94]
 gi|261324861|ref|ZP_05964058.1| polar amino acid ABC transporter [Brucella neotomae 5K33]
 gi|261752069|ref|ZP_05995778.1| polar amino acid ABC transporter [Brucella suis bv. 5 str. 513]
 gi|261757956|ref|ZP_06001665.1| polar amino acid ABC transporter [Brucella sp. F5/99]
 gi|265988440|ref|ZP_06100997.1| polar amino acid ABC transporter [Brucella pinnipedialis M292/94/1]
 gi|265997904|ref|ZP_06110461.1| polar amino acid ABC transporter [Brucella ceti M490/95/1]
 gi|294852108|ref|ZP_06792781.1| general L-amino acid transport system permease [Brucella sp. NVSL
           07-0026]
 gi|260920525|gb|EEX87178.1| polar amino acid ABC transporter [Brucella ceti B1/94]
 gi|261296626|gb|EEY00123.1| polar amino acid ABC transporter [Brucella pinnipedialis B2/94]
 gi|261300841|gb|EEY04338.1| polar amino acid ABC transporter [Brucella neotomae 5K33]
 gi|261737940|gb|EEY25936.1| polar amino acid ABC transporter [Brucella sp. F5/99]
 gi|261741822|gb|EEY29748.1| polar amino acid ABC transporter [Brucella suis bv. 5 str. 513]
 gi|262552372|gb|EEZ08362.1| polar amino acid ABC transporter [Brucella ceti M490/95/1]
 gi|264660637|gb|EEZ30898.1| polar amino acid ABC transporter [Brucella pinnipedialis M292/94/1]
 gi|294820697|gb|EFG37696.1| general L-amino acid transport system permease [Brucella sp. NVSL
           07-0026]
          Length = 385

 Score =  295 bits (756), Expect = 5e-78,   Method: Composition-based stats.
 Identities = 221/382 (57%), Positives = 286/382 (74%), Gaps = 1/382 (0%)

Query: 6   KEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVF 65
            +  YVR +++    PP   +GI  W+  N F TP D  LT   + L+++ +P II W+F
Sbjct: 4   ADLQYVRTQMVDGEAPPRSVQGISHWLRVNLFATPVDAALTIFGLVLVVWFVPPIIEWLF 63

Query: 66  LDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLT 125
           ++A W G++RT C T +QGG QPDGW+ ACWAF+  +YEQF++G YP+++RWR  L  L 
Sbjct: 64  INAAWTGTSRTACLTAAQGGAQPDGWSGACWAFVNAKYEQFLYGRYPISERWRVDLTALI 123

Query: 126 GSILLTPMLIPSFPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVIS 184
            + LL P+LIP  P+K LN+IL F +FP+   F ++ G  GL  VET LWGGLLVTLV+S
Sbjct: 124 FAALLVPLLIPKIPKKGLNAILFFLVFPVVAFFLLVGGWFGLPYVETPLWGGLLVTLVLS 183

Query: 185 FFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTW 244
           F GI +S+PLGI+LALGR S +PV++   I FIE+ RGVPLVTVLFMAS+MLPLFLP   
Sbjct: 184 FVGIAVSLPLGIVLALGRRSKLPVIKTLSIIFIEMVRGVPLVTVLFMASVMLPLFLPPGV 243

Query: 245 DVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIK 304
             DKLLRAL+GV+ FASAY+AEV+RGGLQ+I +GQ+E A++LGLSY QK  L+++PQ +K
Sbjct: 244 TFDKLLRALIGVALFASAYMAEVVRGGLQAIPRGQYEGADALGLSYWQKTGLVVLPQALK 303

Query: 305 RVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWI 364
            VIPGIVNTFIGLFKD+SL+ II MFDLLGIVR NFS++ W S  TP TGLIF GFVFWI
Sbjct: 304 LVIPGIVNTFIGLFKDTSLVYIIGMFDLLGIVRQNFSDANWASPQTPATGLIFAGFVFWI 363

Query: 365 FCFSISLYSVFIEKTLHKGSKK 386
           FCF++S YS+F+E+ L  G K+
Sbjct: 364 FCFAMSRYSIFMERRLDTGHKR 385


>gi|254713863|ref|ZP_05175674.1| His/Glu/Gln/Arg/opine amino acid ABC transporter permease [Brucella
           ceti M644/93/1]
 gi|254717080|ref|ZP_05178891.1| His/Glu/Gln/Arg/opine amino acid ABC transporter permease [Brucella
           ceti M13/05/1]
 gi|261218891|ref|ZP_05933172.1| polar amino acid ABC transporter [Brucella ceti M13/05/1]
 gi|261321610|ref|ZP_05960807.1| polar amino acid ABC transporter [Brucella ceti M644/93/1]
 gi|260923980|gb|EEX90548.1| polar amino acid ABC transporter [Brucella ceti M13/05/1]
 gi|261294300|gb|EEX97796.1| polar amino acid ABC transporter [Brucella ceti M644/93/1]
          Length = 385

 Score =  295 bits (756), Expect = 5e-78,   Method: Composition-based stats.
 Identities = 220/382 (57%), Positives = 285/382 (74%), Gaps = 1/382 (0%)

Query: 6   KEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVF 65
            +  YVR +++    PP   +GI  W+  N F TP D  LT   + L+++ +P II W+F
Sbjct: 4   ADLQYVRTQMVDGEAPPRSVQGISHWLRVNLFATPVDAALTIFGLVLVVWFVPPIIEWLF 63

Query: 66  LDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLT 125
           ++A W G++RT C T +QGG QPDGW+ ACWAF+  +YEQF++G YP+++RWR  L  L 
Sbjct: 64  INAAWTGTSRTACLTAAQGGAQPDGWSGACWAFVNAKYEQFLYGRYPISERWRVDLTALI 123

Query: 126 GSILLTPMLIPSFPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVIS 184
            + LL P+LIP  P+K LN+IL F +FP+   F ++ G  GL  VET LWGGLLVTLV+S
Sbjct: 124 FAALLVPLLIPKIPKKGLNAILFFLVFPVVAFFLLVGGWFGLPYVETPLWGGLLVTLVLS 183

Query: 185 FFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTW 244
           F GI +S+PLGI+L LGR S +PV++   I FIE+ RGVPLVTVLFMAS+MLPLFLP   
Sbjct: 184 FVGIAVSLPLGIVLVLGRRSKLPVIKTLSIIFIEMVRGVPLVTVLFMASVMLPLFLPPGV 243

Query: 245 DVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIK 304
             DKLLRAL+GV+ FASAY+AEV+RGGLQ+I +GQ+E A++LGLSY QK  L+++PQ +K
Sbjct: 244 TFDKLLRALIGVALFASAYMAEVVRGGLQAIPRGQYEGADALGLSYWQKTGLVVLPQALK 303

Query: 305 RVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWI 364
            VIPGIVNTFIGLFKD+SL+ II MFDLLGIVR NFS++ W S  TP TGLIF GFVFWI
Sbjct: 304 LVIPGIVNTFIGLFKDTSLVYIIGMFDLLGIVRQNFSDANWASPQTPATGLIFAGFVFWI 363

Query: 365 FCFSISLYSVFIEKTLHKGSKK 386
           FCF++S YS+F+E+ L  G K+
Sbjct: 364 FCFAMSRYSIFMERRLDTGHKR 385


>gi|254718863|ref|ZP_05180674.1| His/Glu/Gln/Arg/opine amino acid ABC transporter permease [Brucella
           sp. 83/13]
 gi|265983848|ref|ZP_06096583.1| polar amino acid ABC transporter [Brucella sp. 83/13]
 gi|306837634|ref|ZP_07470504.1| amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine family [Brucella sp. NF 2653]
 gi|264662440|gb|EEZ32701.1| polar amino acid ABC transporter [Brucella sp. 83/13]
 gi|306407283|gb|EFM63492.1| amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine family [Brucella sp. NF 2653]
          Length = 385

 Score =  295 bits (756), Expect = 6e-78,   Method: Composition-based stats.
 Identities = 221/382 (57%), Positives = 286/382 (74%), Gaps = 1/382 (0%)

Query: 6   KEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVF 65
            +  YVR +++    PP   +GI  W+  N F TP D  LT   + L+++ +P II W+F
Sbjct: 4   ADLQYVRTQMVDGEAPPRSVQGISHWLRVNLFATPVDAALTIFGLVLVVWFVPPIIEWLF 63

Query: 66  LDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLT 125
           ++A W G++RT C T +QGG QPDGW+ ACWAF+  +YEQF++G YP+++RWR  L  L 
Sbjct: 64  INAAWTGTSRTACLTAAQGGAQPDGWSGACWAFVNAKYEQFLYGRYPISERWRVDLTALI 123

Query: 126 GSILLTPMLIPSFPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVIS 184
            + LL P+LIP  P+K LN+IL F +FP+   F ++ G  GL  VET LWGGLLVTLV+S
Sbjct: 124 FAALLVPLLIPKVPKKGLNAILFFLVFPVVAFFLLVGGWFGLPYVETPLWGGLLVTLVLS 183

Query: 185 FFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTW 244
           F GI +S+PLGI+LALGR S +PV++   I FIE+ RGVPLVTVLFMAS+MLPLFLP   
Sbjct: 184 FVGIAVSLPLGIVLALGRRSKLPVIKTLSIIFIEMVRGVPLVTVLFMASVMLPLFLPPGV 243

Query: 245 DVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIK 304
             DKLLRAL+GV+ FASAY+AEV+RGGLQ+I +GQ+E A++LGLSY QK  L+++PQ +K
Sbjct: 244 TFDKLLRALIGVALFASAYMAEVVRGGLQAIPRGQYEGADALGLSYWQKTGLVVLPQALK 303

Query: 305 RVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWI 364
            VIPGIVNTFIGLFKD+SL+ II MFDLLGIVR NFS++ W S  TP TGLIF GFVFWI
Sbjct: 304 LVIPGIVNTFIGLFKDTSLVYIIGMFDLLGIVRQNFSDANWASPQTPATGLIFAGFVFWI 363

Query: 365 FCFSISLYSVFIEKTLHKGSKK 386
           FCF++S YS+F+E+ L  G K+
Sbjct: 364 FCFAMSRYSIFMERRLDTGHKR 385


>gi|148559315|ref|YP_001258725.1| amino acid ABC transporter permease [Brucella ovis ATCC 25840]
 gi|148370572|gb|ABQ60551.1| amino acid ABC transporter, permease protein [Brucella ovis ATCC
           25840]
          Length = 385

 Score =  295 bits (756), Expect = 6e-78,   Method: Composition-based stats.
 Identities = 220/382 (57%), Positives = 285/382 (74%), Gaps = 1/382 (0%)

Query: 6   KEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVF 65
            +  YVR +++    PP   +GI  W+  N F TP D  LT   + L+++ +P II W+F
Sbjct: 4   ADLQYVRTQMVDGEAPPRSVQGISHWLRVNLFATPVDAALTIFGLVLVVWFVPPIIEWLF 63

Query: 66  LDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLT 125
           ++A W G++RT C T +QGG QPDGW+ ACWAF+  +YEQF++G YP+++RWR  L  L 
Sbjct: 64  INAAWTGTSRTACLTAAQGGAQPDGWSGACWAFVNAKYEQFLYGRYPISERWRVDLTALI 123

Query: 126 GSILLTPMLIPSFPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVIS 184
            + LL P+LIP  P+K LN+IL F +FP+   F ++ G  GL  VET LWGGLLVTLV+S
Sbjct: 124 FAALLVPLLIPKIPKKGLNAILFFLVFPVVAFFLLVGGWFGLPYVETPLWGGLLVTLVLS 183

Query: 185 FFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTW 244
           F GI +S+PLGI+LALGR S +PV++   I FIE+ RGVPLVTVLFMAS+MLPLFLP   
Sbjct: 184 FVGIAVSLPLGIVLALGRRSKLPVIKTLSIIFIEMVRGVPLVTVLFMASVMLPLFLPPGV 243

Query: 245 DVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIK 304
             DKLLRAL+GV+ FASAY+AEV+RGGLQ+I +GQ+E A++LGLSY QK  L+++PQ +K
Sbjct: 244 TFDKLLRALIGVALFASAYMAEVVRGGLQAIPRGQYEGADALGLSYWQKTSLVVLPQALK 303

Query: 305 RVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWI 364
            VIPGIVNTFIGLFKD+SL+ II MFDLLGIVR NFS++ W S   P TGLIF GFVFWI
Sbjct: 304 LVIPGIVNTFIGLFKDTSLVYIIGMFDLLGIVRQNFSDANWASPQAPATGLIFAGFVFWI 363

Query: 365 FCFSISLYSVFIEKTLHKGSKK 386
           FCF++S YS+F+E+ L  G K+
Sbjct: 364 FCFAMSRYSIFMERRLDTGHKR 385


>gi|319784338|ref|YP_004143814.1| polar amino acid ABC transporter inner membrane subunit
           [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317170226|gb|ADV13764.1| polar amino acid ABC transporter, inner membrane subunit
           [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 385

 Score =  295 bits (756), Expect = 6e-78,   Method: Composition-based stats.
 Identities = 213/382 (55%), Positives = 281/382 (73%), Gaps = 1/382 (0%)

Query: 6   KEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVF 65
            +  +VR  ++     P    G+ AW+ KN   +  D +LT + I L+   +P II+W F
Sbjct: 4   HDMSWVRTEMVLAQPAPASVTGLGAWVRKNLIASTGDTILTIVGIALVAMILPQIINWAF 63

Query: 66  LDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLT 125
           ++AVW G +RTVC TV+QGGIQPDGW  ACWAF+  ++ QF+ G YP+ +RWRPILV + 
Sbjct: 64  INAVWTGPDRTVCATVAQGGIQPDGWTGACWAFVNAKFGQFMLGRYPIEERWRPILVAIL 123

Query: 126 GSILLTPMLIPSFPRKFLNSILLFGLFPIFSF-FVLYGGLGLSIVETSLWGGLLVTLVIS 184
              LL PML+P  PRK LN++LLF + PI +F  ++ G  GL  VETSLWGGLLVTL +S
Sbjct: 124 FVALLVPMLMPKVPRKGLNAVLLFFVLPIVAFVLLVGGMFGLPHVETSLWGGLLVTLSLS 183

Query: 185 FFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTW 244
           F GI +S+PLGI+LALGR S +P+++  C+ FIE  RG+PL+TVLF AS+MLPLFLP+  
Sbjct: 184 FVGIAVSLPLGIVLALGRRSKMPIIKTLCVVFIETVRGIPLITVLFFASVMLPLFLPEGV 243

Query: 245 DVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIK 304
             DK LRAL+GVS FA+AY+AEV+RGGLQ+I KGQ+E A+SLGL Y QKM  I+MPQ +K
Sbjct: 244 SFDKFLRALIGVSLFAAAYMAEVVRGGLQAIPKGQYEGADSLGLGYWQKMYFIVMPQALK 303

Query: 305 RVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWI 364
            VIPGIVNTFIG+FKD+SL+ II+MFDLLGIV+ NFS++ W ++ T  +GLIF  FVFW+
Sbjct: 304 LVIPGIVNTFIGMFKDTSLVIIISMFDLLGIVKQNFSDANWATAQTARSGLIFAAFVFWL 363

Query: 365 FCFSISLYSVFIEKTLHKGSKK 386
           FCF +S YS++ E+ L  G K+
Sbjct: 364 FCFGMSRYSMYTERRLDTGHKR 385


>gi|256369177|ref|YP_003106685.1| amino acid ABC transporter, permease protein [Brucella microti CCM
           4915]
 gi|255999337|gb|ACU47736.1| amino acid ABC transporter, permease protein [Brucella microti CCM
           4915]
          Length = 385

 Score =  295 bits (755), Expect = 9e-78,   Method: Composition-based stats.
 Identities = 220/382 (57%), Positives = 285/382 (74%), Gaps = 1/382 (0%)

Query: 6   KEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVF 65
            +  YVR +++    PP   +GI  W+  N F TP D  LT   + L+++ +P II W+F
Sbjct: 4   ADLQYVRTQMVDGEAPPRSVQGISHWLRVNLFATPVDAALTIFGLVLVVWFVPPIIEWLF 63

Query: 66  LDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLT 125
           ++A W G++RT C T +QGG QPDGW+ ACWAF+  +YEQF++G YP+++RWR  L  L 
Sbjct: 64  INAAWTGTSRTACLTAAQGGAQPDGWSGACWAFVNAKYEQFLYGRYPISERWRVDLTALI 123

Query: 126 GSILLTPMLIPSFPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVIS 184
            + LL P+LIP  P+K LN+IL F +FP+   F ++ G  GL  VET LWGGLLVTLV+S
Sbjct: 124 FAALLVPLLIPKIPKKGLNAILFFLVFPVVAFFLLVGGWFGLPYVETPLWGGLLVTLVLS 183

Query: 185 FFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTW 244
           F GI +S+PLGI+LA GR S +PV++   I FIE+ RGVPLVTVLFMAS+MLPLFLP   
Sbjct: 184 FVGIAVSLPLGIVLAFGRRSKLPVIKTLSIIFIEMVRGVPLVTVLFMASVMLPLFLPPGV 243

Query: 245 DVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIK 304
             DKLLRAL+GV+ FASAY+AEV+RGGLQ+I +GQ+E A++LGLSY QK  L+++PQ +K
Sbjct: 244 TFDKLLRALIGVALFASAYMAEVVRGGLQAIPRGQYEGADALGLSYWQKTGLVVLPQALK 303

Query: 305 RVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWI 364
            VIPGIVNTFIGLFKD+SL+ II MFDLLGIVR NFS++ W S  TP TGLIF GFVFWI
Sbjct: 304 LVIPGIVNTFIGLFKDTSLVYIIGMFDLLGIVRQNFSDANWASPQTPATGLIFAGFVFWI 363

Query: 365 FCFSISLYSVFIEKTLHKGSKK 386
           FCF++S YS+F+E+ L  G K+
Sbjct: 364 FCFAMSRYSIFMERRLDTGHKR 385


>gi|15888896|ref|NP_354577.1| ABC transporter, membrane spanning protein (amino acid)
           [Agrobacterium tumefaciens str. C58]
 gi|15156666|gb|AAK87362.1| ABC transporter, membrane spanning protein (amino acid)
           [Agrobacterium tumefaciens str. C58]
          Length = 385

 Score =  294 bits (753), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 221/379 (58%), Positives = 281/379 (74%), Gaps = 1/379 (0%)

Query: 9   PYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDA 68
            +VR+ +      P    G   W+    F TPKD +LT + + LL + +P II W+F+DA
Sbjct: 7   AFVRQTIEDARPAPSSAVGFGHWLRTKLFATPKDTVLTVIALALLAYLVPPIIKWLFIDA 66

Query: 69  VWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSI 128
           VW GS+R  C TVSQGG  PDG + ACWAF+  +  QF+FG YP+ +RWRPILV +T +I
Sbjct: 67  VWTGSDRFACLTVSQGGALPDGQSGACWAFVSAKLGQFVFGRYPIDERWRPILVMVTFAI 126

Query: 129 LLTPMLIPSFPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFG 187
           LL PMLIP  P K LN++ LF + P    F ++ G  GL  VET LWGGL+VTL++SFFG
Sbjct: 127 LLVPMLIPKAPFKRLNALALFIILPFIAFFLLIGGVFGLPKVETQLWGGLMVTLILSFFG 186

Query: 188 IIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVD 247
           I +S+P GILLALGR SN+PV++  C+ FIE+ RG+PL+TVLF ASIMLPLFLPD W  D
Sbjct: 187 ITVSLPFGILLALGRRSNLPVIKMLCVLFIEVIRGIPLITVLFFASIMLPLFLPDGWTFD 246

Query: 248 KLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVI 307
           K LRAL+GVS F+SAY+AEV+RGGLQ+I KGQ+E A+SLGL+Y QK RLI++PQ +K VI
Sbjct: 247 KFLRALVGVSLFSSAYMAEVIRGGLQAIPKGQYEGADSLGLNYWQKTRLIVLPQALKLVI 306

Query: 308 PGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCF 367
           PGIVNTFIGLFKD+SL+SII MFDLLGIV +N +++ W + VT  TG IF GFVFWIFCF
Sbjct: 307 PGIVNTFIGLFKDTSLVSIIGMFDLLGIVTLNQADANWATPVTAMTGYIFAGFVFWIFCF 366

Query: 368 SISLYSVFIEKTLHKGSKK 386
            +S YS+F+E+ L  G K+
Sbjct: 367 GMSRYSLFMERHLDTGHKR 385


>gi|222085838|ref|YP_002544369.1| general L-amino acid ABC transporter [Agrobacterium radiobacter
           K84]
 gi|221723286|gb|ACM26442.1| general L-amino acid ABC transporter [Agrobacterium radiobacter
           K84]
          Length = 384

 Score =  294 bits (752), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 230/378 (60%), Positives = 289/378 (76%)

Query: 9   PYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDA 68
            +V K LL P   P  ++G+  WI KN   TPKD++LT L I  L ++IP I++W+F+ A
Sbjct: 7   SFVSKTLLPPQQAPANEKGVGHWIKKNLLATPKDMVLTVLAIAFLAWAIPHIVNWLFIQA 66

Query: 69  VWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSI 128
            W G++RT C T  QGG QPDGW+ ACWAF+  +   F+FG YP  +RWRPILV +   +
Sbjct: 67  AWTGADRTFCATTIQGGTQPDGWSGACWAFVSAKINVFLFGLYPPEERWRPILVIILAVL 126

Query: 129 LLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGI 188
            + P+LIPS PRK LN +L F + PI SFF+LYGG GL +VET  WGGL+VTL++SF  I
Sbjct: 127 TIAPLLIPSVPRKGLNVLLAFIVLPIMSFFLLYGGFGLDVVETQRWGGLMVTLIVSFVAI 186

Query: 189 IISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDK 248
            +S+P GI+LALGR S +PV+R  C+ FIE+ RG+PL+TVLFMAS+MLPLFLP  W +DK
Sbjct: 187 AVSVPFGIVLALGRRSQMPVIRMLCVLFIEVIRGIPLITVLFMASVMLPLFLPQGWTIDK 246

Query: 249 LLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIP 308
           LLRA++GVS F SAY+AEV+RGGLQ++ KGQFE A+SLGL Y QKMRLI++PQ IK VIP
Sbjct: 247 LLRAVIGVSIFTSAYMAEVIRGGLQAVPKGQFEGADSLGLGYWQKMRLIVLPQAIKLVIP 306

Query: 309 GIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFS 368
           GIVNTFIG+FKD+SLISIINMFDLLGIVR NFS+  W S VTP TGLIF GFVFW+FCF+
Sbjct: 307 GIVNTFIGMFKDTSLISIINMFDLLGIVRQNFSDPNWASPVTPVTGLIFAGFVFWLFCFA 366

Query: 369 ISLYSVFIEKTLHKGSKK 386
           +S YS F+E+ L  G K+
Sbjct: 367 MSRYSGFMERHLDTGHKR 384


>gi|13476743|ref|NP_108312.1| amino acid ABC transporter, permease protein [Mesorhizobium loti
           MAFF303099]
 gi|14027504|dbj|BAB53773.1| amino acid ABC transporter, permease protein [Mesorhizobium loti
           MAFF303099]
          Length = 385

 Score =  293 bits (750), Expect = 3e-77,   Method: Composition-based stats.
 Identities = 212/382 (55%), Positives = 278/382 (72%), Gaps = 1/382 (0%)

Query: 6   KEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVF 65
            +  +VR  +      P   RG +AW+ KN  GT  D +LT L I ++ + +P +I W F
Sbjct: 4   HDMSWVRTEMALAQSAPTSVRGPMAWVRKNLVGTVGDTILTILGIVIVAWILPQVIGWAF 63

Query: 66  LDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLT 125
           ++AVW G +RTVC TV+QGGIQPDGW  ACWAF+  ++ QF+FG YP+ +RWRPILV + 
Sbjct: 64  INAVWTGPDRTVCATVAQGGIQPDGWTGACWAFVNAKFGQFMFGTYPIEERWRPILVAIL 123

Query: 126 GSILLTPMLIPSFPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVIS 184
              LL PMLIP  PRK LN+ILLF + PI   F ++ G  GL  VETS WGGLLVTL +S
Sbjct: 124 FVALLVPMLIPRVPRKGLNAILLFLVLPIVSFFLLIGGVFGLPHVETSRWGGLLVTLSLS 183

Query: 185 FFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTW 244
           F GI +S+PLG +LALGR S +P+++  C+ FIE  RG+PL+TVLF  S+MLPLFLP   
Sbjct: 184 FVGIAVSLPLGTVLALGRRSKMPIVKTLCVVFIETVRGIPLITVLFFVSVMLPLFLPAGV 243

Query: 245 DVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIK 304
             DK LRAL+GVS FA+AY+AEV+RGGLQ+I KGQ+E A+SLGL Y QKM LI++PQ ++
Sbjct: 244 TFDKFLRALIGVSLFAAAYMAEVVRGGLQAIPKGQYEGADSLGLGYWQKMGLIVLPQALR 303

Query: 305 RVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWI 364
            VIPGIVNTFIG+FKD+SL+ II+MFDLLG+V+ NFS++ W +  T  +GL+F  FVFW+
Sbjct: 304 LVIPGIVNTFIGMFKDTSLVLIISMFDLLGVVKQNFSDANWATPQTARSGLVFAAFVFWL 363

Query: 365 FCFSISLYSVFIEKTLHKGSKK 386
           FCF +S YS++ E+ L  G K+
Sbjct: 364 FCFGMSRYSMYTERRLDTGHKR 385


>gi|190891585|ref|YP_001978127.1| general L-amino acid ABC transporter, permease protein [Rhizobium
           etli CIAT 652]
 gi|190696864|gb|ACE90949.1| general L-amino acid ABC transporter, permease protein [Rhizobium
           etli CIAT 652]
          Length = 381

 Score =  293 bits (750), Expect = 3e-77,   Method: Composition-based stats.
 Identities = 239/378 (63%), Positives = 298/378 (78%)

Query: 9   PYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDA 68
            +VR  +L P  PP  ++G++AWI +N   TPKD++LT L +  + +++   + W+F+ A
Sbjct: 4   SFVRTAILAPEPPPAGEKGMVAWIRRNLLATPKDMVLTTLAVVFIAWALLHAVDWLFVQA 63

Query: 69  VWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSI 128
           VW G +RT C T  QGGIQPDGW+ ACWAF+  +++QFI+G YP+ +RWRP LV +   +
Sbjct: 64  VWRGPDRTFCATAVQGGIQPDGWSGACWAFVNAKFDQFIYGRYPLDERWRPTLVGILFVL 123

Query: 129 LLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGI 188
           LL PMLIPS PRK +N++LLFG  PI SFF+LYGG GL IVET LWGGLLVTLV+SF GI
Sbjct: 124 LLVPMLIPSAPRKGVNALLLFGALPIVSFFLLYGGYGLEIVETPLWGGLLVTLVLSFVGI 183

Query: 189 IISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDK 248
            +S PLGI+LALGR S +PV+R  CI FIE+ RGVPL+TVLFMAS+MLPLFLP  W VDK
Sbjct: 184 AVSFPLGIILALGRRSQMPVIRTVCIVFIEVVRGVPLITVLFMASVMLPLFLPAGWTVDK 243

Query: 249 LLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIP 308
           LLRA++GVS FASAY+AEV+RGGLQ+I KGQFE A+SLGL Y QKMRLIIMPQ IK VIP
Sbjct: 244 LLRAIIGVSIFASAYMAEVIRGGLQAIPKGQFEGADSLGLGYWQKMRLIIMPQAIKLVIP 303

Query: 309 GIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFS 368
           GIVNTFIG+FKD+SL+SII+MFDLLGIVR+NF +  W ++VTP TGLIF GF FW+FCF 
Sbjct: 304 GIVNTFIGMFKDTSLVSIISMFDLLGIVRLNFVDPNWATAVTPLTGLIFAGFSFWLFCFG 363

Query: 369 ISLYSVFIEKTLHKGSKK 386
           +S YS F+E+ L  G K+
Sbjct: 364 MSRYSAFMERHLDTGHKR 381


>gi|153009882|ref|YP_001371097.1| polar amino acid ABC transporter inner membrane subunit
           [Ochrobactrum anthropi ATCC 49188]
 gi|151561770|gb|ABS15268.1| polar amino acid ABC transporter, inner membrane subunit
           [Ochrobactrum anthropi ATCC 49188]
          Length = 385

 Score =  293 bits (750), Expect = 3e-77,   Method: Composition-based stats.
 Identities = 225/382 (58%), Positives = 285/382 (74%), Gaps = 1/382 (0%)

Query: 6   KEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVF 65
            +  YVR +++    PP   +GI  W+  N F TP D  LT L +  + + +P II W+F
Sbjct: 4   ADLQYVRSQMVDGEAPPRSVQGISHWLRVNLFATPVDAALTILGLLAVAWFLPPIIEWLF 63

Query: 66  LDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLT 125
             AVW G++RT C TV+QGG QP+GW+ ACWAF+  +YEQFI+G YP+++RWR  L  L 
Sbjct: 64  FKAVWTGADRTACLTVAQGGTQPEGWSGACWAFVNAKYEQFIYGRYPISERWRVNLTALI 123

Query: 126 GSILLTPMLIPSFPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVIS 184
             +LL P+LIP  P+K LN+IL F +FPI   F ++ G  GL  VET LWGGLLVTLV+S
Sbjct: 124 FVVLLVPLLIPKAPKKALNAILFFFVFPIVAFFLLVGGWFGLPYVETPLWGGLLVTLVLS 183

Query: 185 FFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTW 244
           F GI +S+PLGI+LALGR S +PV++   I FIE+ RGVPLVTVLFMAS+MLPLFLP   
Sbjct: 184 FVGIAVSLPLGIVLALGRRSKLPVIKTFSIIFIEMVRGVPLVTVLFMASVMLPLFLPPGV 243

Query: 245 DVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIK 304
             DKLLRAL+GV+ FASAY+AEV+RGGLQ+I +GQ+E A++LGLSY QK  LI++PQ +K
Sbjct: 244 TFDKLLRALIGVALFASAYMAEVVRGGLQAIPRGQYEGADALGLSYWQKTGLIVLPQALK 303

Query: 305 RVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWI 364
            VIPGIVNTFIGLFKD+SL+ II MFDLLGIVR NFS++ W S  TP TGLIF GFVFWI
Sbjct: 304 LVIPGIVNTFIGLFKDTSLVYIIGMFDLLGIVRQNFSDANWASPQTPATGLIFAGFVFWI 363

Query: 365 FCFSISLYSVFIEKTLHKGSKK 386
           FCF++S YS+F+E+ L  G K+
Sbjct: 364 FCFAMSRYSIFMERRLDTGHKR 385


>gi|325292972|ref|YP_004278836.1| general L-amino acid transport system permease protein AapM
           [Agrobacterium sp. H13-3]
 gi|325060825|gb|ADY64516.1| general L-amino acid transport system permease protein AapM
           [Agrobacterium sp. H13-3]
          Length = 385

 Score =  293 bits (749), Expect = 4e-77,   Method: Composition-based stats.
 Identities = 217/379 (57%), Positives = 279/379 (73%), Gaps = 1/379 (0%)

Query: 9   PYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDA 68
            +VR  + +    P    GI  W+    F TPKD +LT L I  L + +P I  W+F+DA
Sbjct: 7   AFVRHTIEEAKPAPSSAVGISHWLRTKLFATPKDTVLTVLAIAFLAYLLPPIFKWLFVDA 66

Query: 69  VWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSI 128
           VW G++R  C T SQGG   DG + ACWAF+  ++ Q +FG YP+ +RWRPILV +  +I
Sbjct: 67  VWTGTDRIACLTASQGGALADGQSGACWAFVSAKFGQIMFGRYPIDERWRPILVMVMFTI 126

Query: 129 LLTPMLIPSFPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFG 187
           LL PMLIP  P K LN++ LF + P+   F ++ G  GL +VET LWGGL+VTL++SFFG
Sbjct: 127 LLVPMLIPKAPFKRLNALALFIILPVIAFFLLIGGVFGLPVVETQLWGGLMVTLILSFFG 186

Query: 188 IIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVD 247
           I +S+P GILLALGR SN+PV++  C+ FIE+ RG+PL+TVLF ASIMLPLFLPD W  D
Sbjct: 187 IAVSLPFGILLALGRRSNLPVIKMLCVLFIEVIRGIPLITVLFFASIMLPLFLPDGWTFD 246

Query: 248 KLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVI 307
           K LRAL+GVS F+SAY+AEV+RGGLQ+I KGQ+E A+SLGL+Y QK RLI++PQ +K VI
Sbjct: 247 KFLRALVGVSLFSSAYMAEVIRGGLQAIPKGQYEGADSLGLNYWQKTRLIVLPQALKLVI 306

Query: 308 PGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCF 367
           PGIVNTFIGLFKD+SL+SII MFDLLGIV +N S++ W + VT  TG IF GF+FWIFCF
Sbjct: 307 PGIVNTFIGLFKDTSLVSIIGMFDLLGIVTLNQSDANWATPVTAMTGYIFAGFIFWIFCF 366

Query: 368 SISLYSVFIEKTLHKGSKK 386
            +S YS+F+E+ L  G K+
Sbjct: 367 GMSRYSLFMERHLDTGHKR 385


>gi|306843690|ref|ZP_07476290.1| amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine family [Brucella sp. BO1]
 gi|306276000|gb|EFM57709.1| amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine family [Brucella sp. BO1]
          Length = 385

 Score =  292 bits (748), Expect = 4e-77,   Method: Composition-based stats.
 Identities = 220/382 (57%), Positives = 285/382 (74%), Gaps = 1/382 (0%)

Query: 6   KEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVF 65
            +  YVR +++    PP   +GI  W+  N F TP D  LT   + L+++ +  II W+F
Sbjct: 4   ADLQYVRTQMVDGEAPPRSVQGISHWLRVNLFATPVDAALTIFGLVLVVWFVLPIIEWLF 63

Query: 66  LDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLT 125
           ++A W G++RT C T +QGG QPDGW+ ACWAF+  +YEQF++G YP+++RWR  L  L 
Sbjct: 64  INAAWTGTSRTACLTAAQGGAQPDGWSGACWAFVNAKYEQFLYGRYPISERWRVDLTALI 123

Query: 126 GSILLTPMLIPSFPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVIS 184
            + LL P+LIP  P+K LN+IL F +FP+   F ++ G  GL  VET LWGGLLVTLV+S
Sbjct: 124 FAALLVPLLIPKVPKKGLNAILFFLVFPVVAFFLLVGGWFGLPYVETPLWGGLLVTLVLS 183

Query: 185 FFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTW 244
           F GI +S+PLGI+LALGR S +PV++   I FIE+ RGVPLVTVLFMAS+MLPLFLP   
Sbjct: 184 FVGIAVSLPLGIVLALGRRSKLPVIKTLSIIFIEMVRGVPLVTVLFMASVMLPLFLPPGV 243

Query: 245 DVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIK 304
             DKLLRAL+GV+ FASAY+AEV+RGGLQ+I +GQ+E A++LGLSY QK  L+++PQ +K
Sbjct: 244 TFDKLLRALIGVALFASAYMAEVVRGGLQAIPRGQYEGADALGLSYWQKTGLVVLPQALK 303

Query: 305 RVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWI 364
            VIPGIVNTFIGLFKD+SL+ II MFDLLGIVR NFS++ W S  TP TGLIF GFVFWI
Sbjct: 304 LVIPGIVNTFIGLFKDTSLVYIIGMFDLLGIVRQNFSDANWASPQTPATGLIFAGFVFWI 363

Query: 365 FCFSISLYSVFIEKTLHKGSKK 386
           FCF++S YS+F+E+ L  G K+
Sbjct: 364 FCFAMSRYSIFMERRLDTGHKR 385


>gi|163843016|ref|YP_001627420.1| His/Glu/Gln/Arg/opine amino acid ABC transporter permease [Brucella
           suis ATCC 23445]
 gi|163673739|gb|ABY37850.1| amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine family [Brucella suis ATCC 23445]
          Length = 385

 Score =  292 bits (747), Expect = 7e-77,   Method: Composition-based stats.
 Identities = 220/382 (57%), Positives = 286/382 (74%), Gaps = 1/382 (0%)

Query: 6   KEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVF 65
            +  YVR +++    PP   +GI  W+  N F TP D  LT   + L+++ +P II W+F
Sbjct: 4   ADLQYVRTQMVDGETPPRSVQGISHWLRVNLFATPVDAALTIFGLVLVVWFVPPIIEWLF 63

Query: 66  LDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLT 125
           ++A W G++RT C T +QGG QPDGW+ A WAF+  +YEQF++G YP+++RWR  L  L 
Sbjct: 64  INAAWTGTSRTACLTAAQGGAQPDGWSGAYWAFVNAKYEQFLYGRYPISERWRVDLTALI 123

Query: 126 GSILLTPMLIPSFPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVIS 184
            + LL P+LIP  P+K LN+IL F +FP+   F ++ G  GL  VET LWGGLLVTLV+S
Sbjct: 124 FAALLVPLLIPKIPKKGLNAILFFLVFPVVAFFLLVGGWFGLPYVETPLWGGLLVTLVLS 183

Query: 185 FFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTW 244
           F GI +S+PLGI+LALGR S +PV++   I+FIE+ RGVPLVTVLFMAS+MLPLFLP   
Sbjct: 184 FVGIAVSLPLGIVLALGRRSKLPVIKTLSISFIEMVRGVPLVTVLFMASVMLPLFLPPGV 243

Query: 245 DVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIK 304
             DKLLRAL+GV+ FASAY+AEV+RGGLQ+I +GQ+E A++LGLSY QK  L+++PQ +K
Sbjct: 244 TFDKLLRALIGVALFASAYMAEVVRGGLQAIPRGQYEGADALGLSYWQKTGLVVLPQALK 303

Query: 305 RVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWI 364
            VIPGIVNTFIGLFKD+SL+ II MFDLLGIVR NFS++ W S  TP TGLIF GFVFWI
Sbjct: 304 LVIPGIVNTFIGLFKDTSLVYIIGMFDLLGIVRQNFSDANWASPQTPATGLIFAGFVFWI 363

Query: 365 FCFSISLYSVFIEKTLHKGSKK 386
           FCF++S YS+F+E+ L  G K+
Sbjct: 364 FCFAMSRYSIFMERRLDTGHKR 385


>gi|307316994|ref|ZP_07596435.1| polar amino acid ABC transporter, inner membrane subunit
           [Sinorhizobium meliloti AK83]
 gi|306897082|gb|EFN27827.1| polar amino acid ABC transporter, inner membrane subunit
           [Sinorhizobium meliloti AK83]
          Length = 384

 Score =  291 bits (744), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 222/383 (57%), Positives = 287/383 (74%), Gaps = 1/383 (0%)

Query: 4   SCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHW 63
           S  +  +VR  +++ S  P  + G+++W+ KN F TPKD  LT + + +L + +P  I W
Sbjct: 2   STNQASFVRASMIEASPAPSLESGVVSWLRKNLFATPKDTALTIISLLILAWLVPPAIQW 61

Query: 64  VFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVF 123
           +F+DA W G  R VC T+SQGG QP+GW+ ACWAF+  ++ QF+FG YP+ +RWRP LV 
Sbjct: 62  LFIDAAWSGGGRGVCATLSQGGSQPEGWSGACWAFVNAKFAQFLFGRYPLDERWRPALVG 121

Query: 124 LTGSILLTPMLIPSFPRKFLNSILLFGLFPIFS-FFVLYGGLGLSIVETSLWGGLLVTLV 182
           +   +LL PMLIP  P K LN++LL    PI S   +  G  GL+ VET LWGGL+VTLV
Sbjct: 122 ILFVLLLVPMLIPRIPYKGLNALLLLVALPILSAILLPGGWFGLTYVETPLWGGLMVTLV 181

Query: 183 ISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPD 242
           +SF GI +S+PLGILLALGR SN+PV++  C  FIE+ RGVPL+TVLFMAS+MLPLFLP 
Sbjct: 182 LSFVGIAVSLPLGILLALGRRSNMPVIKMLCTVFIEVIRGVPLITVLFMASVMLPLFLPQ 241

Query: 243 TWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQV 302
               DK LRAL+GVS FASAY+AEV+RGGLQ+I KGQ+E A+SLGLS+ QKM  I++PQ 
Sbjct: 242 GVTFDKFLRALIGVSLFASAYMAEVVRGGLQAIPKGQYEGADSLGLSFWQKMGFIVLPQA 301

Query: 303 IKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVF 362
           +K VIPGIVNTFIGLFKD+SL+SII MFDLLGIVR+NFS++ W ++VTP TGLIF GFVF
Sbjct: 302 LKLVIPGIVNTFIGLFKDTSLVSIIGMFDLLGIVRLNFSDTNWATAVTPLTGLIFAGFVF 361

Query: 363 WIFCFSISLYSVFIEKTLHKGSK 385
           W+FCF +S YS F+E+ L +  +
Sbjct: 362 WLFCFGMSRYSGFMERLLDRSQR 384


>gi|15965229|ref|NP_385582.1| general L-amino acid transport permease ABC transporter protein
           [Sinorhizobium meliloti 1021]
 gi|307309252|ref|ZP_07588920.1| polar amino acid ABC transporter, inner membrane subunit
           [Sinorhizobium meliloti BL225C]
 gi|15074409|emb|CAC46055.1| Probable general L-amino acid transport permease ABC transporter
           [Sinorhizobium meliloti 1021]
 gi|306900253|gb|EFN30870.1| polar amino acid ABC transporter, inner membrane subunit
           [Sinorhizobium meliloti BL225C]
          Length = 384

 Score =  290 bits (743), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 222/383 (57%), Positives = 286/383 (74%), Gaps = 1/383 (0%)

Query: 4   SCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHW 63
           S  +  +VR  +++ S  P  + G ++W+ KN F TPKD  LT + + +L + +P  I W
Sbjct: 2   STNQASFVRASMIEASPAPSLESGAVSWLRKNLFATPKDTALTIISLLILAWLVPPAIQW 61

Query: 64  VFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVF 123
           +F+DA W G  R VC T+SQGG QP+GW+ ACWAF+  ++ QF+FG YP+ +RWRP LV 
Sbjct: 62  LFIDAAWSGGGRGVCATLSQGGSQPEGWSGACWAFVNAKFAQFLFGRYPLDERWRPALVG 121

Query: 124 LTGSILLTPMLIPSFPRKFLNSILLFGLFPIFS-FFVLYGGLGLSIVETSLWGGLLVTLV 182
           +   +LL PMLIP  P K LN++LL    PI S   +  G  GL+ VET LWGGL+VTLV
Sbjct: 122 ILFVLLLVPMLIPRIPYKGLNALLLLVALPILSAILLPGGWFGLTYVETPLWGGLMVTLV 181

Query: 183 ISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPD 242
           +SF GI +S+PLGILLALGR SN+PV++  C  FIE+ RGVPL+TVLFMAS+MLPLFLP 
Sbjct: 182 LSFVGIAVSLPLGILLALGRRSNMPVIKMLCTVFIEVIRGVPLITVLFMASVMLPLFLPQ 241

Query: 243 TWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQV 302
               DK LRAL+GVS FASAY+AEV+RGGLQ+I KGQ+E A+SLGLS+ QKM  I++PQ 
Sbjct: 242 GVTFDKFLRALIGVSLFASAYMAEVVRGGLQAIPKGQYEGADSLGLSFWQKMGFIVLPQA 301

Query: 303 IKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVF 362
           +K VIPGIVNTFIGLFKD+SL+SII MFDLLGIVR+NFS++ W ++VTP TGLIF GFVF
Sbjct: 302 LKLVIPGIVNTFIGLFKDTSLVSIIGMFDLLGIVRLNFSDTNWATAVTPLTGLIFAGFVF 361

Query: 363 WIFCFSISLYSVFIEKTLHKGSK 385
           W+FCF +S YS F+E+ L +  +
Sbjct: 362 WLFCFGMSRYSGFMERLLDRSQR 384


>gi|150396325|ref|YP_001326792.1| polar amino acid ABC transporter inner membrane subunit
           [Sinorhizobium medicae WSM419]
 gi|150027840|gb|ABR59957.1| polar amino acid ABC transporter, inner membrane subunit
           [Sinorhizobium medicae WSM419]
          Length = 384

 Score =  290 bits (741), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 220/383 (57%), Positives = 285/383 (74%), Gaps = 1/383 (0%)

Query: 4   SCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHW 63
           S ++  +VR  +++ S  P  +RG  +W+ +N F TPKD +LT + + +L + +P  I W
Sbjct: 2   STQQATFVRASMIEASPAPSLERGAASWLRRNLFATPKDSVLTIISLLILAWLVPPAIQW 61

Query: 64  VFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVF 123
           +F+DA W G  R VC T+SQGG QP+GW+ ACWAF+  ++ QF+FG YP+ +RWRP LV 
Sbjct: 62  LFIDAAWSGGGRGVCATLSQGGSQPEGWSGACWAFVNAKFAQFLFGRYPLDERWRPALVG 121

Query: 124 LTGSILLTPMLIPSFPRK-FLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLV 182
           +   +LL PMLIP  P K     +LL  L  + +  +  G  GL+ VET LWGGL+VTLV
Sbjct: 122 ILFVLLLVPMLIPRIPYKGLNALLLLGALPVLAAILLPGGWFGLTYVETPLWGGLMVTLV 181

Query: 183 ISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPD 242
           +SF GI +S+PLGILLALGR SN+PV++  C  FIE+ RGVPL+TVLFMAS+MLPLFLP 
Sbjct: 182 LSFVGIAVSLPLGILLALGRRSNMPVIKMLCTAFIEVIRGVPLITVLFMASVMLPLFLPQ 241

Query: 243 TWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQV 302
               DK LRAL+GVS FASAY+AEV+RGGLQ+I KGQ+E A+SLGLSY QKM  I++PQ 
Sbjct: 242 GVTFDKFLRALIGVSLFASAYMAEVVRGGLQAIPKGQYEGADSLGLSYWQKMGFIVLPQA 301

Query: 303 IKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVF 362
           +K VIPGIVNTFIGLFKD+SL+SII MFDLLGIVR+NFS++ W S+VTP TGLIF GFVF
Sbjct: 302 LKLVIPGIVNTFIGLFKDTSLVSIIGMFDLLGIVRLNFSDTNWASAVTPLTGLIFAGFVF 361

Query: 363 WIFCFSISLYSVFIEKTLHKGSK 385
           W+FCF +S YS F+E+ L +  +
Sbjct: 362 WLFCFGMSRYSGFMERLLDRSQR 384


>gi|227821878|ref|YP_002825848.1| putative amino acid ABC transporter, permease protein
           [Sinorhizobium fredii NGR234]
 gi|227340877|gb|ACP25095.1| putative amino acid ABC transporter, permease protein
           [Sinorhizobium fredii NGR234]
          Length = 384

 Score =  290 bits (741), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 222/383 (57%), Positives = 286/383 (74%), Gaps = 1/383 (0%)

Query: 4   SCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHW 63
           S  +  +VR  ++  S  P  + G+++W+ KN F TPKD +LT + + +L + +P  I W
Sbjct: 2   STNQAAFVRSSMVDASPAPALESGVVSWLRKNLFATPKDTVLTIISLLILAWLVPPAIQW 61

Query: 64  VFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVF 123
           +F+DA W G  R VC T+SQGG QPDGW+ ACWAF+  ++ QF+FG YP+ +RWRP LV 
Sbjct: 62  LFIDAAWTGGGRGVCATLSQGGSQPDGWSGACWAFVNAKFGQFVFGRYPLEERWRPALVG 121

Query: 124 LTGSILLTPMLIPSFPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLV 182
           +   + L PMLIP  P K LN+ILLF   PI  +  +  G LGL  VET+ WGGL+VTL 
Sbjct: 122 ILFVLFLVPMLIPKIPYKGLNAILLFAALPIVATILLPGGWLGLVYVETAFWGGLMVTLA 181

Query: 183 ISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPD 242
           +SF GI +S+PLGILLALGR S++PV++  C  FIE+ RG+PL+TVLFMAS+MLPLFLP 
Sbjct: 182 LSFVGIAVSLPLGILLALGRRSDMPVIKMLCTVFIEIVRGIPLITVLFMASVMLPLFLPQ 241

Query: 243 TWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQV 302
               DK LRAL+GVS FASAY+AEV+RGGLQ+I KGQ+E A+SLGLSY QKM LI++PQ 
Sbjct: 242 GVTFDKFLRALIGVSFFASAYMAEVVRGGLQAIPKGQYEGADSLGLSYWQKMNLIVLPQA 301

Query: 303 IKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVF 362
           +K VIPGIVNTFIGLFKD+SL+SII MFDLLGIVR NF+++ W ++VTP TGLIF GFVF
Sbjct: 302 LKLVIPGIVNTFIGLFKDTSLVSIIGMFDLLGIVRFNFTDANWATAVTPITGLIFAGFVF 361

Query: 363 WIFCFSISLYSVFIEKTLHKGSK 385
           W+FCF +S YS F+E+ L K  +
Sbjct: 362 WLFCFGMSRYSGFMERLLDKSQR 384


>gi|150378347|ref|YP_001314941.1| polar amino acid ABC transporter, inner membrane subunit
           [Sinorhizobium medicae WSM419]
 gi|150032894|gb|ABR65008.1| polar amino acid ABC transporter, inner membrane subunit
           [Sinorhizobium medicae WSM419]
          Length = 384

 Score =  288 bits (737), Expect = 9e-76,   Method: Composition-based stats.
 Identities = 220/383 (57%), Positives = 285/383 (74%), Gaps = 1/383 (0%)

Query: 4   SCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHW 63
           S ++  +VR  +++ S  P  +RG  +W+ +N F TPKD +LT + + +L + +P  I W
Sbjct: 2   STQQATFVRASMIEASPAPSLERGAASWLRRNLFATPKDSVLTIISLLILTWLVPPAIQW 61

Query: 64  VFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVF 123
           +F+DA W G  R VC T+SQGG QP+GW+ ACWAF+  ++ QF+FG YP+ +RWRP LV 
Sbjct: 62  LFIDAAWSGGGRGVCATLSQGGSQPEGWSGACWAFVNAKFAQFLFGRYPLDERWRPALVG 121

Query: 124 LTGSILLTPMLIPSFPRK-FLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLV 182
           +   +LL PMLIP  P K     +LL  L  + +  +  G  GL+ VET LWGGL+VTLV
Sbjct: 122 ILFVLLLVPMLIPRIPYKGLNALLLLGALPVLAAILLPGGWFGLTYVETPLWGGLMVTLV 181

Query: 183 ISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPD 242
           +SF GI +S+PLGILLALGR SN+PV++  C  FIE+ RGVPL+TVLFMAS+MLPLFLP 
Sbjct: 182 LSFVGIAVSLPLGILLALGRRSNMPVIKMLCTAFIEVIRGVPLITVLFMASVMLPLFLPQ 241

Query: 243 TWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQV 302
               DK LRAL+GVS FASAY+AEV+RGGLQ+I KGQ+E A+SLGLSY QKM  I++PQ 
Sbjct: 242 GVTFDKFLRALIGVSLFASAYMAEVVRGGLQAIPKGQYEGADSLGLSYWQKMGFIVLPQA 301

Query: 303 IKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVF 362
           +K VIPGIVNTFIGLFKD+SL+SII MFDLLGIVR+NFS++ W S+VTP TGLIF GFVF
Sbjct: 302 LKLVIPGIVNTFIGLFKDTSLVSIIGMFDLLGIVRLNFSDTNWASAVTPLTGLIFAGFVF 361

Query: 363 WIFCFSISLYSVFIEKTLHKGSK 385
           W+FCF +S YS F+E+ L +  +
Sbjct: 362 WLFCFGMSRYSGFMERLLDRSQR 384


>gi|254780172|ref|YP_003064585.1| general L-amino acid transport system permease protein [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254039849|gb|ACT56645.1| general L-amino acid transport system permease protein [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 386

 Score =  288 bits (736), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 386/386 (100%), Positives = 386/386 (100%)

Query: 1   MIDSCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGI 60
           MIDSCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGI
Sbjct: 1   MIDSCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGI 60

Query: 61  IHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPI 120
           IHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPI
Sbjct: 61  IHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPI 120

Query: 121 LVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVT 180
           LVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVT
Sbjct: 121 LVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVT 180

Query: 181 LVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFL 240
           LVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFL
Sbjct: 181 LVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFL 240

Query: 241 PDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMP 300
           PDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMP
Sbjct: 241 PDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMP 300

Query: 301 QVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGF 360
           QVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGF
Sbjct: 301 QVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGF 360

Query: 361 VFWIFCFSISLYSVFIEKTLHKGSKK 386
           VFWIFCFSISLYSVFIEKTLHKGSKK
Sbjct: 361 VFWIFCFSISLYSVFIEKTLHKGSKK 386


>gi|254501118|ref|ZP_05113269.1| ABC transporter, permease protein [Labrenzia alexandrii DFL-11]
 gi|222437189|gb|EEE43868.1| ABC transporter, permease protein [Labrenzia alexandrii DFL-11]
          Length = 383

 Score =  287 bits (733), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 178/381 (46%), Positives = 256/381 (67%), Gaps = 11/381 (2%)

Query: 11  VRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVW 70
           VR         P+   G+I W+ +N F +  + +LT + + L    +   I + F+DAVW
Sbjct: 9   VRTEEAPLLPAPISTTGVIGWMRQNLFSSIGNTILTLIGVLLAYSMLAPFIQFAFIDAVW 68

Query: 71  IGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILL 130
            G NR  C        Q  G + ACWA++   + QFI+G YP+ +R+R  +V+   ++LL
Sbjct: 69  TGDNREACL------PQDGGHSGACWAYVEAYFPQFIYGRYPVEERYRVDIVYALFALLL 122

Query: 131 TPMLIPSFPRKFLNSILLFGLFPIFSF-----FVLYGGLGLSIVETSLWGGLLVTLVISF 185
            P+ IPS P K +N+IL   +FPI ++      V+   + L IVET++WGGLLVTLVI+ 
Sbjct: 123 VPLAIPSAPFKKINAILFLVVFPIIAYFLLTGLVIGDNVVLPIVETAVWGGLLVTLVIAV 182

Query: 186 FGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWD 245
            GI+ S+PLG+ LALGR S +P+++   I FIE +RGVPL+TVLFM+S+MLPLFLP+   
Sbjct: 183 TGIVASLPLGVALALGRRSKMPIIKLVSIIFIEFWRGVPLITVLFMSSVMLPLFLPEGVT 242

Query: 246 VDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKR 305
            DKLLR L+GV+ F++AY+AEV+RGGLQ+I KGQ+E A +LGL +   M LII+PQ +K 
Sbjct: 243 FDKLLRVLIGVTLFSAAYMAEVVRGGLQAIPKGQYEGAMALGLRFWPMMYLIILPQALKL 302

Query: 306 VIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIF 365
           VIPGIVNTFIGLFKD++L+ I+ MFDLLG ++ +F++ TW +     TG +F   +F++F
Sbjct: 303 VIPGIVNTFIGLFKDTTLVLIVGMFDLLGQIQSSFTDPTWSTPSQGHTGYLFAAIIFFVF 362

Query: 366 CFSISLYSVFIEKTLHKGSKK 386
           CF +S YS+++EK LH G K+
Sbjct: 363 CFGMSRYSIYMEKKLHTGHKR 383


>gi|330962157|gb|EGH62417.1| amino acid ABC transporter permease [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 365

 Score =  286 bits (731), Expect = 5e-75,   Method: Composition-based stats.
 Identities = 176/375 (46%), Positives = 241/375 (64%), Gaps = 14/375 (3%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
                   PP    G +AW+ +N F +  + LLT   + L+   +P I+ W  LDA WIG
Sbjct: 4   HTFKPDMPPPGKVFGPVAWMRQNLFSSWINTLLTLFSLYLIYLIVPPILSWALLDANWIG 63

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
           + +  CT              ACW FI  R+ QF++G +P   RWR  L  +   +   P
Sbjct: 64  TTKEDCTKA-----------GACWVFIEQRFGQFMYGYFPNELRWRVDLTAILAIVGAAP 112

Query: 133 MLIPSFPRKFLNSILLFGLFPIFSF-FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIIS 191
           + I  FPRK +  I    ++PI +F  +  G  GL+ V TS WGGL++TLVI+  GI+ +
Sbjct: 113 LFISKFPRKAVYGICFLVIYPIVAFYLLHGGAFGLTNVPTSQWGGLMLTLVIATVGIVGA 172

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +PLGILLALGR SN+P +R  C+TFIE +RGVPL+TVLFM+S+MLPLF+P+  + DKLLR
Sbjct: 173 LPLGILLALGRRSNMPAVRVVCVTFIEFWRGVPLITVLFMSSVMLPLFMPEGMNFDKLLR 232

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
           AL+GV  F SAYIAEV+RGG+Q+I KGQ+EAA+++GL Y + M L+I+PQ +K VIPGIV
Sbjct: 233 ALIGVILFQSAYIAEVVRGGMQAIPKGQYEAASAMGLGYWRSMGLVILPQALKMVIPGIV 292

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISL 371
           NTFI LFKD+SL+ II +FDLL  V+   ++  W+     T G +F   VFWIFCF +S 
Sbjct: 293 NTFIALFKDTSLVIIIGLFDLLNSVKQATADPAWLG--MATEGYVFAALVFWIFCFGMSR 350

Query: 372 YSVFIEKTLHKGSKK 386
           YS+ +E+ L  G K+
Sbjct: 351 YSMHLERKLDTGHKR 365


>gi|330873113|gb|EGH07262.1| amino acid ABC transporter permease [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
 gi|330963201|gb|EGH63461.1| amino acid ABC transporter permease [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 365

 Score =  285 bits (730), Expect = 6e-75,   Method: Composition-based stats.
 Identities = 175/375 (46%), Positives = 240/375 (64%), Gaps = 14/375 (3%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
                   PP    G +AW+ +N F +  + LLT   + L+   +P I+ W  LDA WIG
Sbjct: 4   HTFKPDMPPPGKVFGPVAWMRQNLFSSWINTLLTLFSLYLIYLVVPPILSWALLDANWIG 63

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
           + +  CT              ACW FI  R+ QF++G +P   RWR  L  +   +   P
Sbjct: 64  TTKEDCTKA-----------GACWVFIEQRFGQFMYGYFPNELRWRVDLTAILAIVGAAP 112

Query: 133 MLIPSFPRKFLNSILLFGLFPIFSF-FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIIS 191
           + I  FPRK +  I    ++P+ +F  +  G  GL+ V TS WGGL++TLVI+  GI+ +
Sbjct: 113 LFISKFPRKAVYGICFLVIYPVVAFYLLHGGAFGLTNVPTSQWGGLMLTLVIATVGIVGA 172

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +PLGILLALGR SN+P +R  C+TFIE +RGVPL+TVLFM+S+MLPLF+P+  + DKLLR
Sbjct: 173 LPLGILLALGRRSNMPAVRVVCVTFIEFWRGVPLITVLFMSSVMLPLFMPEGMNFDKLLR 232

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
           AL+GV  F SAYIAEV+RGG+Q+I KGQ+EAA+++GL Y + M L+I+PQ +K VIPGIV
Sbjct: 233 ALIGVILFQSAYIAEVVRGGMQAIPKGQYEAASAMGLGYWRAMGLVILPQALKMVIPGIV 292

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISL 371
           NTFI LFKD+SL+ II +FDLL  V+   ++  W+     T G +F   VFWIFCF +S 
Sbjct: 293 NTFIALFKDTSLVIIIGLFDLLNSVKQATADPAWLG--MATEGYVFAALVFWIFCFGMSR 350

Query: 372 YSVFIEKTLHKGSKK 386
           YS+ +E  L  G K+
Sbjct: 351 YSMHLEHKLDTGHKR 365


>gi|28868468|ref|NP_791087.1| amino acid ABC transporter permease [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|213967084|ref|ZP_03395233.1| amino acid ABC transporter, permease protein [Pseudomonas syringae
           pv. tomato T1]
 gi|301386370|ref|ZP_07234788.1| amino acid ABC transporter, permease protein [Pseudomonas syringae
           pv. tomato Max13]
 gi|302062366|ref|ZP_07253907.1| amino acid ABC transporter, permease protein [Pseudomonas syringae
           pv. tomato K40]
 gi|302133058|ref|ZP_07259048.1| amino acid ABC transporter, permease protein [Pseudomonas syringae
           pv. tomato NCPPB 1108]
 gi|28851706|gb|AAO54782.1| amino acid ABC transporter, permease protein [Pseudomonas syringae
           pv. tomato str. DC3000]
 gi|213927926|gb|EEB61472.1| amino acid ABC transporter, permease protein [Pseudomonas syringae
           pv. tomato T1]
 gi|331015250|gb|EGH95306.1| amino acid ABC transporter, permease protein [Pseudomonas syringae
           pv. lachrymans str. M302278PT]
          Length = 365

 Score =  285 bits (729), Expect = 9e-75,   Method: Composition-based stats.
 Identities = 175/375 (46%), Positives = 240/375 (64%), Gaps = 14/375 (3%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
                   PP    G +AW+ +N F +  + LLT   + L+   +P I+ W  LDA WIG
Sbjct: 4   HTFKPDMPPPGKVFGPVAWMRQNLFSSWINTLLTLFSLYLIYLIVPPILSWALLDANWIG 63

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
           + +  CT              ACW FI  R+ QF++G +P   RWR  L  +   +   P
Sbjct: 64  TTKEDCTKA-----------GACWVFIEQRFGQFMYGYFPNELRWRVDLTAILAIVGAAP 112

Query: 133 MLIPSFPRKFLNSILLFGLFPIFSF-FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIIS 191
           + I  FPRK +  I    ++P+ +F  +  G  GL+ V TS WGGL++TLVI+  GI+ +
Sbjct: 113 LFISKFPRKAVYGICFLLIYPVVAFYLLHGGAFGLTNVPTSQWGGLMLTLVIATVGIVGA 172

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +PLGILLALGR SN+P +R  C+TFIE +RGVPL+TVLFM+S+MLPLF+P+  + DKLLR
Sbjct: 173 LPLGILLALGRRSNMPAVRVVCVTFIEFWRGVPLITVLFMSSVMLPLFMPEGMNFDKLLR 232

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
           AL+GV  F SAYIAEV+RGG+Q+I KGQ+EAA+++GL Y + M L+I+PQ +K VIPGIV
Sbjct: 233 ALIGVILFQSAYIAEVVRGGMQAIPKGQYEAASAMGLGYWRAMGLVILPQALKMVIPGIV 292

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISL 371
           NTFI LFKD+SL+ II +FDLL  V+   ++  W+     T G +F   VFWIFCF +S 
Sbjct: 293 NTFIALFKDTSLVIIIGLFDLLNSVKQATADPAWLG--MATEGYVFAALVFWIFCFGMSR 350

Query: 372 YSVFIEKTLHKGSKK 386
           YS+ +E  L  G K+
Sbjct: 351 YSMHLEHKLDTGHKR 365


>gi|312959112|ref|ZP_07773631.1| amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine [Pseudomonas fluorescens WH6]
 gi|311286882|gb|EFQ65444.1| amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine [Pseudomonas fluorescens WH6]
          Length = 365

 Score =  284 bits (727), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 178/375 (47%), Positives = 237/375 (63%), Gaps = 14/375 (3%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
                   PP    G +AW+  N F +  + LLT L I L+   +P I+HW  LDA W+G
Sbjct: 4   HTFKPDMPPPSKVFGPVAWMRANLFSSWLNTLLTLLSIYLVYLVVPPILHWAILDANWVG 63

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
           + R  CT              ACW FI  R+ QF++G YP   RWR  L      + + P
Sbjct: 64  TTRADCTKE-----------GACWVFIQQRFGQFMYGYYPGDLRWRVDLTVWLAIVGVAP 112

Query: 133 MLIPSFPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIIS 191
           + I  F  K +  +    L+PI   F +  G  GL+ V TS WGGL++TLVI+  GI  +
Sbjct: 113 LFISRFAHKAIYGLSFLVLYPIVAYFLLHGGVFGLANVATSQWGGLMLTLVIATVGIAGA 172

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +PLGI+LALGR SN+P +R  C+TFIE +RGVPL+TVLFM+S+MLPLFLP+  + DKLLR
Sbjct: 173 LPLGIVLALGRRSNMPAIRVVCVTFIEFWRGVPLITVLFMSSVMLPLFLPEGMNFDKLLR 232

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
           AL+GV  F SAY+AEV+RGGLQ+I KGQ+EAA ++GL Y + M L+I+PQ +K VIPGIV
Sbjct: 233 ALIGVILFQSAYVAEVVRGGLQAIPKGQYEAAAAMGLGYWRSMGLVILPQALKLVIPGIV 292

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISL 371
           NTFI LFKD+SL+ II +FDLL  V+   ++  W+     T G +F   VFWIFCF +S 
Sbjct: 293 NTFIALFKDTSLVIIIGLFDLLNSVKQAAADPKWLG--MATEGYVFAALVFWIFCFGMSR 350

Query: 372 YSVFIEKTLHKGSKK 386
           YS+ +E+ L  G K+
Sbjct: 351 YSMHLERKLDTGHKR 365


>gi|289647198|ref|ZP_06478541.1| amino acid ABC transporter, permease protein [Pseudomonas syringae
           pv. aesculi str. 2250]
          Length = 365

 Score =  284 bits (726), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 174/375 (46%), Positives = 239/375 (63%), Gaps = 14/375 (3%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
                   PP    G +AW+ +N F +  + LLT   + L+   +P II W  LDA W+G
Sbjct: 4   HTFKPDMPPPGKVFGPMAWMRQNLFSSWINTLLTLFSLYLIYLVVPPIISWALLDANWVG 63

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
           + +  CT              ACW FI  R+ QF++G +P    WR  L  +   +   P
Sbjct: 64  TTKDDCTKA-----------GACWVFIEQRFGQFMYGYFPNELHWRVDLTAVLAIVGAAP 112

Query: 133 MLIPSFPRKFLNSILLFGLFPIFSF-FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIIS 191
           + I  F RK +  I    ++PI +F  +  G  GL+ V TS WGGL++TLVI+  GI+ +
Sbjct: 113 LFISKFQRKAVYGIAFLVIYPIVAFYLLHGGAFGLTNVPTSQWGGLMLTLVIATVGIVGA 172

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +PLGILLALGR SN+P +R  C+TFIE +RGVPL+TVLFM+S+MLPLF+P+  + DKLLR
Sbjct: 173 LPLGILLALGRRSNMPAVRVVCVTFIEFWRGVPLITVLFMSSVMLPLFMPEGMNFDKLLR 232

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
           AL+GV  F SAYIAEV+RGG+Q+I KGQ+EAA+++GL Y + M L+I+PQ +K VIPGIV
Sbjct: 233 ALIGVILFQSAYIAEVVRGGMQAIPKGQYEAASAMGLGYWRSMGLVILPQALKMVIPGIV 292

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISL 371
           NTFI LFKD+SL+ II +FDLL  V+   ++  W+     T G +F   VFWIFCF +S 
Sbjct: 293 NTFIALFKDTSLVIIIGLFDLLNSVKQATADPAWLG--MATEGYVFAALVFWIFCFGMSR 350

Query: 372 YSVFIEKTLHKGSKK 386
           YS+ +E+ L  G K+
Sbjct: 351 YSMHLERKLDTGHKR 365


>gi|298485802|ref|ZP_07003881.1| ABC-type amino acid transport system, permease component yhdY
           [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
 gi|298159828|gb|EFI00870.1| ABC-type amino acid transport system, permease component yhdY
           [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
          Length = 365

 Score =  284 bits (726), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 175/375 (46%), Positives = 240/375 (64%), Gaps = 14/375 (3%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
                   PP    G +AW+ +N F +  + LLT   + L+   +P II W  LDA W+G
Sbjct: 4   HTFKPDMPPPGKVFGPMAWLRQNLFSSWINTLLTLFSLYLIYLVVPPIISWALLDANWVG 63

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
           + +  CT              ACW FI  R+ QF++G +P   RWR  L  +   +   P
Sbjct: 64  TTKEDCTKA-----------GACWVFIEQRFGQFMYGYFPNELRWRVDLTAVLAIVGAAP 112

Query: 133 MLIPSFPRKFLNSILLFGLFPIFSF-FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIIS 191
           + I  F RK +  I    ++PI +F  +  G  GL+ V TS WGGL++TLVI+  GI+ +
Sbjct: 113 LFISKFQRKAVYGIAFLVIYPIVAFYLLHGGAFGLTNVPTSQWGGLMLTLVIATVGIVGA 172

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +PLGILLALGR SN+P +R  C+TFIE +RGVPL+TVLFM+S+MLPLF+P+  + DKLLR
Sbjct: 173 LPLGILLALGRRSNMPAVRVVCVTFIEFWRGVPLITVLFMSSVMLPLFMPEGMNFDKLLR 232

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
           AL+GV  F SAYIAEV+RGG+Q+I KGQ+EAA+++GL Y + M L+I+PQ +K VIPGIV
Sbjct: 233 ALIGVILFQSAYIAEVVRGGMQAIPKGQYEAASAMGLGYWRSMGLVILPQALKMVIPGIV 292

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISL 371
           NTFI LFKD+SL+ II +FDLL  V+   ++  W+     T G +F   VFWIFCF +S 
Sbjct: 293 NTFIALFKDTSLVIIIGLFDLLNSVKQATADPAWLG--MATEGYVFAALVFWIFCFGMSR 350

Query: 372 YSVFIEKTLHKGSKK 386
           YS+ +E+ L  G K+
Sbjct: 351 YSMHLERKLDTGHKR 365


>gi|257487408|ref|ZP_05641449.1| amino acid ABC transporter, permease protein [Pseudomonas syringae
           pv. tabaci ATCC 11528]
 gi|289628607|ref|ZP_06461561.1| amino acid ABC transporter, permease protein [Pseudomonas syringae
           pv. aesculi str. NCPPB3681]
 gi|330867830|gb|EGH02539.1| amino acid ABC transporter permease [Pseudomonas syringae pv.
           aesculi str. 0893_23]
 gi|331009000|gb|EGH89056.1| amino acid ABC transporter permease [Pseudomonas syringae pv.
           tabaci ATCC 11528]
          Length = 365

 Score =  283 bits (725), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 175/375 (46%), Positives = 240/375 (64%), Gaps = 14/375 (3%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
                   PP    G +AW+ +N F +  + LLT   + L+   +P II W  LDA W+G
Sbjct: 4   HTFKPDMPPPGKVFGPMAWMRQNLFSSWINTLLTLFSLYLIYLVVPPIISWALLDANWVG 63

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
           + +  CT              ACW FI  R+ QF++G +P   RWR  L  +   +   P
Sbjct: 64  TTKEDCTKA-----------GACWVFIEQRFGQFMYGYFPNELRWRVDLTAVLAIVGAAP 112

Query: 133 MLIPSFPRKFLNSILLFGLFPIFSF-FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIIS 191
           + I  F RK +  I    ++PI +F  +  G  GL+ V TS WGGL++TLVI+  GI+ +
Sbjct: 113 LFISKFQRKAVYGIAFLVIYPIVAFYLLHGGAFGLTNVPTSQWGGLMLTLVIATVGIVGA 172

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +PLGILLALGR SN+P +R  C+TFIE +RGVPL+TVLFM+S+MLPLF+P+  + DKLLR
Sbjct: 173 LPLGILLALGRRSNMPAVRVVCVTFIEFWRGVPLITVLFMSSVMLPLFMPEGMNFDKLLR 232

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
           AL+GV  F SAYIAEV+RGG+Q+I KGQ+EAA+++GL Y + M L+I+PQ +K VIPGIV
Sbjct: 233 ALIGVILFQSAYIAEVVRGGMQAIPKGQYEAASAMGLGYWRSMGLVILPQALKMVIPGIV 292

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISL 371
           NTFI LFKD+SL+ II +FDLL  V+   ++  W+     T G +F   VFWIFCF +S 
Sbjct: 293 NTFIALFKDTSLVIIIGLFDLLNSVKQATADPAWLG--MATEGYVFAALVFWIFCFGMSR 350

Query: 372 YSVFIEKTLHKGSKK 386
           YS+ +E+ L  G K+
Sbjct: 351 YSMHLERKLDTGHKR 365


>gi|330887727|gb|EGH20388.1| amino acid ABC transporter permease [Pseudomonas syringae pv. mori
           str. 301020]
          Length = 365

 Score =  283 bits (725), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 175/375 (46%), Positives = 240/375 (64%), Gaps = 14/375 (3%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
                   PP    G +AW+ +N F +  + LLT   + L+   +P II W  LDA W+G
Sbjct: 4   HTFKPDMPPPGKVFGPMAWMRQNLFSSWINTLLTLFSLYLIYLVVPPIISWALLDANWVG 63

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
           + +  CT              ACW FI  R+ QF++G +P   RWR  L  +   +   P
Sbjct: 64  TTKEDCTKA-----------GACWVFIEQRFGQFMYGYFPNELRWRVDLTAILAIVGAAP 112

Query: 133 MLIPSFPRKFLNSILLFGLFPIFSF-FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIIS 191
           + I  F RK +  I    ++PI +F  +  G  GL+ V TS WGGL++TLVI+  GI+ +
Sbjct: 113 LFISKFQRKAVYGIAFLVIYPIVAFYLLHGGAFGLTNVPTSQWGGLMLTLVIATVGIVGA 172

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +PLGILLALGR SN+P +R  C+TFIE +RGVPL+TVLFM+S+MLPLF+P+  + DKLLR
Sbjct: 173 LPLGILLALGRRSNMPAVRVVCVTFIEFWRGVPLITVLFMSSVMLPLFMPEGMNFDKLLR 232

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
           AL+GV  F SAYIAEV+RGG+Q+I KGQ+EAA+++GL Y + M L+I+PQ +K VIPGIV
Sbjct: 233 ALIGVILFQSAYIAEVVRGGMQAIPKGQYEAASAMGLGYWRSMGLVILPQALKMVIPGIV 292

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISL 371
           NTFI LFKD+SL+ II +FDLL  V+   ++  W+     T G +F   VFWIFCF +S 
Sbjct: 293 NTFIALFKDTSLVIIIGLFDLLNSVKQATADPAWLG--MATEGYVFAALVFWIFCFGMSR 350

Query: 372 YSVFIEKTLHKGSKK 386
           YS+ +E+ L  G K+
Sbjct: 351 YSMHLERKLDTGHKR 365


>gi|330988311|gb|EGH86414.1| amino acid ABC transporter permease [Pseudomonas syringae pv.
           lachrymans str. M301315]
          Length = 365

 Score =  283 bits (725), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 175/375 (46%), Positives = 239/375 (63%), Gaps = 14/375 (3%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
                   PP    G +AW+ +N F    + LLT   + L+   +P II W  LDA W+G
Sbjct: 4   HTFKPDMPPPGKVFGPMAWMRQNLFSNWINTLLTLFSLYLIYLVVPPIISWALLDANWVG 63

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
           + +  CT              ACW FI  R+ QF++G +P   RWR  L  +   +   P
Sbjct: 64  TTKEDCTKA-----------GACWVFIEQRFGQFMYGYFPNELRWRVDLTAVLAIVGAAP 112

Query: 133 MLIPSFPRKFLNSILLFGLFPIFSF-FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIIS 191
           + I  F RK +  I    ++PI +F  +  G  GL+ V TS WGGL++TLVI+  GI+ +
Sbjct: 113 LFISKFQRKAVYGIAFLVIYPIVAFYLLHGGAFGLTNVPTSQWGGLMLTLVIATVGIVGA 172

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +PLGILLALGR SN+P +R  C+TFIE +RGVPL+TVLFM+S+MLPLF+P+  + DKLLR
Sbjct: 173 LPLGILLALGRRSNMPAVRVVCVTFIEFWRGVPLITVLFMSSVMLPLFMPEGMNFDKLLR 232

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
           AL+GV  F SAYIAEV+RGG+Q+I KGQ+EAA+++GL Y + M L+I+PQ +K VIPGIV
Sbjct: 233 ALIGVILFQSAYIAEVVRGGMQAIPKGQYEAASAMGLGYWRSMGLVILPQALKMVIPGIV 292

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISL 371
           NTFI LFKD+SL+ II +FDLL  V+   ++  W+     T G +F   VFWIFCF +S 
Sbjct: 293 NTFIALFKDTSLVIIIGLFDLLNSVKQATADPAWLG--MATEGYVFAALVFWIFCFGMSR 350

Query: 372 YSVFIEKTLHKGSKK 386
           YS+ +E+ L  G K+
Sbjct: 351 YSMHLERKLDTGHKR 365


>gi|320325829|gb|EFW81890.1| amino acid ABC transporter, permease protein [Pseudomonas syringae
           pv. glycinea str. B076]
 gi|320327253|gb|EFW83267.1| amino acid ABC transporter, permease protein [Pseudomonas syringae
           pv. glycinea str. race 4]
          Length = 365

 Score =  283 bits (723), Expect = 4e-74,   Method: Composition-based stats.
 Identities = 174/375 (46%), Positives = 239/375 (63%), Gaps = 14/375 (3%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
                   PP    G +AW+ +N F +  + LLT   + L+   +P II W  LDA W+G
Sbjct: 4   HTFKPDMPPPGKVFGPMAWMRQNLFSSWINTLLTLFSLYLIYLVVPPIISWALLDANWVG 63

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
           + +  CT              ACW FI  R+ QF++G +P   RWR  L  +   +   P
Sbjct: 64  TTKADCTKA-----------GACWVFIEQRFGQFMYGYFPNELRWRVDLTAILAIVGAAP 112

Query: 133 MLIPSFPRKFLNSILLFGLFPIFSF-FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIIS 191
           + I  F RK +  I    ++PI +F  +  G  GL+ V TS WGGL++TLVI+  GI+ +
Sbjct: 113 LFISKFQRKAVYGIAFLVIYPIVAFYLLHGGAFGLTNVPTSQWGGLMLTLVIATVGIVGA 172

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +PLGILLALGR SN+P +R  C+TFIE +RGVPL+TVLFM+S+MLPLF+P+  + DKLLR
Sbjct: 173 LPLGILLALGRRSNMPAVRVVCVTFIEFWRGVPLITVLFMSSVMLPLFMPEGMNFDKLLR 232

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
           AL+GV  F SAYIAEV+RGG+Q+I KGQ+EAA+++ L Y + M L+I+PQ +K VIPGIV
Sbjct: 233 ALIGVILFQSAYIAEVVRGGMQAIPKGQYEAASAMDLGYWRSMGLVILPQALKMVIPGIV 292

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISL 371
           NTFI LFKD+SL+ II +FDLL  V+   ++  W+     T G +F   VFWIFCF +S 
Sbjct: 293 NTFIALFKDTSLVIIIGLFDLLNSVKQATADPAWLG--MATEGYVFAALVFWIFCFGMSR 350

Query: 372 YSVFIEKTLHKGSKK 386
           YS+ +E+ L  G K+
Sbjct: 351 YSMHLERKLDTGHKR 365


>gi|167035541|ref|YP_001670772.1| polar amino acid ABC transporter inner membrane subunit
           [Pseudomonas putida GB-1]
 gi|166862029|gb|ABZ00437.1| polar amino acid ABC transporter, inner membrane subunit
           [Pseudomonas putida GB-1]
          Length = 365

 Score =  282 bits (722), Expect = 5e-74,   Method: Composition-based stats.
 Identities = 172/371 (46%), Positives = 237/371 (63%), Gaps = 14/371 (3%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
               PPV   G++AW+  N F +  + LLT   + L+   +P ++ W  +DA W+G+ R 
Sbjct: 8   PDMPPPVKTVGVLAWMRANLFSSWLNTLLTLFALYLVWLIVPPLLQWALIDANWVGTTRA 67

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            CT              ACW F+  R+ QF++G YP   RWR  L      +   P+ I 
Sbjct: 68  DCTKE-----------GACWVFVQQRFGQFMYGYYPAELRWRVDLTVWLAVLGAAPLFIK 116

Query: 137 SFPRKFLNSILLFGLFPIFSF-FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
            FPRK    +    L+P+ ++  +  G LGL  V TS WGGL++TLVI+  GI+ ++PLG
Sbjct: 117 RFPRKAFYGLGFLVLYPVLAYTLLHGGYLGLDSVPTSQWGGLMLTLVIATVGIVGALPLG 176

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           ILLALGR S +P ++  C+TFIE +RGVPL+TVLFM+S+MLPLFLP+    DKLLRA++G
Sbjct: 177 ILLALGRRSRMPAVKVVCVTFIEFWRGVPLITVLFMSSVMLPLFLPEGMSFDKLLRAMIG 236

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           V  F SAYIAEV+RGGLQ+I KGQ+EAA ++GL Y + M L+I+PQ +K VIPGIVNTFI
Sbjct: 237 VILFQSAYIAEVVRGGLQAIPKGQYEAAAAMGLGYWRSMGLVILPQALKLVIPGIVNTFI 296

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD+SL+ II +FDLL  V+   ++  W+     T G +F   VFW+FCF +S YS+ 
Sbjct: 297 ALFKDTSLVIIIGLFDLLNSVKQAAADPAWLG--MATEGYVFAALVFWVFCFGMSRYSMH 354

Query: 376 IEKTLHKGSKK 386
           +E+ L  G K+
Sbjct: 355 LERKLDTGHKR 365


>gi|26988034|ref|NP_743459.1| polar amino acid ABC transporter inner membrane subunit
           [Pseudomonas putida KT2440]
 gi|24982754|gb|AAN66923.1|AE016320_11 general amino acid ABC transporter, permease protein [Pseudomonas
           putida KT2440]
 gi|313500472|gb|ADR61838.1| AapM [Pseudomonas putida BIRD-1]
          Length = 365

 Score =  282 bits (722), Expect = 6e-74,   Method: Composition-based stats.
 Identities = 174/371 (46%), Positives = 237/371 (63%), Gaps = 14/371 (3%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
               PPV   G++AW+  N F +  + LLT   I L+   +P ++ W  +DA W+G+ R 
Sbjct: 8   PDMPPPVKTVGVLAWMRANLFSSWLNTLLTLFAIYLVWLIVPPLLQWALIDANWVGTTRA 67

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            CT              ACW F+  R+ QF++G YP   RWR  L      +   P+ I 
Sbjct: 68  DCTKE-----------GACWVFVQQRFGQFMYGYYPTELRWRVDLTVWLAVLGAAPLFIK 116

Query: 137 SFPRKFLNSILLFGLFPIFSF-FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
            FPRK    +    L+P+ ++  +  G LGL  V TS WGGL++TLVI+  GI+ ++PLG
Sbjct: 117 RFPRKAFYGLGFLVLYPVLAYTLLHGGYLGLESVPTSQWGGLMLTLVIATVGIVGALPLG 176

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           ILLALGR S +P ++  C+TFIE +RGVPL+TVLFM+S+MLPLFLP+    DKLLRA++G
Sbjct: 177 ILLALGRRSRMPAVKVVCVTFIEFWRGVPLITVLFMSSVMLPLFLPEGMSFDKLLRAMIG 236

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           V  F SAYIAEV+RGGLQ+I KGQ+EAA ++GL Y + M L+I+PQ +K VIPGIVNTFI
Sbjct: 237 VILFQSAYIAEVVRGGLQAIPKGQYEAAAAMGLGYWRSMGLVILPQALKLVIPGIVNTFI 296

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD+SL+ II +FDLL  V+   ++  W+     T G +F   VFWIFCF +S YS+ 
Sbjct: 297 ALFKDTSLVIIIGLFDLLNSVKQAAADPAWLG--MATEGYVFAALVFWIFCFGMSRYSMH 354

Query: 376 IEKTLHKGSKK 386
           +E+ L  G K+
Sbjct: 355 LERKLDTGHKR 365


>gi|71737094|ref|YP_273400.1| amino acid ABC transporter permease [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|71557647|gb|AAZ36858.1| amino acid ABC transporter, permease protein [Pseudomonas syringae
           pv. phaseolicola 1448A]
          Length = 365

 Score =  282 bits (721), Expect = 6e-74,   Method: Composition-based stats.
 Identities = 175/375 (46%), Positives = 240/375 (64%), Gaps = 14/375 (3%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
                   PP    G +AW+ +N F +  + LLT   + L+   +P II W  LDA W+G
Sbjct: 4   HTFKPDMPPPGKVFGPMAWMRQNLFSSWINTLLTLFSLYLIYLVVPPIISWALLDANWVG 63

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
           + +  CT              ACW FI  R+ QF++G +P   RWR  L  +   +   P
Sbjct: 64  TTKADCTKA-----------GACWVFIEQRFGQFMYGYFPNELRWRVDLTAILAIVGAAP 112

Query: 133 MLIPSFPRKFLNSILLFGLFPIFSF-FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIIS 191
           + I  F RK +  I    ++PI +F  +  G  GL+ V TS WGGL++TLVI+  GI+ +
Sbjct: 113 LFISKFQRKAVYGIAFLVIYPIVAFYLLHGGAFGLTNVPTSQWGGLMLTLVIATVGIVGA 172

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +PLGILLALGR SN+P +R  C+TFIE +RGVPL+TVLFM+S+MLPLF+P+  + DKLLR
Sbjct: 173 LPLGILLALGRRSNMPAVRVVCVTFIEFWRGVPLITVLFMSSVMLPLFMPEGMNFDKLLR 232

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
           AL+GV  F SAYIAEV+RGG+Q+I KGQ+EAA+++GL Y + M L+I+PQ +K VIPGIV
Sbjct: 233 ALIGVILFQSAYIAEVVRGGMQAIPKGQYEAASAMGLGYWRSMGLVILPQALKMVIPGIV 292

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISL 371
           NTFI LFKD+SL+ II +FDLL  V+   ++  W+     T G +F   VFWIFCF +S 
Sbjct: 293 NTFIALFKDTSLVIIIGLFDLLNSVKQATADPAWLG--MATEGYVFAALVFWIFCFGMSR 350

Query: 372 YSVFIEKTLHKGSKK 386
           YS+ +E+ L  G K+
Sbjct: 351 YSMHLERKLDTGHKR 365


>gi|66044327|ref|YP_234168.1| amino acid ABC transporter permease [Pseudomonas syringae pv.
           syringae B728a]
 gi|63255034|gb|AAY36130.1| Amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine [Pseudomonas syringae pv. syringae
           B728a]
          Length = 365

 Score =  282 bits (721), Expect = 7e-74,   Method: Composition-based stats.
 Identities = 176/375 (46%), Positives = 241/375 (64%), Gaps = 14/375 (3%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
                   PP    G +AW+ +N F +  + LLT   + L+   +P II W  LDA WIG
Sbjct: 4   HTFKPDMPPPGKVFGPMAWMRQNLFSSWINTLLTLFSLYLIYLVVPPIISWALLDANWIG 63

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
           + +  CT              ACW FI  R+ QF++G +P   RWR  L  +   +   P
Sbjct: 64  TTKADCTKA-----------GACWVFIEQRFGQFMYGYFPNELRWRVDLTAILAIVGAAP 112

Query: 133 MLIPSFPRKFLNSILLFGLFPIFSF-FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIIS 191
           + I  FPRK +  I    ++P+ +F  +  G  GL+ V TS WGGL++TLVI+  GI+ +
Sbjct: 113 LFISKFPRKAVYGIAFLVIYPVVAFYLLHGGAFGLTNVPTSQWGGLMLTLVIATVGIVGA 172

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +PLGILLALGR SN+P +R  C+TFIE +RGVPL+TVLFM+S+MLPLF+P+  + DKLLR
Sbjct: 173 LPLGILLALGRRSNMPAVRVVCVTFIEFWRGVPLITVLFMSSVMLPLFMPEGMNFDKLLR 232

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
           AL+GV  F SAYIAEV+RGG+Q+I KGQ+EAA+++GL Y + M L+I+PQ +K VIPGIV
Sbjct: 233 ALIGVILFQSAYIAEVVRGGMQAIPKGQYEAASAMGLGYWRSMGLVILPQALKMVIPGIV 292

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISL 371
           NTFI LFKD+SL+ II +FDLL  V+   ++  W+     T G +F   VFWIFCF +S 
Sbjct: 293 NTFIALFKDTSLVIIIGLFDLLNSVKQATADPAWLG--MATEGYVFAALVFWIFCFGMSR 350

Query: 372 YSVFIEKTLHKGSKK 386
           YS+ +E+ L  G K+
Sbjct: 351 YSMHLERKLDTGHKR 365


>gi|148549628|ref|YP_001269730.1| polar amino acid ABC transporter inner membrane subunit
           [Pseudomonas putida F1]
 gi|148513686|gb|ABQ80546.1| polar amino acid ABC transporter, inner membrane subunit
           [Pseudomonas putida F1]
          Length = 365

 Score =  282 bits (721), Expect = 7e-74,   Method: Composition-based stats.
 Identities = 173/371 (46%), Positives = 237/371 (63%), Gaps = 14/371 (3%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
               PPV   G++AW+  N F +  + LLT   + L+   +P ++ W  +DA W+G+ R 
Sbjct: 8   PDMPPPVKTVGVLAWMRANLFSSWLNTLLTLFALYLVWLIVPPLLQWALIDANWVGTTRA 67

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            CT              ACW F+  R+ QF++G YP   RWR  L      +   P+ I 
Sbjct: 68  DCTKE-----------GACWVFVQQRFGQFMYGYYPTELRWRVDLTVWLAMLGAAPLFIK 116

Query: 137 SFPRKFLNSILLFGLFPIFSF-FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
            FPRK    +    L+P+ ++  +  G LGL  V TS WGGL++TLVI+  GI+ ++PLG
Sbjct: 117 RFPRKAFYGLGFLVLYPVLAYTLLHGGYLGLESVPTSQWGGLMLTLVIATVGIVGALPLG 176

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           ILLALGR S +P ++  C+TFIE +RGVPL+TVLFM+S+MLPLFLP+    DKLLRA++G
Sbjct: 177 ILLALGRRSRMPAVKVVCVTFIEFWRGVPLITVLFMSSVMLPLFLPEGMSFDKLLRAMIG 236

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           V  F SAYIAEV+RGGLQ+I KGQ+EAA ++GL Y + M L+I+PQ +K VIPGIVNTFI
Sbjct: 237 VILFQSAYIAEVVRGGLQAIPKGQYEAAAAMGLGYWRSMGLVILPQALKLVIPGIVNTFI 296

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD+SL+ II +FDLL  V+   ++  W+     T G +F   VFWIFCF +S YS+ 
Sbjct: 297 ALFKDTSLVIIIGLFDLLNSVKQAAADPAWLG--MATEGYVFAALVFWIFCFGMSRYSMH 354

Query: 376 IEKTLHKGSKK 386
           +E+ L  G K+
Sbjct: 355 LERKLDTGHKR 365


>gi|330975708|gb|EGH75774.1| amino acid ABC transporter permease [Pseudomonas syringae pv.
           aptata str. DSM 50252]
          Length = 365

 Score =  282 bits (721), Expect = 8e-74,   Method: Composition-based stats.
 Identities = 176/375 (46%), Positives = 241/375 (64%), Gaps = 14/375 (3%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
                   PP    G +AW+ +N F +  + LLT   + L+   +P II W  LDA WIG
Sbjct: 4   HTFKPDMPPPGKVFGPVAWMRQNLFSSWINTLLTLFSLYLIYLVVPPIISWSLLDANWIG 63

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
           + +  CT              ACW FI  R+ QF++G +P   RWR  L  +   +   P
Sbjct: 64  TTKADCTKA-----------GACWVFIEQRFGQFMYGYFPNELRWRVDLTAILAIVGAAP 112

Query: 133 MLIPSFPRKFLNSILLFGLFPIFSF-FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIIS 191
           + I  FPRK +  I    ++P+ +F  +  G  GL+ V TS WGGL++TLVI+  GI+ +
Sbjct: 113 LFISKFPRKAVYGIAFLVIYPVVAFYLLHGGAFGLTNVPTSQWGGLMLTLVIATVGIVGA 172

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +PLGILLALGR SN+P +R  C+TFIE +RGVPL+TVLFM+S+MLPLF+P+  + DKLLR
Sbjct: 173 LPLGILLALGRRSNMPAVRVVCVTFIEFWRGVPLITVLFMSSVMLPLFMPEGMNFDKLLR 232

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
           AL+GV  F SAYIAEV+RGG+Q+I KGQ+EAA+++GL Y + M L+I+PQ +K VIPGIV
Sbjct: 233 ALIGVILFQSAYIAEVVRGGMQAIPKGQYEAASAMGLGYWRSMGLVILPQALKMVIPGIV 292

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISL 371
           NTFI LFKD+SL+ II +FDLL  V+   ++  W+     T G +F   VFWIFCF +S 
Sbjct: 293 NTFIALFKDTSLVIIIGLFDLLNSVKQATADPAWLG--MATEGYVFAALVFWIFCFGMSR 350

Query: 372 YSVFIEKTLHKGSKK 386
           YS+ +E+ L  G K+
Sbjct: 351 YSMHLERKLDTGHKR 365


>gi|260463339|ref|ZP_05811540.1| polar amino acid ABC transporter, inner membrane subunit
           [Mesorhizobium opportunistum WSM2075]
 gi|259030929|gb|EEW32204.1| polar amino acid ABC transporter, inner membrane subunit
           [Mesorhizobium opportunistum WSM2075]
          Length = 385

 Score =  282 bits (721), Expect = 8e-74,   Method: Composition-based stats.
 Identities = 211/382 (55%), Positives = 280/382 (73%), Gaps = 1/382 (0%)

Query: 6   KEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVF 65
            +  +VR  +      P    G +AW+ KN  GT  D +LT L I ++ + +P +I W F
Sbjct: 4   HDMSWVRTEMALAQPAPASVSGPMAWVRKNLVGTVGDTILTILGIIIVAWVLPQVIGWAF 63

Query: 66  LDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLT 125
           ++AVW G +RTVC TV+QGGIQPDGW+ ACWAF+  ++ QF+FG YP+ +RWRPI+V + 
Sbjct: 64  INAVWTGPDRTVCATVAQGGIQPDGWSGACWAFVNAKFGQFMFGTYPVEERWRPIVVAIL 123

Query: 126 GSILLTPMLIPSFPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVIS 184
            + LL PMLIP  PRK LN+ILLF + PI   F ++ G  GL  VETS WGGLL+TL +S
Sbjct: 124 FAALLIPMLIPRVPRKGLNAILLFLVLPIVSFFLLVGGMFGLPHVETSRWGGLLITLSLS 183

Query: 185 FFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTW 244
           F GI +S+PLG +LALGR S +P+++  C+ FIE  RG+PL+TVLF  S+MLPLFLP   
Sbjct: 184 FVGIAVSLPLGTVLALGRRSKMPIVKMLCVIFIEAVRGIPLITVLFFVSVMLPLFLPAGV 243

Query: 245 DVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIK 304
             DK LRAL+GVS FA+AY+AEV+RGGLQ+I KGQ+E A+SLGL Y QKM LI++PQ +K
Sbjct: 244 TFDKYLRALIGVSLFAAAYMAEVVRGGLQAIPKGQYEGADSLGLGYWQKMSLIVLPQALK 303

Query: 305 RVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWI 364
            VIPGIVNTFIG+FKD+SL+ II+MFDLLGIV+ NFS++ W ++ T  +GL+F  FVFW+
Sbjct: 304 LVIPGIVNTFIGMFKDTSLVLIISMFDLLGIVKQNFSDANWATAQTAKSGLVFAAFVFWL 363

Query: 365 FCFSISLYSVFIEKTLHKGSKK 386
           FCF +S YS++ E+ L  G K+
Sbjct: 364 FCFGMSRYSMYTERRLDTGHKR 385


>gi|330969252|gb|EGH69318.1| amino acid ABC transporter permease [Pseudomonas syringae pv.
           aceris str. M302273PT]
          Length = 365

 Score =  282 bits (720), Expect = 8e-74,   Method: Composition-based stats.
 Identities = 175/375 (46%), Positives = 240/375 (64%), Gaps = 14/375 (3%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
                   PP    G +AW+ +N F +  + LLT   + L+   +P II W  LDA WIG
Sbjct: 4   HTFKPDMPPPGKVFGPMAWMRQNLFSSWINTLLTLFSLYLIYLVVPPIISWALLDANWIG 63

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
           + +  CT              ACW FI  R+ QF++G +P   RWR  L  +   +   P
Sbjct: 64  TTKADCTKA-----------GACWVFIEQRFGQFMYGYFPNELRWRVDLTAILAIVGAAP 112

Query: 133 MLIPSFPRKFLNSILLFGLFPIFSF-FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIIS 191
           + I  FPRK +  I    ++P+ +F  +  G  GL+ V TS WGGL++T VI+  GI+ +
Sbjct: 113 LFISKFPRKAVYGIAFLVIYPVVAFYLLHGGAFGLTNVPTSQWGGLMLTPVIATVGIVGA 172

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +PLGILLALGR SN+P +R  C+TFIE +RGVPL+TVLFM+S+MLPLF+P+  + DKLLR
Sbjct: 173 LPLGILLALGRRSNMPAVRVVCVTFIEFWRGVPLITVLFMSSVMLPLFMPEGMNFDKLLR 232

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
           AL+GV  F SAYIAEV+RGG+Q+I KGQ+EAA+++GL Y + M L+I+PQ +K VIPGIV
Sbjct: 233 ALIGVILFQSAYIAEVVRGGMQAIPKGQYEAASAMGLGYWRSMGLVILPQALKMVIPGIV 292

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISL 371
           NTFI LFKD+SL+ II +FDLL  V+   ++  W+     T G +F   VFWIFCF +S 
Sbjct: 293 NTFIALFKDTSLVIIIGLFDLLNSVKQATADPAWLG--MATEGYVFAALVFWIFCFGMSR 350

Query: 372 YSVFIEKTLHKGSKK 386
           YS+ +E+ L  G K+
Sbjct: 351 YSMHLERKLDTGHKR 365


>gi|330811532|ref|YP_004355994.1| Putative amino acid ABC transporter, permease component
           [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
 gi|327379640|gb|AEA70990.1| Putative amino acid ABC transporter, permease component
           [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
          Length = 365

 Score =  281 bits (719), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 178/375 (47%), Positives = 239/375 (63%), Gaps = 14/375 (3%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
                   PP    G++AW+  N F +  + LLT     L+   +P ++HW  LDA W+G
Sbjct: 4   HTFKPDMPPPGSSIGVVAWMRANMFSSWINTLLTLFAFYLIYLIVPPLLHWAILDANWVG 63

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
           + R  CT              ACW FI  R+ QF++G YP   RWR  L      I + P
Sbjct: 64  TTRADCTKE-----------GACWVFIQQRFGQFMYGYYPTDLRWRVDLTVWLAVIGVAP 112

Query: 133 MLIPSFPRKFLNSILLFGLFPIFSF-FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIIS 191
           + I  FPRK +  +    L+PI ++  +  G  GL  V TS WGGL++TLVI+  GI+ +
Sbjct: 113 LFISRFPRKAIYGLSFLVLYPIIAWCLLHGGVFGLDAVATSQWGGLMLTLVIATVGIVGA 172

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +PLGI+LALGR SN+P +R  C+TFIE +RGVPL+TVLFM+S+MLPLFLP+  + DKLLR
Sbjct: 173 LPLGIVLALGRRSNMPAIRVVCVTFIEFWRGVPLITVLFMSSVMLPLFLPEGMNFDKLLR 232

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
           AL+GV  F SAYIAEV+RGGLQ+I KGQ+EAA ++GL Y + M L+I+PQ +K VIPGIV
Sbjct: 233 ALIGVILFQSAYIAEVVRGGLQAIPKGQYEAAAAMGLGYWRSMGLVILPQALKLVIPGIV 292

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISL 371
           NTFI LFKD+SL+ II +FDLL  V+   ++  W+     T G +F   VFWIFCF +S 
Sbjct: 293 NTFIALFKDTSLVIIIGLFDLLNSVKQAAADPKWLG--MATEGYVFAALVFWIFCFGMSR 350

Query: 372 YSVFIEKTLHKGSKK 386
           YS+ +E+ L  G K+
Sbjct: 351 YSMHLERKLDTGHKR 365


>gi|163760313|ref|ZP_02167396.1| amino acid ABC transporter, permease protein [Hoeflea phototrophica
           DFL-43]
 gi|162282712|gb|EDQ33000.1| amino acid ABC transporter, permease protein [Hoeflea phototrophica
           DFL-43]
          Length = 377

 Score =  281 bits (718), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 201/385 (52%), Positives = 263/385 (68%), Gaps = 9/385 (2%)

Query: 1   MIDSCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGI 60
           M  + K   YVR        PPV   G+  W+ +N F + +D +LT L   LLL+ +P I
Sbjct: 1   MDANQKTVAYVRSEESPRMAPPVTSSGVAGWLKENLFASTRDTVLTILTFLLLLWMVPPI 60

Query: 61  IHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPI 120
           + W FL AVW G +R  C               ACWAF+  ++ QFI+G YP+ +RWR  
Sbjct: 61  VDWAFLSAVWTGESREDCIVPGA---------GACWAFVEAKFGQFIYGRYPVEERWRVD 111

Query: 121 LVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVT 180
           L  L     L P+ IPS P K  N++ L  +FPI  F +L G LGL+ VET+LWGGLLVT
Sbjct: 112 LTGLLLIAGLVPIAIPSLPYKRENALYLLVVFPILGFILLTGQLGLAPVETALWGGLLVT 171

Query: 181 LVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFL 240
           LV++  GI++S PLGILLALGR S +P+++  CI FIE +RGVPL+TVLFM+S+MLPLFL
Sbjct: 172 LVVAIVGIVVSFPLGILLALGRRSEMPIVKMFCIIFIEFWRGVPLITVLFMSSVMLPLFL 231

Query: 241 PDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMP 300
           P+    DKLLRAL+GV+ F+SAY+AEV+RGGLQ+I KGQ+EAAN++ L++ Q  RL+IMP
Sbjct: 232 PEGVTFDKLLRALIGVALFSSAYMAEVIRGGLQAIPKGQYEAANAMALTFWQGTRLVIMP 291

Query: 301 QVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGF 360
           Q +K VIPGIVNTFIGLFKD+SL+ II +FDLLGIV+ N ++  WIS  TP TG +F   
Sbjct: 292 QALKLVIPGIVNTFIGLFKDTSLVLIIGLFDLLGIVQQNMNDPNWISPATPATGFVFAAL 351

Query: 361 VFWIFCFSISLYSVFIEKTLHKGSK 385
           VF+IFCF +S YS ++E+ L  G K
Sbjct: 352 VFFIFCFGMSRYSAYMERRLDTGHK 376


>gi|170720092|ref|YP_001747780.1| polar amino acid ABC transporter inner membrane subunit
           [Pseudomonas putida W619]
 gi|169758095|gb|ACA71411.1| polar amino acid ABC transporter, inner membrane subunit
           [Pseudomonas putida W619]
          Length = 365

 Score =  281 bits (718), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 175/371 (47%), Positives = 239/371 (64%), Gaps = 14/371 (3%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
               PPV   G++AW+  N F +  + LLT   + L+   +P ++ W  +DA W+G+ R 
Sbjct: 8   PDMPPPVKTVGVLAWMRVNLFSSWLNTLLTLFAVYLVWLIVPPLLQWALIDANWVGTTRA 67

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            CT              ACW FI  R+ QF++G YP   RWR  L      +   P+ I 
Sbjct: 68  DCTKE-----------GACWVFIQQRFGQFMYGYYPAELRWRVDLTVWLAVLGAAPLFIK 116

Query: 137 SFPRKFLNSILLFGLFPIFSF-FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
            FPRK +  +    ++PI ++  +  G LGL  V TS WGGL++TLVI+  GI+ ++PLG
Sbjct: 117 RFPRKAVYGLGFLVVYPILAYTLLHGGYLGLESVPTSQWGGLMLTLVIATVGIVGALPLG 176

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           ILLALGR SN+P ++  C+TFIE +RGVPL+TVLFM+S+MLPLFLP+    DKLLRA++G
Sbjct: 177 ILLALGRRSNMPAVKVVCVTFIEFWRGVPLITVLFMSSVMLPLFLPEGMSFDKLLRAMIG 236

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           V  F SAYIAEV+RGGLQ+I KGQ+EAA ++GL Y + M L+I+PQ +K VIPGIVNTFI
Sbjct: 237 VILFQSAYIAEVVRGGLQAIPKGQYEAAAAMGLGYWRSMGLVILPQALKLVIPGIVNTFI 296

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD+SL+ II +FDLL  V+   ++  W+     T G +F   VFWIFCF +S YS+ 
Sbjct: 297 ALFKDTSLVIIIGLFDLLNSVKQAAADPAWLG--MATEGYVFAALVFWIFCFGMSRYSMH 354

Query: 376 IEKTLHKGSKK 386
           +E+ L  G K+
Sbjct: 355 LERKLDTGHKR 365


>gi|104783490|ref|YP_609988.1| general amino acid ABC transporter permease [Pseudomonas
           entomophila L48]
 gi|95112477|emb|CAK17204.1| general amino acid ABC transporter, permease protein [Pseudomonas
           entomophila L48]
          Length = 365

 Score =  281 bits (718), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 177/371 (47%), Positives = 243/371 (65%), Gaps = 14/371 (3%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
               PPV   G++AW+  N F +  + LLT   + L+   +P ++ W F+DA W+G+ R 
Sbjct: 8   PDMPPPVKTVGVLAWMRANLFSSWLNTLLTLFALYLVWLIVPPLVQWAFIDANWVGTTRA 67

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            CT              ACW FI  R+ QF++G YP   RWR  L      +   P+ I 
Sbjct: 68  DCTKE-----------GACWVFIQQRFGQFMYGYYPTELRWRVDLTVWLAVLGAAPLFIK 116

Query: 137 SFPRKFLNSILLFGLFPIFSF-FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
            FPRK +  +    L+P+ ++  +  G LGL+ V+TS WGGL++TLVI+  GI+ ++PLG
Sbjct: 117 RFPRKAVYGLGFLVLYPVLAYTLLHGGYLGLATVQTSQWGGLMLTLVIATVGIVGALPLG 176

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           ILLALGR SN+P ++  C+TFIE +RGVPL+TVLFM+S+MLPLFLP+    DKLLRA++G
Sbjct: 177 ILLALGRRSNMPAVKVVCVTFIEFWRGVPLITVLFMSSVMLPLFLPEGMSFDKLLRAMIG 236

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           V  F SAYIAEV+RGGLQ+I KGQ+EAA ++GL Y + M L+I+PQ +K VIPGIVNTFI
Sbjct: 237 VILFQSAYIAEVVRGGLQAIPKGQYEAAAAMGLGYWRAMGLVILPQALKLVIPGIVNTFI 296

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD+SL+ II +FDLL  V+   ++ TW+     T G +F   VFWIFCF +S YS+ 
Sbjct: 297 ALFKDTSLVIIIGLFDLLNSVKQAAADPTWLG--MATEGYVFAALVFWIFCFGMSRYSMH 354

Query: 376 IEKTLHKGSKK 386
           +E+ L  G K+
Sbjct: 355 LERKLDTGHKR 365


>gi|70728432|ref|YP_258181.1| general amino acid ABC transporter permease [Pseudomonas
           fluorescens Pf-5]
 gi|68342731|gb|AAY90337.1| general amino acid ABC transporter, permease protein [Pseudomonas
           fluorescens Pf-5]
          Length = 365

 Score =  280 bits (717), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 179/375 (47%), Positives = 239/375 (63%), Gaps = 14/375 (3%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
                   PP    G++AW+  N F    + LLT     L+   +P ++HW  LDA W+G
Sbjct: 4   HTFKPDMPPPSRSIGVLAWMRANMFSNWLNTLLTLFAFYLIYLVVPPLLHWAILDANWVG 63

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
           ++R  CT              ACW FI  R+ QF++G YP+  RWR  L      I   P
Sbjct: 64  TSRADCT-----------RGGACWVFIQQRFGQFMYGYYPVELRWRVDLSVWLAVIGAAP 112

Query: 133 MLIPSFPRKFLNSILLFGLFPIFSF-FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIIS 191
           + I  FPRK +  +     +PI ++  +  G LGLS V TS WGGL++TLVI+  GI  +
Sbjct: 113 LFISRFPRKAIYGLCFLVGYPIIAYSLLHGGYLGLSTVATSQWGGLMLTLVIATVGIAGA 172

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +PLGILLALGR SN+P +R  C+TFIE +RGVPL+TVLFM+S+MLPLFLP+  + DKLLR
Sbjct: 173 LPLGILLALGRRSNLPAIRVVCVTFIEFWRGVPLITVLFMSSVMLPLFLPEGMNFDKLLR 232

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
           AL+GV  F SAY+AEV+RGGLQ+I KGQ+EAA ++GL Y + M L+I+PQ +K VIPGIV
Sbjct: 233 ALIGVILFQSAYVAEVVRGGLQAIPKGQYEAAAAMGLGYWRAMGLVILPQALKLVIPGIV 292

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISL 371
           NTFI LFKD+SL+ II +FDLL  V+   ++  W+     T G +F   VFWIFCF +S 
Sbjct: 293 NTFIALFKDTSLVIIIGLFDLLNSVKQAAADPKWLG--MATEGYVFAALVFWIFCFGMSR 350

Query: 372 YSVFIEKTLHKGSKK 386
           YS+ +E+ L  G K+
Sbjct: 351 YSMHLERKLDTGHKR 365


>gi|330882634|gb|EGH16783.1| amino acid ABC transporter permease [Pseudomonas syringae pv.
           glycinea str. race 4]
          Length = 365

 Score =  280 bits (716), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 173/375 (46%), Positives = 238/375 (63%), Gaps = 14/375 (3%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
                   PP    G +AW+ +N F +  + LLT   + L+   +P II W  LDA W+G
Sbjct: 4   HTFKPDMPPPGKVFGPMAWMRQNLFSSWINTLLTLFSLYLIYLVVPPIISWALLDANWVG 63

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
           + +  CT              ACW FI  R+ QF++G +P   RWR  L  +   +   P
Sbjct: 64  TTKADCTKA-----------GACWVFIEQRFGQFMYGYFPNELRWRVDLTAILAIVGAAP 112

Query: 133 MLIPSFPRKFLNSILLFGLFPIFSF-FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIIS 191
           + I  F RK +  I    ++PI +F  +  G  GL+ V TS WGGL++TLVI+  GI+ +
Sbjct: 113 LFISKFQRKAVYGIAFLVIYPIVAFYLLHGGAFGLTNVPTSQWGGLMLTLVIATVGIVGA 172

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +PLGILLALGR SN+P +R  C+TFIE +RGVPL+TVLFM+S+MLPLF+P+  + DKLLR
Sbjct: 173 LPLGILLALGRRSNMPAVRVVCVTFIEFWRGVPLITVLFMSSVMLPLFMPEGMNFDKLLR 232

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
           AL+GV  F SAYIAEV+RGG+Q+I KGQ+EAA+++ L Y + M L+ +PQ +K VIPGIV
Sbjct: 233 ALIGVILFQSAYIAEVVRGGMQAIPKGQYEAASAMDLGYWRSMGLVFLPQALKMVIPGIV 292

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISL 371
           NTFI LFKD+SL+ II +FDLL  V+   ++  W+     T G +F   VFWIFCF +S 
Sbjct: 293 NTFIALFKDTSLVIIIGLFDLLNSVKQATADPAWLG--MATEGYVFAALVFWIFCFGMSR 350

Query: 372 YSVFIEKTLHKGSKK 386
           YS+ +E+ L  G K+
Sbjct: 351 YSMHLERKLDTGHKR 365


>gi|2961078|gb|AAC05642.1| unknown [Pseudomonas marginalis pv. alfalfae]
          Length = 365

 Score =  280 bits (715), Expect = 4e-73,   Method: Composition-based stats.
 Identities = 178/375 (47%), Positives = 236/375 (62%), Gaps = 14/375 (3%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
                   PP    G +AW+  N F +  + LLT L   L+   +P I+ W  LDA W+G
Sbjct: 4   HTFKPDMPPPSKVFGPMAWMRANLFSSWLNTLLTLLAFYLIYLVVPPILQWAILDANWVG 63

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
           + R  CT              ACW FI  R+ QF++G YP   RWR  L      + + P
Sbjct: 64  TTRADCTKE-----------GACWVFIQQRFGQFMYGYYPGDLRWRVDLTVWLAIVGVAP 112

Query: 133 MLIPSFPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIIS 191
           + I  FPRK +  +    L+PI   F +  G  GL+ V TS WGGL++TLVI+  GI  +
Sbjct: 113 LFISRFPRKAVYGLSFLVLYPIIAYFLLHGGIFGLTNVATSQWGGLMLTLVIATVGIAGA 172

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +PLGI+LALGR SN+P +R  C+TFIE +RGVPL+TVLFM+S+MLPLFLP+   +DKLLR
Sbjct: 173 LPLGIVLALGRRSNMPAIRVVCVTFIEFWRGVPLITVLFMSSVMLPLFLPEGMGIDKLLR 232

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
           AL+GV  F SAY+AEV+RGGLQ+I KGQ+EAA ++GL Y + M L+I+PQ +K VIPGIV
Sbjct: 233 ALIGVILFQSAYVAEVVRGGLQAIPKGQYEAAAAMGLGYWRSMGLVILPQALKMVIPGIV 292

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISL 371
           NTFI LFKD+SL+ II +FDLL  V+   ++  W+     T G +F   VFWIFCF +S 
Sbjct: 293 NTFIALFKDTSLVIIIGLFDLLNSVKQAAADPKWLG--MATEGYVFAALVFWIFCFGMSR 350

Query: 372 YSVFIEKTLHKGSKK 386
           YS+ +E  L  G K+
Sbjct: 351 YSIHLEHKLDTGHKR 365


>gi|146308573|ref|YP_001189038.1| polar amino acid ABC transporter, inner membrane subunit
           [Pseudomonas mendocina ymp]
 gi|145576774|gb|ABP86306.1| amino acid ABC transporter membrane protein 2, PAAT family
           [Pseudomonas mendocina ymp]
          Length = 365

 Score =  280 bits (715), Expect = 4e-73,   Method: Composition-based stats.
 Identities = 174/375 (46%), Positives = 233/375 (62%), Gaps = 14/375 (3%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
                   PP    G + W+  N F    + LLT   I L+   +P +I W F+DA W G
Sbjct: 4   HTFKPDLPPPRMSVGAVGWLKANLFSNWFNTLLTLFAIYLIWLIVPPLIQWAFIDATWSG 63

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
           S R  CT              ACW FI  R+ QF++G YP   RWR         I   P
Sbjct: 64  STRADCTG-----------GGACWVFIQQRFGQFMYGFYPSELRWRVDTTLWLAIIGAAP 112

Query: 133 MLIPSFPRKFLNSILLFGLFPIFSF-FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIIS 191
           + +P  PRK    +    ++P+ ++  +  G  GLS+V TS WGGL++TLVI+  GI  +
Sbjct: 113 LFVPQMPRKAFYGLAFLVIYPVVAWCLLHGGVFGLSVVPTSQWGGLMLTLVIAAVGITGA 172

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +PLGILLALGR SN+P +R  C+TFIE +RGVPL+TVLFM+S+MLPLFLP+    DKL+R
Sbjct: 173 LPLGILLALGRRSNMPAIRVICVTFIEFWRGVPLITVLFMSSVMLPLFLPEGMHFDKLMR 232

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
           AL+GV  F SAYIAEV+RGGLQ+I KGQ+EAA ++GL Y + M L+I+PQ +K VIPGIV
Sbjct: 233 ALIGVILFQSAYIAEVVRGGLQAIPKGQYEAAAAMGLGYWRMMGLVILPQALKLVIPGIV 292

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISL 371
           NTFI LFKD+SL+ II +FDLL  ++   ++  W+     T G +F   +FWIFCF +S 
Sbjct: 293 NTFISLFKDTSLVIIIGLFDLLNSIKQATTDPAWLG--MATEGYVFAALIFWIFCFGMSR 350

Query: 372 YSVFIEKTLHKGSKK 386
           YS+ +E+ L  G K+
Sbjct: 351 YSMHLERKLDTGHKR 365


>gi|77457202|ref|YP_346707.1| amino acid ABC transporter permease [Pseudomonas fluorescens Pf0-1]
 gi|77381205|gb|ABA72718.1| amino acid ABC transporter membrane protein 2, PAAT family
           [Pseudomonas fluorescens Pf0-1]
          Length = 365

 Score =  278 bits (712), Expect = 7e-73,   Method: Composition-based stats.
 Identities = 174/375 (46%), Positives = 233/375 (62%), Gaps = 14/375 (3%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
                   PP    G +AWI  N F +  + LLT     L+   +P I+ W  LDA W+G
Sbjct: 4   HTFKPDMPPPAKVFGPMAWIRANMFSSWLNTLLTLFAFYLIYLVVPPILSWAILDANWVG 63

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
           + R  CT              ACW FI  R+ QF++G YP   RWR  L      I + P
Sbjct: 64  TTRADCTKE-----------GACWVFIQQRFGQFMYGYYPPELRWRVDLTVWLAVIGVAP 112

Query: 133 MLIPSFPRKFLNSILLFGLFPIFSF-FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIIS 191
           + I     K +  +    ++PI ++  +  G  GL  V TS WGGL++TLVI+  GI  +
Sbjct: 113 LFIKRVAHKAVYGLSFLVVYPIVAWCLLHGGVFGLDTVATSQWGGLMLTLVIATVGIAGA 172

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +PLGI+LALGR SN+P +R  C+TFIE +RGVPL+TVLFM+S+MLPLFLP+  + DKLLR
Sbjct: 173 LPLGIVLALGRRSNMPAIRVVCVTFIEFWRGVPLITVLFMSSVMLPLFLPEGMNFDKLLR 232

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
           AL+GV  F SAY+AEV+RGGLQ+I KGQ+EAA ++GL Y + M L+I+PQ +K VIPGIV
Sbjct: 233 ALIGVILFQSAYVAEVVRGGLQAIPKGQYEAAAAMGLGYWRAMGLVILPQALKLVIPGIV 292

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISL 371
           NTFI LFKD+SL+ II +FDLL  V+   ++  W+     T G +F   VFWIFCF +S 
Sbjct: 293 NTFIALFKDTSLVIIIGLFDLLNSVKQAAADPKWLG--MATEGYVFAALVFWIFCFGMSR 350

Query: 372 YSVFIEKTLHKGSKK 386
           YS+ +E+ L  G K+
Sbjct: 351 YSMHLERKLDTGHKR 365


>gi|260768538|ref|ZP_05877472.1| amino acid ABC transporter permease protein [Vibrio furnissii CIP
           102972]
 gi|260616568|gb|EEX41753.1| amino acid ABC transporter permease protein [Vibrio furnissii CIP
           102972]
 gi|315180250|gb|ADT87164.1| general L-amino acid transport system permease protein AapM [Vibrio
           furnissii NCTC 11218]
          Length = 365

 Score =  278 bits (710), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 167/375 (44%), Positives = 245/375 (65%), Gaps = 14/375 (3%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
            +      PP    G++ W+ KN F +P + ++T ++  +   +I  ++ W  + A W+G
Sbjct: 4   HQFQPSLPPPANTTGVVGWLRKNLFNSPLNSVVTLILAYIAFSAIWHVLDWAIIKADWVG 63

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
           + R  CT            + ACW FI  R+EQF++G YP A+ WRP + F T +I +  
Sbjct: 64  ATRDACT-----------RDGACWVFISVRWEQFMYGFYPQAELWRPRIFFATLAIFIAL 112

Query: 133 MLIPSFPRKFLNSILLFGLFPIFSF-FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIIS 191
           +     P++    +    ++P      +  G  GL +V T  WGGLLVTL+I+  GI++S
Sbjct: 113 LAYERTPKRTWIWLFFVNIYPFLMAGLLYGGVFGLEVVSTHKWGGLLVTLIIALVGIVVS 172

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +P+G+ LALGR S++PV+R  C  +IE++RGVPL+TVLFMAS+MLPLFL +  + DKLLR
Sbjct: 173 LPIGVALALGRRSDMPVIRSLCTVYIEVWRGVPLITVLFMASVMLPLFLSEGSETDKLLR 232

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
           AL+GV  F++AY+AEV+RGGLQ+I KGQ+EAA++LGLSY +KM LII+PQ +K  IP IV
Sbjct: 233 ALIGVVMFSAAYMAEVIRGGLQAIPKGQYEAADALGLSYWKKMGLIILPQALKITIPSIV 292

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISL 371
           NTFIGLFKD+SL+ II MFD+LGI +   ++  W+     T   +F+  VFW+FCF +S 
Sbjct: 293 NTFIGLFKDTSLVLIIGMFDVLGIGQAANTDPEWLG--FATESYVFVALVFWVFCFGMSR 350

Query: 372 YSVFIEKTLHKGSKK 386
           YS+++E+ LH G K+
Sbjct: 351 YSIWLERKLHTGHKR 365


>gi|229588543|ref|YP_002870662.1| putative amino acid ABC transporter membrane protein [Pseudomonas
           fluorescens SBW25]
 gi|229360409|emb|CAY47266.1| putative amino acid ABC transport system, membrane protein
           [Pseudomonas fluorescens SBW25]
          Length = 365

 Score =  277 bits (709), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 175/375 (46%), Positives = 235/375 (62%), Gaps = 14/375 (3%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
                   PP    G +AW+  N F +  + LLT L   L+   +P I+ W  +DA W+G
Sbjct: 4   HTFKPDMPPPNKVFGPMAWMRANLFSSWLNTLLTLLAFYLIYLVVPPILSWAIIDANWVG 63

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
           + R  CT              ACW FI  R+ QF++G YP   RWR  L      + + P
Sbjct: 64  TTRADCTKE-----------GACWVFIQQRFGQFMYGYYPGDLRWRVDLTVWLAIVGVAP 112

Query: 133 MLIPSFPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIIS 191
           + +  F RK +  +    L+PI   F +  G  GL+ V TS WGGL++TLVI+  GI  +
Sbjct: 113 LFVSRFQRKAIYGLSFLVLYPIIAFFLLHGGIFGLANVATSQWGGLMLTLVIATVGIAGA 172

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +PLGI+LALGR SN+P +R  C+TFIE +RGVPL+TVLFM+S+MLPLFLP+   +DKLLR
Sbjct: 173 LPLGIMLALGRRSNMPAIRVVCVTFIEFWRGVPLITVLFMSSVMLPLFLPEGMGIDKLLR 232

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
           AL+GV  F SAY+AEV+RGGLQ+I KGQ+EAA ++GL Y + M L+I+PQ +K VIPGIV
Sbjct: 233 ALIGVILFQSAYVAEVVRGGLQAIPKGQYEAAAAMGLGYWRSMGLVILPQALKMVIPGIV 292

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISL 371
           NTFI LFKD+SL+ II +FDLL  V+   ++  W+     T G +F   VFWIFCF +S 
Sbjct: 293 NTFIALFKDTSLVIIIGLFDLLNSVKQAAADPKWLG--MATEGYVFAALVFWIFCFGMSR 350

Query: 372 YSVFIEKTLHKGSKK 386
           YS+ +E  L  G K+
Sbjct: 351 YSIHLEHKLDTGHKR 365


>gi|254508776|ref|ZP_05120888.1| ABC-type amino acid transport system, permease component [Vibrio
           parahaemolyticus 16]
 gi|219548296|gb|EED25309.1| ABC-type amino acid transport system, permease component [Vibrio
           parahaemolyticus 16]
          Length = 365

 Score =  277 bits (709), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 168/375 (44%), Positives = 243/375 (64%), Gaps = 14/375 (3%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
            + L    PP    G++ W+ KN F  P + ++T ++  L    +  I+ W FL A W+G
Sbjct: 4   HQFLPDLPPPSNTVGVVGWLRKNLFNGPVNSVVTVILAYLAAVLLWNIVDWAFLKADWVG 63

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
           + R  C+            + ACW FI  R+EQF++G YP  + WRP L ++T +I    
Sbjct: 64  TTRDACS-----------RDGACWVFISVRWEQFMYGFYPQEELWRPRLFYITLAIFTVL 112

Query: 133 MLIPSFPRKFLNSILLFGLFPIFSF-FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIIS 191
           +     P++    +    ++P      +  G  GL +VET  WGGLLVTL+I+  GI++S
Sbjct: 113 LAYEKTPKRMWIWLFFVNVYPFIIAALLYGGVFGLEVVETHKWGGLLVTLIIALVGIVVS 172

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +P+G+ LALGR S +P++R  C  +IE++RGVPL+TVLFMAS+MLPLFL +  + DKL+R
Sbjct: 173 LPIGVALALGRRSEMPIIRSICTVYIEVWRGVPLITVLFMASVMLPLFLSEGSETDKLIR 232

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
           AL+GV  F++AY+AEV+RGGLQ+I KGQ+EAA++LGLSY +KM LII+PQ +K  IP IV
Sbjct: 233 ALIGVVMFSAAYMAEVVRGGLQAIPKGQYEAADALGLSYWKKMGLIILPQALKITIPSIV 292

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISL 371
           NTFIGLFKD+SL+ II MFD+LGI +   ++  W+     T   +F+  VFW+FCF +S 
Sbjct: 293 NTFIGLFKDTSLVLIIGMFDVLGIGQAANTDPEWLG--FATESYVFVALVFWVFCFGMSR 350

Query: 372 YSVFIEKTLHKGSKK 386
           YS+++E  LH G K+
Sbjct: 351 YSIWLENKLHTGHKR 365


>gi|153835217|ref|ZP_01987884.1| general L-amino acid transport system permease protein AapM [Vibrio
           harveyi HY01]
 gi|148868283|gb|EDL67415.1| general L-amino acid transport system permease protein AapM [Vibrio
           harveyi HY01]
          Length = 365

 Score =  277 bits (708), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 169/375 (45%), Positives = 246/375 (65%), Gaps = 14/375 (3%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
            +      PP    G+I W+ KN F  P + ++T ++  ++  ++  II W F++A WIG
Sbjct: 4   HQFQPDLPPPANTVGVIGWLRKNLFNGPVNSIVTLILAYIVFSALWNIIDWAFVNADWIG 63

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
           + R  CT              ACW FI  R+EQF++G YP ++ WRP L ++T +I    
Sbjct: 64  ATRDDCT-----------REGACWVFISVRWEQFMYGFYPESELWRPRLFYITLAIFTVL 112

Query: 133 MLIPSFPRKFLNSILLFGLFPIFSF-FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIIS 191
           +     P++    +    ++P      +  G  GL +VET  WGGLLVTL+I+  GI++S
Sbjct: 113 LAYEKTPKRIWIWLFFVNIYPFIIAALLYGGVFGLEVVETHKWGGLLVTLIIALVGIVVS 172

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +P+G+ LALGR S++P++R  C  +IE++RGVPL+TVLFMAS+MLPLFL +  + DKL+R
Sbjct: 173 LPIGVALALGRRSDMPIIRSICTVYIEVWRGVPLITVLFMASVMLPLFLAEGSETDKLIR 232

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
           AL+GV  F++AY+AEV+RGGLQ+I KGQ+EAA++LGLSY +KM LII+PQ +K  IP IV
Sbjct: 233 ALIGVVMFSAAYMAEVVRGGLQAIPKGQYEAADALGLSYWKKMGLIILPQALKITIPSIV 292

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISL 371
           NTFIGLFKD+SL+ II MFD+LGI +   ++  W+     T   +F+  VFW+FCF +S 
Sbjct: 293 NTFIGLFKDTSLVLIIGMFDVLGIGQAANTDPEWLG--FATESYVFVALVFWVFCFGMSR 350

Query: 372 YSVFIEKTLHKGSKK 386
           YS+++E  LH G K+
Sbjct: 351 YSIWLENKLHTGHKR 365


>gi|325275054|ref|ZP_08141042.1| polar amino acid ABC transporter inner membrane subunit
           [Pseudomonas sp. TJI-51]
 gi|324099817|gb|EGB97675.1| polar amino acid ABC transporter inner membrane subunit
           [Pseudomonas sp. TJI-51]
          Length = 365

 Score =  277 bits (707), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 174/371 (46%), Positives = 241/371 (64%), Gaps = 14/371 (3%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
               PPV   G++AW+  N F +  + LLT   + L+   +P ++ W  +DA W+G+ R 
Sbjct: 8   PDMPPPVKTVGVLAWMRTNLFSSWLNTLLTLFALYLIWLIVPPLLQWALIDANWVGTTRA 67

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            CT            + ACW F+  R+ QF++G YP+  RWR  L      +   P+ I 
Sbjct: 68  DCTK-----------DGACWVFVQQRFGQFMYGYYPVELRWRVDLTVWLAVLGAAPLFIK 116

Query: 137 SFPRKFLNSILLFGLFPIFSF-FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
            FPRK L  +    L+P+ ++  +  G LGLS V TS WGGL++TLVI+  GI+ ++PLG
Sbjct: 117 RFPRKALYGLGFLVLYPLLAYTLLHGGLLGLSNVSTSQWGGLMLTLVIATVGIVGALPLG 176

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           ILLALGR S +P ++  C+TFIE +RGVPL+TVLFM+S+MLPLFLP+    DKLLRA++G
Sbjct: 177 ILLALGRRSRMPAVKVVCVTFIEFWRGVPLITVLFMSSVMLPLFLPEGMSFDKLLRAMIG 236

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           V  F SAY+AEV+RGGLQ+I KGQ+EAA ++GL Y + M L+I+PQ +K VIPGIVNTFI
Sbjct: 237 VILFQSAYVAEVVRGGLQAIPKGQYEAAAAMGLGYWRAMGLVILPQALKLVIPGIVNTFI 296

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD+SL+ II +FDLL  V+   ++  W+     T G +F   VFWIFCF +S YS+ 
Sbjct: 297 ALFKDTSLVIIIGLFDLLNSVKQAAADPAWLG--MATEGYVFAALVFWIFCFGMSRYSMH 354

Query: 376 IEKTLHKGSKK 386
           +E+ L  G K+
Sbjct: 355 LERKLDTGHKR 365


>gi|262394186|ref|YP_003286040.1| amino acid ABC transporter permease [Vibrio sp. Ex25]
 gi|262337780|gb|ACY51575.1| amino acid ABC transporter permease protein [Vibrio sp. Ex25]
          Length = 365

 Score =  277 bits (707), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 168/375 (44%), Positives = 244/375 (65%), Gaps = 14/375 (3%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
            +      PP    G + W+ KN F  P + ++T ++  L+  +I  I+ W F++A WIG
Sbjct: 4   HQFQPDLPPPANTVGFVGWMRKNLFNGPVNSIVTVILAYLVFSAIWHIVDWAFINADWIG 63

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
           S R  C+              ACW FI  R+EQF++G YP ++ WRP L ++T +I    
Sbjct: 64  STRDDCS-----------REGACWVFISVRWEQFMYGFYPESELWRPRLFYITLAIFTVL 112

Query: 133 MLIPSFPRKFLNSILLFGLFPIFSF-FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIIS 191
           +     P++    +    ++P      +  G  GL +V+T  WGGLLVTL+I+  GI++S
Sbjct: 113 LAYEKTPKRIWIWLFFVNIYPFIIAGLLYGGIFGLEVVDTHKWGGLLVTLIIALVGIVVS 172

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +P+G++LALGR S +P++R  C  +IE++RGVPL+TVLFMAS+MLPLF+ +  + DKL+R
Sbjct: 173 LPIGVVLALGRRSEMPIIRSICTVYIEVWRGVPLITVLFMASVMLPLFMSEGSETDKLIR 232

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
           AL+GV  FASAY+AEV+RGGLQ+I KGQ+EAA++LGLSY +K  LII+PQ +K  IP IV
Sbjct: 233 ALIGVVMFASAYMAEVVRGGLQAIPKGQYEAADALGLSYWKKTGLIILPQALKITIPSIV 292

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISL 371
           NTFIGLFKD+SL+ II MFD+LGI +   ++  W+     T   +F+  VFW+FCF +S 
Sbjct: 293 NTFIGLFKDTSLVLIIGMFDVLGIGQAANTDPDWLG--FATESYVFVALVFWVFCFGMSR 350

Query: 372 YSVFIEKTLHKGSKK 386
           YS+++E  LH G K+
Sbjct: 351 YSIWLENKLHTGHKR 365


>gi|156974645|ref|YP_001445552.1| hypothetical protein VIBHAR_02363 [Vibrio harveyi ATCC BAA-1116]
 gi|156526239|gb|ABU71325.1| hypothetical protein VIBHAR_02363 [Vibrio harveyi ATCC BAA-1116]
          Length = 365

 Score =  277 bits (707), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 170/375 (45%), Positives = 246/375 (65%), Gaps = 14/375 (3%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
            +      PP    G+I W+ KN F  P + ++T ++  ++  ++  II W F++A WIG
Sbjct: 4   HQFQPDLPPPANTVGVIGWLRKNLFNGPVNSIVTLILAYIVFSALWNIIDWAFINADWIG 63

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
           + R  CT              ACW FI  R+EQF++G YP A+ WRP L ++T +I    
Sbjct: 64  ATRDDCT-----------REGACWVFISVRWEQFMYGFYPEAELWRPRLFYITLAIFTVL 112

Query: 133 MLIPSFPRKFLNSILLFGLFPIFSF-FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIIS 191
           +     P++    +    ++P      +  G  GL +VET  WGGLLVTL+I+  GI++S
Sbjct: 113 LAYEKTPKRIWIWLFFVNIYPFIIAALLYGGVFGLEVVETHKWGGLLVTLIIALVGIVVS 172

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +P+G+ LALGR S++P++R  C  +IE++RGVPL+TVLFMAS+MLPLFL +  + DKL+R
Sbjct: 173 LPIGVALALGRRSDMPIIRSICTVYIEVWRGVPLITVLFMASVMLPLFLAEGSETDKLIR 232

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
           AL+GV  F++AY+AEV+RGGLQ+I KGQ+EAA++LGLSY +KM LII+PQ +K  IP IV
Sbjct: 233 ALIGVVMFSAAYMAEVVRGGLQAIPKGQYEAADALGLSYWKKMGLIILPQALKITIPSIV 292

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISL 371
           NTFIGLFKD+SL+ II MFD+LGI +   ++  W+     T   +F+  VFW+FCF +S 
Sbjct: 293 NTFIGLFKDTSLVLIIGMFDVLGIGQAANTDPEWLG--FATESYVFVALVFWVFCFGMSR 350

Query: 372 YSVFIEKTLHKGSKK 386
           YS+++E  LH G K+
Sbjct: 351 YSIWLENKLHTGHKR 365


>gi|269964207|ref|ZP_06178498.1| amino acid ABC transporter, permease protein [Vibrio harveyi 1DA3]
 gi|269831056|gb|EEZ85224.1| amino acid ABC transporter, permease protein [Vibrio harveyi 1DA3]
          Length = 365

 Score =  277 bits (707), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 166/375 (44%), Positives = 245/375 (65%), Gaps = 14/375 (3%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
            +      PP    G++ W+ KN F  P + ++T ++  ++  ++  I+ W F++A W+G
Sbjct: 4   HQFQPDLPPPANTVGVVGWLRKNLFNGPINSIVTLILAYIVFSALWNIVDWAFINADWVG 63

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
           + R  CT              ACW FI  R+EQF++G YP A+ WRP L ++T +I    
Sbjct: 64  TTRDDCT-----------REGACWVFISVRWEQFMYGFYPEAELWRPRLFYITLAIFTVL 112

Query: 133 MLIPSFPRKFLNSILLFGLFPIFSF-FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIIS 191
           +     P++    +    ++P      +  G  GL +VET  WGGLLVTL+I+  GI++S
Sbjct: 113 LAYEKTPKRIWIWLFFVNIYPFIIAALLYGGVFGLEVVETHKWGGLLVTLIIALVGIVVS 172

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +P+G+ LALGR S++P++R  C  +IE++RGVPL+TVLFMAS+MLPLFL    + DKL+R
Sbjct: 173 LPIGVALALGRRSDMPIIRSICTVYIEVWRGVPLITVLFMASVMLPLFLAQGSETDKLIR 232

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
           AL+GV  F++AY+AEV+RGGLQ+I KGQ+EAA++LGL+Y +KM LII+PQ +K  IP IV
Sbjct: 233 ALIGVVMFSAAYMAEVVRGGLQAIPKGQYEAADALGLTYWKKMGLIILPQALKITIPSIV 292

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISL 371
           NTFIGLFKD+SL+ II MFD+LGI +   ++  W+     T   +F+  VFW+FCF +S 
Sbjct: 293 NTFIGLFKDTSLVLIIGMFDVLGIGQAANTDPEWLG--FATESYVFVALVFWVFCFGMSR 350

Query: 372 YSVFIEKTLHKGSKK 386
           YS+++E  LH G K+
Sbjct: 351 YSIWLENKLHTGHKR 365


>gi|323498375|ref|ZP_08103375.1| hypothetical protein VISI1226_13938 [Vibrio sinaloensis DSM 21326]
 gi|323316617|gb|EGA69628.1| hypothetical protein VISI1226_13938 [Vibrio sinaloensis DSM 21326]
          Length = 365

 Score =  276 bits (706), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 167/375 (44%), Positives = 244/375 (65%), Gaps = 14/375 (3%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
            + L    PP    G++ W+ KN F +P + ++T ++  L+   +  I+ W  L A W+G
Sbjct: 4   HQFLPDLPPPANTVGVVGWLRKNLFNSPVNSVVTVILAYLVGMLMWNIVDWGLLKADWVG 63

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
           + R  C+            + ACW FI  R+EQF++G YP  + WRP L ++T +I    
Sbjct: 64  TTRDACS-----------RDGACWVFISVRWEQFMYGFYPQEELWRPRLFYITLAIFTVL 112

Query: 133 MLIPSFPRKFLNSILLFGLFPIFSF-FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIIS 191
           +     P++    +    ++P      +  G  GL +VET  WGGLLVTL+I+  GI++S
Sbjct: 113 LAYEKTPKRLWIWLFFVNVYPFIIAGLLYGGVFGLEVVETHKWGGLLVTLIIALVGIVVS 172

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +P+G+ LALGR S +P++R  C  +IE++RGVPL+TVLFMAS+MLPLFL +  + DKL+R
Sbjct: 173 LPIGVALALGRRSEMPIIRSICTVYIEVWRGVPLITVLFMASVMLPLFLSEGSETDKLIR 232

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
           AL+GV  F++AY+AEV+RGGLQ+I KGQ+EAA++LGLSY +KM LII+PQ +K  IP IV
Sbjct: 233 ALIGVVMFSAAYMAEVVRGGLQAIPKGQYEAADALGLSYWKKMGLIILPQALKITIPSIV 292

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISL 371
           NTFIGLFKD+SL+ II MFD+LGI +   ++  W+     T   +F+  VFW+FCF +S 
Sbjct: 293 NTFIGLFKDTSLVLIIGMFDVLGIGQAANTDPEWLG--FATESYVFVALVFWVFCFGMSR 350

Query: 372 YSVFIEKTLHKGSKK 386
           YS+++E  LH G K+
Sbjct: 351 YSIWLENKLHTGHKR 365


>gi|258621543|ref|ZP_05716576.1| amino acid ABC transporter, permease protein [Vibrio mimicus VM573]
 gi|262171611|ref|ZP_06039289.1| amino acid ABC transporter permease protein [Vibrio mimicus MB-451]
 gi|258586161|gb|EEW10877.1| amino acid ABC transporter, permease protein [Vibrio mimicus VM573]
 gi|261892687|gb|EEY38673.1| amino acid ABC transporter permease protein [Vibrio mimicus MB-451]
          Length = 365

 Score =  276 bits (705), Expect = 5e-72,   Method: Composition-based stats.
 Identities = 173/375 (46%), Positives = 243/375 (64%), Gaps = 14/375 (3%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
            +      PP    G I W+ KN F  P + + T  +  L    I  I+ W  ++A W G
Sbjct: 4   HQFQPSLPPPANTTGPIGWLRKNLFNGPFNTIATLALGYLAAQGIWNILDWAIINANWSG 63

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
           + R  CT              ACW FI  R+EQF++G YP A+ WRP L F+T +I +  
Sbjct: 64  TTRNDCTLE-----------GACWVFISARWEQFMYGFYPAAELWRPRLFFITLAIFVAL 112

Query: 133 MLIPSFPRKFLNSILLFGLFPIFS-FFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIIS 191
           +     P++    ++   ++P F+   +  G  GL +VET  WGGLLVTL+I+  GII S
Sbjct: 113 LAYEKTPKRGWIWLVFVNIYPFFAAILLYGGLFGLEVVETHKWGGLLVTLIIALVGIIAS 172

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +P+G+ LALGR S++P++R  C  +IE++RGVPL+TVLFMAS+MLPLFL +  +++KLLR
Sbjct: 173 LPIGVALALGRRSDMPIIRSLCTVYIEVWRGVPLITVLFMASVMLPLFLSEGSEINKLLR 232

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
           AL+GV  F++AY+AEV+RGGLQ+I KGQ+EAA++LGLSY +KM LII+PQ +K  IP IV
Sbjct: 233 ALIGVVMFSAAYMAEVIRGGLQAIPKGQYEAADALGLSYWKKMGLIILPQALKITIPSIV 292

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISL 371
           NTFIGLFKD+SL+ II MFD+LGI +   ++  W+     T   +F+  VFWIFCF +S 
Sbjct: 293 NTFIGLFKDTSLVLIIGMFDVLGIGQSANTDPNWLG--FATESYVFVALVFWIFCFGMSR 350

Query: 372 YSVFIEKTLHKGSKK 386
           YS+++E  LH G K+
Sbjct: 351 YSIWLEGKLHTGHKR 365


>gi|262274331|ref|ZP_06052142.1| amino acid ABC transporter permease protein [Grimontia hollisae CIP
           101886]
 gi|262220894|gb|EEY72208.1| amino acid ABC transporter permease protein [Grimontia hollisae CIP
           101886]
          Length = 366

 Score =  276 bits (705), Expect = 5e-72,   Method: Composition-based stats.
 Identities = 167/376 (44%), Positives = 243/376 (64%), Gaps = 14/376 (3%)

Query: 12  RKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWI 71
           +        PP    G + W+ +N F TP + L+T ++  +    +  II W F+ + WI
Sbjct: 4   QHEFQPNLPPPPNTVGPVGWMKQNLFSTPVNALVTLVLAYIAFQGLWAIIDWAFIHSDWI 63

Query: 72  GSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLT 131
           G+ R  CT+             ACW FI  R++QF+FG YP  + WRP L +   ++   
Sbjct: 64  GTTREDCTSE-----------GACWVFINVRFDQFMFGFYPQEELWRPQLFYAVLALFTC 112

Query: 132 PMLIPSFPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIII 190
            ++    P++    +L    FP+   F +  G  GL  VET LWGGLL+T++I+  GI++
Sbjct: 113 LLVYEKTPKRGWILLLFLVAFPLLAVFLLFGGVAGLPNVETHLWGGLLITMIIAIVGIVV 172

Query: 191 SMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLL 250
           S+P+GI+LALGR S++P++R     +IE++RGVPL+TVLFMAS+MLPLF+    + +KL+
Sbjct: 173 SLPIGIVLALGRRSDMPIIRSLSTVYIEVWRGVPLITVLFMASVMLPLFMSGESESNKLV 232

Query: 251 RALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGI 310
           RAL+GV  FASAY+AEV+RGGLQ+I KGQ+EAA++LGL+Y +KM LII+PQ +K  IP I
Sbjct: 233 RALIGVVMFASAYMAEVVRGGLQAIPKGQYEAADALGLTYWKKMNLIILPQALKISIPSI 292

Query: 311 VNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSIS 370
           VNTFIGLFKD+SL+ II MFD+LGI +   ++  W+     T   +F+  VFWIFCF +S
Sbjct: 293 VNTFIGLFKDTSLVLIIGMFDVLGIGQAANTDPNWLG--FATESYVFVALVFWIFCFGMS 350

Query: 371 LYSVFIEKTLHKGSKK 386
            YS+++E  LH G ++
Sbjct: 351 RYSIYLENKLHTGHRR 366


>gi|320156511|ref|YP_004188890.1| amino acid ABC transporterpermease [Vibrio vulnificus MO6-24/O]
 gi|319931823|gb|ADV86687.1| amino acid ABC transporter, permease protein [Vibrio vulnificus
           MO6-24/O]
          Length = 365

 Score =  275 bits (704), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 169/375 (45%), Positives = 244/375 (65%), Gaps = 14/375 (3%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
            +      PP    G+I W+ KN F +P + +LT ++    + ++  +  W FL A W+G
Sbjct: 4   HQFQPDLPPPANTVGVIGWMRKNLFNSPVNSVLTLVLAYFAISTLWYVADWAFLSADWVG 63

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
           S R  CT              ACW FI  R+EQF++G YP A+ WRP L ++T +I    
Sbjct: 64  STRDACT-----------REGACWVFISVRWEQFMYGFYPEAELWRPRLFYITLAIFTVL 112

Query: 133 MLIPSFPRKFLNSILLFGLFPIFSF-FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIIS 191
           +     P++    +    ++P      +  G  GL +VET  WGGLLVTL+I+  GI++S
Sbjct: 113 LAYEKTPKRMWIWLFFVNIYPFIVAALLYGGVFGLEVVETHKWGGLLVTLIIALVGIVVS 172

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +P+G+ LALGR S++P++R  C  +IE++RGVPL+TVLFMAS+MLPLFL +  + DKL+R
Sbjct: 173 LPIGVALALGRRSDMPIIRSLCTVYIEVWRGVPLITVLFMASVMLPLFLSEGSETDKLIR 232

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
           AL+GV  F++AY+AEV+RGGLQ+I KGQ+EAA++LGL+Y +KM LII+PQ +K  IP IV
Sbjct: 233 ALIGVVMFSAAYMAEVVRGGLQAIPKGQYEAADALGLTYWKKMGLIILPQALKITIPSIV 292

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISL 371
           NTFIGLFKD+SL+ II MFD+LGI +   ++  W+     T   +F+  VFW+FCF +S 
Sbjct: 293 NTFIGLFKDTSLVLIIGMFDVLGIGQAANTDPEWLG--FATESYVFVALVFWVFCFGMSR 350

Query: 372 YSVFIEKTLHKGSKK 386
           YS+++E  LH G K+
Sbjct: 351 YSIWLENKLHTGHKR 365


>gi|261210915|ref|ZP_05925205.1| amino acid ABC transporter permease protein [Vibrio sp. RC341]
 gi|260839890|gb|EEX66490.1| amino acid ABC transporter permease protein [Vibrio sp. RC341]
          Length = 365

 Score =  275 bits (704), Expect = 7e-72,   Method: Composition-based stats.
 Identities = 173/375 (46%), Positives = 244/375 (65%), Gaps = 14/375 (3%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
            +      PP    G I W+ KN F +P + + T ++    L  I  I+ W  ++A W G
Sbjct: 4   HQFQPSLPPPGNTTGFIGWLRKNLFNSPFNSVATLVLGYFALQGIWHILDWAIINANWSG 63

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
           S R  CT            + ACW FI  R+EQF++G YP A+ WRP L F T ++ +  
Sbjct: 64  STRNDCT-----------LDGACWVFISVRWEQFMYGFYPAAELWRPRLFFFTLALFVAL 112

Query: 133 MLIPSFPRKFLNSILLFGLFPIFS-FFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIIS 191
           +     P++    ++   ++P F+   +  G  GL +VET  WGGLLVTL+I+  GII S
Sbjct: 113 LAYEKTPKRTWVWLVFVNIYPFFAAILLYGGLFGLEVVETHKWGGLLVTLIIALVGIIAS 172

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +P+G+ LALGR S++P++R  C  +IE++RGVPL+TVLFMAS+MLPLFL    ++DKLLR
Sbjct: 173 LPIGVALALGRRSDMPIIRSLCTVYIEVWRGVPLITVLFMASVMLPLFLSQGSEIDKLLR 232

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
           AL+GV  F++AY+AEV+RGGLQ+I KGQ+EAA++LGLSY +KM LII+PQ +K  IP IV
Sbjct: 233 ALIGVVMFSAAYMAEVIRGGLQAIPKGQYEAADALGLSYWKKMGLIILPQALKITIPSIV 292

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISL 371
           NTFIGLFKD+SL+ II MFD+LGI +   ++  W+     T   +F+  VFW+FCF +S 
Sbjct: 293 NTFIGLFKDTSLVLIIGMFDVLGIGQSANTDPNWLG--FATESYVFVALVFWVFCFGMSR 350

Query: 372 YSVFIEKTLHKGSKK 386
           YS+++E  LH G K+
Sbjct: 351 YSIWLEGKLHTGHKR 365


>gi|153839325|ref|ZP_01991992.1| general L-amino acid transport system permease protein AapM [Vibrio
           parahaemolyticus AQ3810]
 gi|260366018|ref|ZP_05778496.1| general L-amino acid transport system permease protein AapM [Vibrio
           parahaemolyticus K5030]
 gi|260898003|ref|ZP_05906499.1| general L-amino acid transport system permease protein AapM [Vibrio
           parahaemolyticus Peru-466]
 gi|149747157|gb|EDM58145.1| general L-amino acid transport system permease protein AapM [Vibrio
           parahaemolyticus AQ3810]
 gi|308088044|gb|EFO37739.1| general L-amino acid transport system permease protein AapM [Vibrio
           parahaemolyticus Peru-466]
 gi|308114204|gb|EFO51744.1| general L-amino acid transport system permease protein AapM [Vibrio
           parahaemolyticus K5030]
 gi|328473626|gb|EGF44461.1| amino acid ABC transporter permease [Vibrio parahaemolyticus 10329]
          Length = 365

 Score =  275 bits (703), Expect = 7e-72,   Method: Composition-based stats.
 Identities = 167/375 (44%), Positives = 245/375 (65%), Gaps = 14/375 (3%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
            +      PP    G++ W+ KN F  P + ++T ++  ++  ++  I+ W F++A WIG
Sbjct: 4   HQFQPDLPPPSNTVGVVGWLRKNLFNGPVNSIVTLILAYIVFNALWHIVDWAFINADWIG 63

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
           S R  C+              ACW FI  R+EQF++G YP A+ WRP L ++T +I    
Sbjct: 64  STRDDCS-----------REGACWVFISVRWEQFMYGFYPEAELWRPRLFYITLAIFTVL 112

Query: 133 MLIPSFPRKFLNSILLFGLFPIFSF-FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIIS 191
           +     P++    +    ++P      +  G  GL +VET  WGGLLVTL+I+  GI++S
Sbjct: 113 LAYEKTPKRLWIWLFFVNIYPFIVAALLYGGVFGLEVVETHKWGGLLVTLIIALVGIVVS 172

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +P+G+ LALGR S++P++R  C  +IE++RGVPL+TVLFMAS+MLPLFL +  + DKL+R
Sbjct: 173 LPIGVALALGRRSDMPIIRSICTIYIEVWRGVPLITVLFMASVMLPLFLAEGSETDKLIR 232

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
           AL+GV  F++AY+AEV+RGGLQ+I KGQ+EAA++LGLSY +K  LII+PQ +K  IP IV
Sbjct: 233 ALIGVVMFSAAYMAEVVRGGLQAIPKGQYEAADALGLSYWKKTGLIILPQALKITIPSIV 292

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISL 371
           NTFIGLFKD+SL+ II MFD+LGI +   ++  W+     T   +F+  VFW+FCF +S 
Sbjct: 293 NTFIGLFKDTSLVLIIGMFDVLGIGQAANTDPEWLG--FATESYVFVALVFWVFCFGMSR 350

Query: 372 YSVFIEKTLHKGSKK 386
           YS+++E  LH G K+
Sbjct: 351 YSIWLENKLHTGHKR 365


>gi|262165599|ref|ZP_06033336.1| amino acid ABC transporter permease protein [Vibrio mimicus VM223]
 gi|262025315|gb|EEY43983.1| amino acid ABC transporter permease protein [Vibrio mimicus VM223]
          Length = 365

 Score =  275 bits (703), Expect = 8e-72,   Method: Composition-based stats.
 Identities = 173/375 (46%), Positives = 244/375 (65%), Gaps = 14/375 (3%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
            +      PP    G I W+ KN F  P + + T  +  L +  I  I+ W  ++A W G
Sbjct: 4   HQFQPSLPPPTNTTGPIGWLRKNLFNGPFNTIATLALGYLAVQGIWNILDWAIINANWSG 63

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
           + R  CT              ACW FI  R+EQF++G YP A+ WRP L F+T +I +  
Sbjct: 64  TTRNDCTLE-----------GACWVFISARWEQFMYGFYPAAELWRPRLFFITLAIFVAL 112

Query: 133 MLIPSFPRKFLNSILLFGLFPIFS-FFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIIS 191
           +     P++    ++   ++P F+   +  G  GL +VET  WGGLLVTL+I+  GII S
Sbjct: 113 LAYEKTPKRGWIWLVFVNIYPFFAAILLYGGLFGLEVVETHKWGGLLVTLIIALVGIIAS 172

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +P+G+ LALGR S++P++R  C  +IE++RGVPL+TVLFMAS+MLPLFL +  +++KLLR
Sbjct: 173 LPIGVALALGRRSDMPIIRSLCTVYIEVWRGVPLITVLFMASVMLPLFLSEGSEINKLLR 232

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
           AL+GV  F++AY+AEV+RGGLQ+I KGQ+EAA++LGLSY +KM LII+PQ +K  IP IV
Sbjct: 233 ALIGVVMFSAAYMAEVIRGGLQAIPKGQYEAADALGLSYWKKMGLIILPQALKITIPSIV 292

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISL 371
           NTFIGLFKD+SL+ II MFD+LGI +   ++  W+     T   +F+  VFWIFCF +S 
Sbjct: 293 NTFIGLFKDTSLVLIIGMFDVLGIGQSANTDPNWLG--FATESYVFVALVFWIFCFGMSR 350

Query: 372 YSVFIEKTLHKGSKK 386
           YS+++E  LH G K+
Sbjct: 351 YSIWLEGKLHTGHKR 365


>gi|258627558|ref|ZP_05722335.1| amino acid ABC transporter, permease protein [Vibrio mimicus VM603]
 gi|258580140|gb|EEW05112.1| amino acid ABC transporter, permease protein [Vibrio mimicus VM603]
          Length = 365

 Score =  275 bits (703), Expect = 8e-72,   Method: Composition-based stats.
 Identities = 173/375 (46%), Positives = 243/375 (64%), Gaps = 14/375 (3%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
            +      PP    G I W+ KN F  P + + T  +  L    I  I+ W  ++A W G
Sbjct: 4   HQFQPSLPPPANTTGPIGWLRKNLFNGPFNTIATLTLGYLAAQGIWNILDWAIINANWSG 63

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
           + R  CT              ACW FI  R+EQF++G YP A+ WRP L F+T +I +  
Sbjct: 64  TTRNDCTLE-----------GACWVFISARWEQFMYGFYPAAELWRPRLFFITLAIFVAL 112

Query: 133 MLIPSFPRKFLNSILLFGLFPIFS-FFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIIS 191
           +     P++    ++   ++P F+   +  G  GL +VET  WGGLLVTL+I+  GII S
Sbjct: 113 LAYEKTPKRGWIWLVFVNIYPFFAAILLYGGLFGLEVVETHKWGGLLVTLIIALVGIIAS 172

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +P+G+ LALGR S++P++R  C  +IE++RGVPL+TVLFMAS+MLPLFL +  +++KLLR
Sbjct: 173 LPIGVALALGRRSDMPIIRSLCTVYIEVWRGVPLITVLFMASVMLPLFLSEGSEINKLLR 232

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
           AL+GV  F++AY+AEV+RGGLQ+I KGQ+EAA++LGLSY +KM LII+PQ +K  IP IV
Sbjct: 233 ALIGVVMFSAAYMAEVIRGGLQAIPKGQYEAADALGLSYWKKMGLIILPQALKITIPSIV 292

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISL 371
           NTFIGLFKD+SL+ II MFD+LGI +   ++  W+     T   +F+  VFWIFCF +S 
Sbjct: 293 NTFIGLFKDTSLVLIIGMFDVLGIGQSANTDPNWLG--FATESYVFVALVFWIFCFGMSR 350

Query: 372 YSVFIEKTLHKGSKK 386
           YS+++E  LH G K+
Sbjct: 351 YSIWLEGKLHTGHKR 365


>gi|312881585|ref|ZP_07741363.1| hypothetical protein VIBC2010_10047 [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309370648|gb|EFP98122.1| hypothetical protein VIBC2010_10047 [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 365

 Score =  275 bits (703), Expect = 8e-72,   Method: Composition-based stats.
 Identities = 170/375 (45%), Positives = 242/375 (64%), Gaps = 14/375 (3%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
            +      PP    G + W+ KN F  P + ++T ++  LL + +  I  W FL A WIG
Sbjct: 4   HQFQPDLPPPANTIGTVGWLRKNLFNGPVNSIVTIVLGYLLFWLLWNIFDWAFLKADWIG 63

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
           + R  C+              ACW FI +R+ QF++G YP  Q WRP L ++T +I    
Sbjct: 64  TTRDACSKE-----------GACWVFIKERWGQFMYGFYPEEQLWRPRLFYITLAIFTAL 112

Query: 133 MLIPSFPRKFLNSILLFGLFPIFS-FFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIIS 191
           +     P++F   +    ++P      +  G  GL +VET  WGGLLVTL+I+  GI++S
Sbjct: 113 LAYEKTPKRFWIWLFFVNIYPFIIGALLYGGIFGLEVVETHKWGGLLVTLIIALVGIVVS 172

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +P+GI LALGR S +P++R  C  +IE++RGVPL+TVLFMAS+MLPLFL +  + DKL+R
Sbjct: 173 LPIGIALALGRRSEMPIIRSICTVYIEIWRGVPLITVLFMASVMLPLFLAEGSETDKLIR 232

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
           AL+GV  F++AY+AEV+RGGLQ+I KGQ+EAA++LGL+Y +KM LII+PQ +K  IP IV
Sbjct: 233 ALIGVVMFSAAYMAEVIRGGLQAIPKGQYEAADALGLTYWKKMGLIILPQALKITIPSIV 292

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISL 371
           NTFIGLFKD+SL+ II MFD+LGI +   ++  W+     T   +F+  VFW+FCF +S 
Sbjct: 293 NTFIGLFKDTSLVLIIGMFDVLGIGQAANTDPEWLG--FATESYVFVALVFWVFCFGMSR 350

Query: 372 YSVFIEKTLHKGSKK 386
           YS+++E  LH G K+
Sbjct: 351 YSIWLENKLHTGHKR 365


>gi|27365996|ref|NP_761524.1| amino acid ABC transporter permease [Vibrio vulnificus CMCP6]
 gi|27362196|gb|AAO11051.1| Amino acid ABC transporter, permease protein [Vibrio vulnificus
           CMCP6]
          Length = 365

 Score =  275 bits (703), Expect = 9e-72,   Method: Composition-based stats.
 Identities = 169/375 (45%), Positives = 244/375 (65%), Gaps = 14/375 (3%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
            +      PP    G+I W+ KN F +P + +LT ++    + ++  +  W FL A W+G
Sbjct: 4   HQFQPDLPPPANTVGVIGWMRKNLFNSPVNSVLTLVLAYFAISTLWYVADWAFLSADWVG 63

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
           S R  CT              ACW FI  R+EQF++G YP A+ WRP L ++T +I    
Sbjct: 64  STRDACT-----------REGACWVFISVRWEQFMYGFYPEAELWRPRLFYITLAIFTLL 112

Query: 133 MLIPSFPRKFLNSILLFGLFPIFSF-FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIIS 191
           +     P++    +    ++P      +  G  GL +VET  WGGLLVTL+I+  GI++S
Sbjct: 113 LAYEKTPKRMWIWLFFVNIYPFIVAALLYGGVFGLEVVETHKWGGLLVTLIIALVGIVVS 172

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +P+G+ LALGR S++P++R  C  +IE++RGVPL+TVLFMAS+MLPLFL +  + DKL+R
Sbjct: 173 LPIGVALALGRRSDMPIIRSLCTVYIEVWRGVPLITVLFMASVMLPLFLSEGSETDKLIR 232

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
           AL+GV  F++AY+AEV+RGGLQ+I KGQ+EAA++LGL+Y +KM LII+PQ +K  IP IV
Sbjct: 233 ALIGVVMFSAAYMAEVVRGGLQAIPKGQYEAADALGLTYWKKMGLIILPQALKITIPSIV 292

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISL 371
           NTFIGLFKD+SL+ II MFD+LGI +   ++  W+     T   +F+  VFW+FCF +S 
Sbjct: 293 NTFIGLFKDTSLVLIIGMFDVLGIGQAANTDPEWLG--FATESYVFVALVFWVFCFGMSR 350

Query: 372 YSVFIEKTLHKGSKK 386
           YS+++E  LH G K+
Sbjct: 351 YSIWLENKLHTGHKR 365


>gi|84394263|ref|ZP_00992989.1| ABC-type amino acid transport system, permease component [Vibrio
           splendidus 12B01]
 gi|84375102|gb|EAP92023.1| ABC-type amino acid transport system, permease component [Vibrio
           splendidus 12B01]
          Length = 365

 Score =  275 bits (702), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 165/375 (44%), Positives = 241/375 (64%), Gaps = 14/375 (3%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
            +      PP    G + W+ KN F  P + ++T ++       +  I  W F++A WIG
Sbjct: 4   HQFQPDLPPPANTVGPVGWLRKNLFNGPINSVVTVVLGYFAFTLLWAIADWAFINADWIG 63

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
           + R  CT+           + ACW FI  R++QF++G YP A+ WRP L + T +I +  
Sbjct: 64  TTRDACTS-----------DGACWVFISVRWDQFMYGFYPEAELWRPRLFYATLAIFVVL 112

Query: 133 MLIPSFPRKFLNSILLFGLFPIFSF-FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIIS 191
           +     P++    +    ++P      +  G  GL +V+T  WGGLLVTL+I+  GI++S
Sbjct: 113 LAYEKTPKRTWIWLFFVNIYPFIIAGLLYGGVFGLEVVDTHKWGGLLVTLIIALVGIVVS 172

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +P+G+ LALGR S +P++R  C  +IE++RGVPL+TVLFMAS+MLPLFL +  + DKL+R
Sbjct: 173 LPIGVALALGRRSEMPIIRSMCTVYIEIWRGVPLITVLFMASVMLPLFLSEGMETDKLIR 232

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
           AL+GV  F++AY+AEV+RGGLQ+I KGQ+EAA++LGLSY +K  LII+PQ +K  IP IV
Sbjct: 233 ALVGVVLFSAAYMAEVIRGGLQAIPKGQYEAADALGLSYWKKTGLIILPQALKITIPSIV 292

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISL 371
           NTFIGLFKD+SL+ II MFD+LGI +   ++  W+     T   +F+  VFW+FCF +S 
Sbjct: 293 NTFIGLFKDTSLVLIIGMFDVLGIGQAANTDPEWLG--FSTESYVFVALVFWVFCFGMSR 350

Query: 372 YSVFIEKTLHKGSKK 386
           YS+++E  LH G K+
Sbjct: 351 YSIWLENRLHTGHKR 365


>gi|149191356|ref|ZP_01869609.1| ABC-type amino acid transport system, permease component [Vibrio
           shilonii AK1]
 gi|148834835|gb|EDL51819.1| ABC-type amino acid transport system, permease component [Vibrio
           shilonii AK1]
          Length = 365

 Score =  275 bits (702), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 165/376 (43%), Positives = 241/376 (64%), Gaps = 14/376 (3%)

Query: 12  RKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWI 71
           + +      PP    G++ W+ KN F  P + LLT ++    +  +  +  W  L A W+
Sbjct: 3   QHQFQPDLPPPANTVGVVGWLRKNLFNGPVNSLLTIVLGYFAISLLWYVFDWAILKADWV 62

Query: 72  GSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLT 131
           G+ R  C+              ACW FI  R+EQF++G YP A+ WRP L + T +I + 
Sbjct: 63  GTTRDACS-----------REGACWVFISVRWEQFMYGFYPQAELWRPRLFYATLAIFVA 111

Query: 132 PMLIPSFPRKFLNSILLFGLFPIFSF-FVLYGGLGLSIVETSLWGGLLVTLVISFFGIII 190
            +     P++    +    ++P  +   +  G  GL +VET  WGGLLVTL+I+  GII+
Sbjct: 112 LLAYERTPKRLWIWLFFVNIYPFIAAGLLYGGVFGLEVVETHKWGGLLVTLIIALVGIIV 171

Query: 191 SMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLL 250
           S+P+G+ LALGR S +P++R  C  +IE++RGVPL+TVLFMAS+MLPLF  +  + DKL+
Sbjct: 172 SLPIGVALALGRRSEMPIIRSICTVYIEVWRGVPLITVLFMASVMLPLFFSEGVETDKLI 231

Query: 251 RALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGI 310
           RAL+GV  F++AY+AEV+RGGLQ+I KGQ+EAA++LGL+Y +KM LI++PQ +K  IP I
Sbjct: 232 RALIGVVMFSAAYMAEVIRGGLQAIPKGQYEAADALGLTYWKKMGLIVLPQALKITIPSI 291

Query: 311 VNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSIS 370
           VNTFIGLFKD+SL+ II MFD+LGI +   ++  W+     T   +F+  VFW+FCF +S
Sbjct: 292 VNTFIGLFKDTSLVLIIGMFDVLGIGQAANTDPEWLG--FATESYVFVALVFWVFCFGMS 349

Query: 371 LYSVFIEKTLHKGSKK 386
            YS+++E  LH G K+
Sbjct: 350 RYSIWLENKLHTGHKR 365


>gi|222148882|ref|YP_002549839.1| ABC transporter membrane spanning protein (amino acid)
           [Agrobacterium vitis S4]
 gi|221735868|gb|ACM36831.1| ABC transporter membrane spanning protein (amino acid)
           [Agrobacterium vitis S4]
          Length = 395

 Score =  274 bits (701), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 224/380 (58%), Positives = 288/380 (75%)

Query: 6   KEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVF 65
               +VR  ++  S  P  Q G  AW+ KN   TPKD++LT L +  L + +PG+I+W+F
Sbjct: 15  HTPVFVRTEMVSASPAPAGQIGTTAWVRKNLIATPKDVVLTLLALAFLAYVLPGLINWLF 74

Query: 66  LDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLT 125
           + AVW G+ R  C TVSQGG  PDG   ACWAF+  +++QFIFG YP  + WRP+ V + 
Sbjct: 75  VHAVWSGAGRIACLTVSQGGALPDGSAGACWAFVGAKFQQFIFGRYPSEEIWRPLTVMVL 134

Query: 126 GSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISF 185
            ++LL PMLIP  P K  N++LLF + P+ SFF+L GG GL  VET+ WGGL+VTL++SF
Sbjct: 135 FAVLLAPMLIPKAPFKGTNALLLFLVLPVVSFFLLTGGFGLEHVETARWGGLMVTLILSF 194

Query: 186 FGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWD 245
           FGI +S+P+GI+LALGR S +PV++  C+ FIE+ RGVPL+TVLFMAS+MLPLFLPD W 
Sbjct: 195 FGIAVSLPVGIMLALGRRSTMPVIKMLCVIFIEVVRGVPLITVLFMASVMLPLFLPDGWS 254

Query: 246 VDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKR 305
            DKLLRAL+GVS F+SAY+AEV+RGGLQ+I KGQFE A+SLGLSY QK+RLI++PQ IK 
Sbjct: 255 FDKLLRALVGVSIFSSAYMAEVIRGGLQAIPKGQFEGADSLGLSYWQKIRLIVLPQAIKL 314

Query: 306 VIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIF 365
           VIPGIVNTFIGLFKD+SL+SII MFDLLGIV +N S+S W +  T  TGL+F GF++W+F
Sbjct: 315 VIPGIVNTFIGLFKDTSLVSIIGMFDLLGIVILNLSDSNWATPETAVTGLVFAGFIYWLF 374

Query: 366 CFSISLYSVFIEKTLHKGSK 385
           CFS+S YS F+E+ L  G K
Sbjct: 375 CFSMSRYSYFMERHLDTGHK 394


>gi|91227963|ref|ZP_01262073.1| amino acid ABC transporter, permease protein [Vibrio alginolyticus
           12G01]
 gi|91188284|gb|EAS74582.1| amino acid ABC transporter, permease protein [Vibrio alginolyticus
           12G01]
          Length = 365

 Score =  274 bits (701), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 166/375 (44%), Positives = 246/375 (65%), Gaps = 14/375 (3%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
            +      PP    G + W+ KN F  P + ++T ++  +++ +I  I+ W F++A WIG
Sbjct: 4   HQFQPDLPPPANTVGFVGWMRKNLFNGPINSIVTVILAYIVVTAIWYIVDWAFINADWIG 63

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
           S R  C+            + ACW FI  R+EQF++G YP ++ WRP L ++T ++    
Sbjct: 64  STRDDCS-----------RDGACWVFISVRWEQFMYGFYPESELWRPRLFYITLAMFTVL 112

Query: 133 MLIPSFPRKFLNSILLFGLFPIFSF-FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIIS 191
           +     P++    +    ++P      +  G  GL +V+T  WGGLLVTL+I+  GI++S
Sbjct: 113 LAYEKTPKRMWIWLFFVNIYPFIIAGLLYGGVFGLEVVDTHKWGGLLVTLIIALVGIVVS 172

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +P+G++LALGR S +P++R  C  +IE++RGVPL+TVLFMAS+MLPLF+ +  + DKL+R
Sbjct: 173 LPIGVVLALGRRSEMPIIRSICTVYIEVWRGVPLITVLFMASVMLPLFMSEGSETDKLIR 232

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
           AL+GV  FASAY+AEV+RGGLQ+I KGQ+EAA++LGLSY +K  LII+PQ +K  IP IV
Sbjct: 233 ALIGVVMFASAYMAEVVRGGLQAIPKGQYEAADALGLSYWKKTGLIILPQALKIAIPSIV 292

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISL 371
           NTFIGLFKD+SL+ II MFD+LGI +   ++  W+     T   +F+  VFW+FCF +S 
Sbjct: 293 NTFIGLFKDTSLVLIIGMFDVLGIGQAANTDPEWLG--FATESYVFVALVFWVFCFGMSR 350

Query: 372 YSVFIEKTLHKGSKK 386
           YS+++E  LH G K+
Sbjct: 351 YSIWLENKLHTGHKR 365


>gi|86148622|ref|ZP_01066904.1| ABC-type amino acid transport system, permease component [Vibrio
           sp. MED222]
 gi|218709392|ref|YP_002417013.1| ABC transporter transmembrane protein [Vibrio splendidus LGP32]
 gi|85833578|gb|EAQ51754.1| ABC-type amino acid transport system, permease component [Vibrio
           sp. MED222]
 gi|218322411|emb|CAV18564.1| ABC transporter: Transmembrane protein [Vibrio splendidus LGP32]
          Length = 365

 Score =  274 bits (701), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 165/375 (44%), Positives = 238/375 (63%), Gaps = 14/375 (3%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
            +      PP    G + W+ KN F  P + ++T ++       +  I  W FL A WIG
Sbjct: 4   HQFQPDLPPPANTVGPVGWLRKNLFNGPINSVVTVVLAYFAFTLLWAIADWAFLSADWIG 63

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
           + R  CT+             ACW FI  R++QF++G YP A+ WRP   + T +I +  
Sbjct: 64  TTRDACTSE-----------GACWVFISVRWDQFMYGFYPEAELWRPRFFYATLAIFVAL 112

Query: 133 MLIPSFPRKFLNSILLFGLFPIFSF-FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIIS 191
           +     P++    +    ++P      +  G  GL +V+T  WGGLLVTL+I+  GI++S
Sbjct: 113 LAYEKTPKRTWIWLFFVNIYPFIIAGLLYGGVFGLEVVDTHKWGGLLVTLIIALVGIVVS 172

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +P+G+ LALGR S +P++R  C  +IE++RGVPL+TVLFMAS+MLPLFL +  + DKL+R
Sbjct: 173 LPIGVALALGRRSEMPIIRSMCTVYIEIWRGVPLITVLFMASVMLPLFLSEGMETDKLIR 232

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
           AL+GV  F++AY+AEV+RGGLQ+I KGQ+EAA++LGLSY +K  LII+PQ +K  IP IV
Sbjct: 233 ALVGVVLFSAAYMAEVIRGGLQAIPKGQYEAADALGLSYWKKTGLIILPQALKITIPSIV 292

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISL 371
           NTFIGLFKD+SL+ II MFD+LGI +   ++  W+     T   +F+  VFW+FCF +S 
Sbjct: 293 NTFIGLFKDTSLVLIIGMFDVLGIGQAANTDPEWLG--YSTESYVFVALVFWVFCFGMSR 350

Query: 372 YSVFIEKTLHKGSKK 386
           YS+++E  LH G K+
Sbjct: 351 YSIWLENRLHTGHKR 365


>gi|269968793|ref|ZP_06182782.1| amino acid ABC transporter, permease protein [Vibrio alginolyticus
           40B]
 gi|269826605|gb|EEZ80950.1| amino acid ABC transporter, permease protein [Vibrio alginolyticus
           40B]
          Length = 365

 Score =  274 bits (701), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 167/375 (44%), Positives = 246/375 (65%), Gaps = 14/375 (3%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
            +      PP    G + W+ KN F  P + ++T ++  +++ +I  I+ W F++A WIG
Sbjct: 4   HQFQPDLPPPANTVGFVGWMRKNLFNGPINSIVTVILAYIVVTAIWYIVDWAFINADWIG 63

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
           S R  C+            + ACW FI  R+EQF++G YP ++ WRP L ++T +I    
Sbjct: 64  STRDDCS-----------RDGACWVFISVRWEQFMYGFYPESELWRPRLFYITLAIFTVL 112

Query: 133 MLIPSFPRKFLNSILLFGLFPIFSF-FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIIS 191
           +     P++    +    ++P      +  G  GL +V+T  WGGLLVTL+I+  GI++S
Sbjct: 113 LAYEKTPKRMWIWLFFVNIYPFIIAGLLYGGVFGLEVVDTHKWGGLLVTLIIALVGIVVS 172

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +P+G++LALGR S +P++R  C  +IE++RGVPL+TVLFMAS+MLPLF+ +  + DKL+R
Sbjct: 173 LPIGVVLALGRRSEMPIIRSICTVYIEVWRGVPLITVLFMASVMLPLFMSEGSETDKLIR 232

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
           AL+GV  FASAY+AEV+RGGLQ+I KGQ+EAA++LGLSY +K  LII+PQ +K  IP IV
Sbjct: 233 ALIGVVMFASAYMAEVVRGGLQAIPKGQYEAADALGLSYWKKTGLIILPQALKITIPSIV 292

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISL 371
           NTFIGLFKD+SL+ II MFD+LGI +   ++  W+     T   +F+  VFW+FCF +S 
Sbjct: 293 NTFIGLFKDTSLVLIIGMFDVLGIGQAANTDPEWLG--FATESYVFVALVFWVFCFGMSR 350

Query: 372 YSVFIEKTLHKGSKK 386
           YS+++E  LH G K+
Sbjct: 351 YSIWLENKLHTGHKR 365


>gi|307942364|ref|ZP_07657715.1| general L-amino acid transport system permease protein AapM
           [Roseibium sp. TrichSKD4]
 gi|307774650|gb|EFO33860.1| general L-amino acid transport system permease protein AapM
           [Roseibium sp. TrichSKD4]
          Length = 384

 Score =  274 bits (700), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 182/381 (47%), Positives = 253/381 (66%), Gaps = 10/381 (2%)

Query: 11  VRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVW 70
           VR         PV   G I W+ +N F +  + +LT + I +    I  II + F+DAVW
Sbjct: 9   VRTEEAPLLPAPVSTTGAIGWMRQNLFSSIGNTILTVIGIFIAYSMIMPIIQFAFIDAVW 68

Query: 71  IGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILL 130
            G +RT C        +P     ACWA++    +QFI+G YP  + +R  +V+   ++LL
Sbjct: 69  TGEDRTACLAA-----EPGEKVGACWAYVGAYMKQFIYGRYPYEELYRVNIVYGLFALLL 123

Query: 131 TPMLIPSFPRKFLNSILLFGLFPIFSF-----FVLYGGLGLSIVETSLWGGLLVTLVISF 185
            P+ +PS P K LN+ L   +FPI ++           +   IVET++WGGLLVTLVI+ 
Sbjct: 124 IPLAMPSVPAKGLNAFLFLVMFPIAAYYLLTGLEFGSFVVFPIVETAVWGGLLVTLVIAV 183

Query: 186 FGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWD 245
            GI+ S+PLG+ LALGR S +P+++   I FIE +RGVPL+TVLFMAS+MLPLFLP+  +
Sbjct: 184 TGIVASLPLGVALALGRRSQMPIIKLVSIIFIEFWRGVPLITVLFMASVMLPLFLPEGVN 243

Query: 246 VDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKR 305
            DKLLR L+GV+ F++AY+AEV+RGGLQ+I KGQ+E A +LGL +   M LII+PQ +K 
Sbjct: 244 FDKLLRVLIGVTLFSAAYMAEVVRGGLQAIPKGQYEGAMALGLRFWPMMYLIILPQALKL 303

Query: 306 VIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIF 365
           VIPGIVNTFIGLFKD++L+ I+ MFDLLG ++ +FS+STW +     TG +F G VF++F
Sbjct: 304 VIPGIVNTFIGLFKDTTLVLIVGMFDLLGQIKSSFSDSTWATPSQGPTGYLFAGVVFFLF 363

Query: 366 CFSISLYSVFIEKTLHKGSKK 386
           CF +S YS+F+EK LH G K+
Sbjct: 364 CFGMSRYSIFMEKKLHTGHKR 384


>gi|163800830|ref|ZP_02194730.1| amino acid ABC transporter, permease protein [Vibrio sp. AND4]
 gi|159175179|gb|EDP59976.1| amino acid ABC transporter, permease protein [Vibrio sp. AND4]
          Length = 365

 Score =  274 bits (700), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 166/375 (44%), Positives = 244/375 (65%), Gaps = 14/375 (3%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
            +      PP    G++ W+ KN F  P + ++T  +  ++  ++  I+ W F++A WIG
Sbjct: 4   HQFQPDLPPPANTIGVVGWLRKNLFNGPINSIVTLFLAYIVFSALWNILDWAFINADWIG 63

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
           + R  C+              ACW FI  R+EQF++G YP A+ WRP L ++T +I    
Sbjct: 64  TTRDDCS-----------REGACWVFISVRWEQFMYGFYPEAELWRPRLFYITLAIFTVL 112

Query: 133 MLIPSFPRKFLNSILLFGLFPIFSF-FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIIS 191
           +     P++    +    ++P      +  G  GL +VET  WGGLLVTL+I+  GI++S
Sbjct: 113 LAYEKTPKRIWIWLFFVNIYPFIIAALLYGGVFGLEVVETHKWGGLLVTLIIALVGIVVS 172

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +P+G+ LALGR S++P++R  C  +IE++RGVPL+TVLFMAS+MLPLFL +  + DKL+R
Sbjct: 173 LPIGVALALGRRSDMPIIRSICTVYIEVWRGVPLITVLFMASVMLPLFLSEGSETDKLIR 232

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
           AL+GV  F++AY+AEV+RGGLQ+I KGQ+EAA++LGLSY +K  LII+PQ +K  IP IV
Sbjct: 233 ALIGVVMFSAAYMAEVVRGGLQAIPKGQYEAADALGLSYWKKTGLIILPQALKITIPSIV 292

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISL 371
           NTFIGLFKD+SL+ II MFD+LGI +   ++  W+     T   +F+  VFW+FCF +S 
Sbjct: 293 NTFIGLFKDTSLVLIIGMFDVLGIGQAANTDPEWLG--FATESYVFVALVFWVFCFGMSR 350

Query: 372 YSVFIEKTLHKGSKK 386
           YS+++E  LH G K+
Sbjct: 351 YSIWLENKLHTGHKR 365


>gi|152998390|ref|YP_001343225.1| polar amino acid ABC transporter inner membrane subunit
           [Marinomonas sp. MWYL1]
 gi|150839314|gb|ABR73290.1| polar amino acid ABC transporter, inner membrane subunit
           [Marinomonas sp. MWYL1]
          Length = 366

 Score =  273 bits (699), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 156/370 (42%), Positives = 237/370 (64%), Gaps = 13/370 (3%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
               PPV   G +AW+ +N F +P +I LT   + +L   +P +I W F++A W GS++ 
Sbjct: 9   PSLPPPVTSVGAVAWVRQNLFSSPLNIFLTLFSLYILYLLVPPVIEWAFINATWEGSSKA 68

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            CT              ACWAFI   ++QF++G YP A+ WR  L  +   +++    + 
Sbjct: 69  ACTA-----------GGACWAFIGVYFDQFMYGLYPEAETWRINLAVILLVVMVGAFAVK 117

Query: 137 SFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGI 196
           +  + +L+  +L     +  F    G  GL +VETSLWGGL +T+++   GI+ S PLGI
Sbjct: 118 TINKLYLSIAILVVYPIVAYFLFAGGVFGLEVVETSLWGGLFLTVLLGVIGIVASFPLGI 177

Query: 197 LLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGV 256
           +LALGR S +P+ +  C+ FIE  R VPL+T+LFMAS+M+PLFLP+  + +KLLR L+G+
Sbjct: 178 VLALGRRSEMPIAKSVCVVFIETIRAVPLITILFMASVMIPLFLPEGLNFNKLLRVLIGI 237

Query: 257 SAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIG 316
           + F++AY+AEV+RGGLQ+I KGQ+EAA+++GL+Y Q M L+I+PQ +K VIPGIVN+FI 
Sbjct: 238 TLFSAAYMAEVVRGGLQAIPKGQYEAADAMGLTYWQSMILVILPQALKLVIPGIVNSFIA 297

Query: 317 LFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFI 376
           LFKD++L+ I+ MFD LG ++    +S W+ +     G  F   ++W+ CF +S YS+ +
Sbjct: 298 LFKDTTLVYIVGMFDFLGRIQAANHDSNWLGTT--IEGYAFAALIYWVICFGMSRYSMAL 355

Query: 377 EKTLHKGSKK 386
           E+ L  G K+
Sbjct: 356 ERKLETGHKR 365


>gi|37679739|ref|NP_934348.1| ABC-type amino acid transport system, permease component [Vibrio
           vulnificus YJ016]
 gi|37198484|dbj|BAC94319.1| ABC-type amino acid transport system, permease component [Vibrio
           vulnificus YJ016]
          Length = 372

 Score =  273 bits (698), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 169/375 (45%), Positives = 244/375 (65%), Gaps = 14/375 (3%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
            +      PP    G+I W+ KN F +P + +LT ++    + ++  +  W FL A W+G
Sbjct: 11  HQFQPDLPPPANTVGVIGWMRKNLFNSPVNSVLTLVLAYFAISTLWYVADWAFLSADWVG 70

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
           S R  CT              ACW FI  R+EQF++G YP A+ WRP L ++T +I    
Sbjct: 71  STRDACT-----------REGACWVFISVRWEQFMYGFYPEAELWRPRLFYITLAIFTVL 119

Query: 133 MLIPSFPRKFLNSILLFGLFPIFSF-FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIIS 191
           +     P++    +    ++P      +  G  GL +VET  WGGLLVTL+I+  GI++S
Sbjct: 120 LAYEKTPKRMWIWLFFVNIYPFIVAALLYGGVFGLEVVETHKWGGLLVTLIIALVGIVVS 179

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +P+G+ LALGR S++P++R  C  +IE++RGVPL+TVLFMAS+MLPLFL +  + DKL+R
Sbjct: 180 LPIGVALALGRRSDMPIIRSLCTVYIEVWRGVPLITVLFMASVMLPLFLSEGSETDKLIR 239

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
           AL+GV  F++AY+AEV+RGGLQ+I KGQ+EAA++LGL+Y +KM LII+PQ +K  IP IV
Sbjct: 240 ALIGVVMFSAAYMAEVVRGGLQAIPKGQYEAADALGLTYWKKMGLIILPQALKITIPSIV 299

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISL 371
           NTFIGLFKD+SL+ II MFD+LGI +   ++  W+     T   +F+  VFW+FCF +S 
Sbjct: 300 NTFIGLFKDTSLVLIIGMFDVLGIGQAANTDPEWLG--FATESYVFVALVFWVFCFGMSR 357

Query: 372 YSVFIEKTLHKGSKK 386
           YS+++E  LH G K+
Sbjct: 358 YSIWLENKLHTGHKR 372


>gi|260778550|ref|ZP_05887442.1| amino acid ABC transporter permease protein [Vibrio coralliilyticus
           ATCC BAA-450]
 gi|260604714|gb|EEX31009.1| amino acid ABC transporter permease protein [Vibrio coralliilyticus
           ATCC BAA-450]
          Length = 365

 Score =  273 bits (698), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 166/375 (44%), Positives = 240/375 (64%), Gaps = 14/375 (3%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
            +      PP    G++ W+ KN F  P + +LT ++  L +  +  +  W  L A W+G
Sbjct: 4   HQFQPDLPPPANTVGVVGWLRKNLFNGPVNSILTVVLAYLAISLLWTVFDWSILKADWVG 63

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
           + R  CT            + ACW FI  R+EQF++G YP  + WRP L + T +I    
Sbjct: 64  TTRDACT-----------RDGACWVFISVRWEQFMYGFYPQEELWRPRLFYFTLAIFTVL 112

Query: 133 MLIPSFPRKFLNSILLFGLFPIFSF-FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIIS 191
           +     P++    +    ++P      +  G  GL +VET  WGGLLVTL+I+  GI++S
Sbjct: 113 LAYEKTPKRLWIWLFFVNIYPFIIAALLYGGVFGLEVVETHKWGGLLVTLIIALVGIVVS 172

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +P+G+ LALGR S +P++R  C  +IE++RGVPL+TVLFMAS+MLPLFL +  + DKL+R
Sbjct: 173 LPIGVALALGRRSEMPIIRSICTVYIEVWRGVPLITVLFMASVMLPLFLAEGSETDKLIR 232

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
           AL+GV  F++AY+AEV+RGGLQ+I KGQ+EAA++LGLSY +KM LI++PQ +K  IP IV
Sbjct: 233 ALIGVVMFSAAYMAEVVRGGLQAIPKGQYEAADALGLSYWKKMGLIVLPQALKITIPSIV 292

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISL 371
           NTFIGLFKD+SL+ II MFD+LGI +   ++  W+     T   +F+  VFW+FCF +S 
Sbjct: 293 NTFIGLFKDTSLVLIIGMFDVLGIGQAANTDPEWLG--FATESYVFVALVFWVFCFGMSR 350

Query: 372 YSVFIEKTLHKGSKK 386
           YS+++E  LH G K+
Sbjct: 351 YSIWLENKLHTGHKR 365


>gi|229521466|ref|ZP_04410885.1| amino acid ABC transporter permease protein [Vibrio cholerae TM
           11079-80]
 gi|297578945|ref|ZP_06940873.1| amino acid ABC transporter [Vibrio cholerae RC385]
 gi|229341564|gb|EEO06567.1| amino acid ABC transporter permease protein [Vibrio cholerae TM
           11079-80]
 gi|297536539|gb|EFH75372.1| amino acid ABC transporter [Vibrio cholerae RC385]
          Length = 365

 Score =  273 bits (698), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 171/375 (45%), Positives = 242/375 (64%), Gaps = 14/375 (3%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
            +      PP    G++ W+ KN F    + + T ++  L +  +  I+ W   +A W G
Sbjct: 4   HQFQPSLPPPSNTTGVVGWLRKNLFNGVFNSIATLVLGYLAIQGLLNILDWAIFNANWSG 63

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
           + R  CT              ACW FI  R+EQF++G YP A+ WRP L F T ++ +  
Sbjct: 64  TTRNDCTLE-----------GACWVFISVRWEQFMYGFYPAAELWRPRLFFFTLALFVAL 112

Query: 133 MLIPSFPRKFLNSILLFGLFPIFS-FFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIIS 191
           +     P++    ++   L+P F+   +  G  GL +VET  WGGLLVTL+I+  GII S
Sbjct: 113 LAYEKTPKRGWIWLVFVNLYPFFAALLLYGGVFGLEVVETHKWGGLLVTLIIALVGIIAS 172

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +P+G+ LALGR S++P++R  C  +IE++RGVPL+TVLFMAS+MLPLFL    ++DKLLR
Sbjct: 173 LPIGVALALGRRSDMPIIRSLCTVYIEVWRGVPLITVLFMASVMLPLFLSQGSEIDKLLR 232

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
           AL+GV  F++AY+AEV+RGGLQ+I KGQ+EAA++LGLSY +KM LII+PQ +K  IP IV
Sbjct: 233 ALIGVVMFSAAYMAEVIRGGLQAIPKGQYEAADALGLSYWKKMGLIILPQALKITIPSIV 292

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISL 371
           NTFIGLFKD+SL+ II MFD+LGI +   ++  W+     T   +F+  VFWIFCF +S 
Sbjct: 293 NTFIGLFKDTSLVLIIGMFDVLGIGQSANTDPNWLG--FATESYVFVALVFWIFCFGMSR 350

Query: 372 YSVFIEKTLHKGSKK 386
           YS+++E  LH G K+
Sbjct: 351 YSIWLEGKLHTGHKR 365


>gi|15641372|ref|NP_231004.1| amino acid ABC transporter, permease protein [Vibrio cholerae O1
           biovar El Tor str. N16961]
 gi|121587995|ref|ZP_01677747.1| amino acid ABC transporter, permease protein [Vibrio cholerae
           2740-80]
 gi|121728528|ref|ZP_01681551.1| amino acid ABC transporter, permease protein [Vibrio cholerae V52]
 gi|147674160|ref|YP_001216919.1| amino acid ABC transporter, permease protein [Vibrio cholerae O395]
 gi|153212686|ref|ZP_01948343.1| amino acid ABC transporter, permease protein [Vibrio cholerae 1587]
 gi|153819357|ref|ZP_01972024.1| amino acid ABC transporter, permease protein [Vibrio cholerae NCTC
           8457]
 gi|153825276|ref|ZP_01977943.1| amino acid ABC transporter, permease protein [Vibrio cholerae
           MZO-2]
 gi|153828797|ref|ZP_01981464.1| amino acid ABC transporter, permease protein [Vibrio cholerae
           623-39]
 gi|183179358|ref|ZP_02957569.1| amino acid ABC transporter, permease protein [Vibrio cholerae
           MZO-3]
 gi|227081531|ref|YP_002810082.1| amino acid ABC transporter, permease protein [Vibrio cholerae
           M66-2]
 gi|229505059|ref|ZP_04394569.1| amino acid ABC transporter permease protein [Vibrio cholerae BX
           330286]
 gi|229511271|ref|ZP_04400750.1| amino acid ABC transporter permease protein [Vibrio cholerae B33]
 gi|229515732|ref|ZP_04405191.1| amino acid ABC transporter permease protein [Vibrio cholerae TMA
           21]
 gi|229518389|ref|ZP_04407833.1| amino acid ABC transporter permease protein [Vibrio cholerae RC9]
 gi|229523538|ref|ZP_04412943.1| amino acid ABC transporter permease protein [Vibrio cholerae bv.
           albensis VL426]
 gi|229529564|ref|ZP_04418954.1| amino acid ABC transporter permease protein [Vibrio cholerae
           12129(1)]
 gi|229608063|ref|YP_002878711.1| amino acid ABC transporter permease protein [Vibrio cholerae
           MJ-1236]
 gi|254848482|ref|ZP_05237832.1| amino acid ABC transporter [Vibrio cholerae MO10]
 gi|255745747|ref|ZP_05419695.1| amino acid ABC transporter permease protein [Vibrio cholera CIRS
           101]
 gi|262158975|ref|ZP_06030087.1| amino acid ABC transporter permease protein [Vibrio cholerae INDRE
           91/1]
 gi|262169334|ref|ZP_06037026.1| amino acid ABC transporter permease protein [Vibrio cholerae RC27]
 gi|298498556|ref|ZP_07008363.1| amino acid ABC transporter [Vibrio cholerae MAK 757]
 gi|9655853|gb|AAF94518.1| amino acid ABC transporter, permease protein [Vibrio cholerae O1
           biovar El Tor str. N16961]
 gi|121547736|gb|EAX57827.1| amino acid ABC transporter, permease protein [Vibrio cholerae
           2740-80]
 gi|121629192|gb|EAX61632.1| amino acid ABC transporter, permease protein [Vibrio cholerae V52]
 gi|124116336|gb|EAY35156.1| amino acid ABC transporter, permease protein [Vibrio cholerae 1587]
 gi|126510102|gb|EAZ72696.1| amino acid ABC transporter, permease protein [Vibrio cholerae NCTC
           8457]
 gi|146316043|gb|ABQ20582.1| amino acid ABC transporter, permease protein [Vibrio cholerae O395]
 gi|148875750|gb|EDL73885.1| amino acid ABC transporter, permease protein [Vibrio cholerae
           623-39]
 gi|149741104|gb|EDM55163.1| amino acid ABC transporter, permease protein [Vibrio cholerae
           MZO-2]
 gi|183012769|gb|EDT88069.1| amino acid ABC transporter, permease protein [Vibrio cholerae
           MZO-3]
 gi|227009419|gb|ACP05631.1| amino acid ABC transporter, permease protein [Vibrio cholerae
           M66-2]
 gi|227013277|gb|ACP09487.1| amino acid ABC transporter, permease protein [Vibrio cholerae O395]
 gi|229333338|gb|EEN98824.1| amino acid ABC transporter permease protein [Vibrio cholerae
           12129(1)]
 gi|229337119|gb|EEO02136.1| amino acid ABC transporter permease protein [Vibrio cholerae bv.
           albensis VL426]
 gi|229345104|gb|EEO10078.1| amino acid ABC transporter permease protein [Vibrio cholerae RC9]
 gi|229347501|gb|EEO12461.1| amino acid ABC transporter permease protein [Vibrio cholerae TMA
           21]
 gi|229351236|gb|EEO16177.1| amino acid ABC transporter permease protein [Vibrio cholerae B33]
 gi|229357282|gb|EEO22199.1| amino acid ABC transporter permease protein [Vibrio cholerae BX
           330286]
 gi|229370718|gb|ACQ61141.1| amino acid ABC transporter permease protein [Vibrio cholerae
           MJ-1236]
 gi|254844187|gb|EET22601.1| amino acid ABC transporter [Vibrio cholerae MO10]
 gi|255736822|gb|EET92219.1| amino acid ABC transporter permease protein [Vibrio cholera CIRS
           101]
 gi|262022147|gb|EEY40856.1| amino acid ABC transporter permease protein [Vibrio cholerae RC27]
 gi|262029160|gb|EEY47812.1| amino acid ABC transporter permease protein [Vibrio cholerae INDRE
           91/1]
 gi|297542889|gb|EFH78939.1| amino acid ABC transporter [Vibrio cholerae MAK 757]
 gi|327484030|gb|AEA78437.1| Amino acid ABC transporter, permease protein [Vibrio cholerae
           LMA3894-4]
          Length = 365

 Score =  273 bits (698), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 170/375 (45%), Positives = 242/375 (64%), Gaps = 14/375 (3%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
            +      PP    G++ W+ KN F    + + T ++  L +  +  I+ W   +A W G
Sbjct: 4   HQFQPSLPPPSNTTGVVGWLRKNLFNGVFNSIATLVLGYLAIQGLLNILDWAIFNANWSG 63

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
           + R  CT              ACW FI  R+EQF++G YP A+ WRP L F T ++ +  
Sbjct: 64  TTRNDCTLE-----------GACWVFISVRWEQFMYGFYPAAELWRPRLFFFTLALFVAL 112

Query: 133 MLIPSFPRKFLNSILLFGLFPIFS-FFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIIS 191
           +     P++    ++   ++P F+   +  G  GL +VET  WGGLLVTL+I+  GII S
Sbjct: 113 LAYEKTPKRGWIWLVFVNIYPFFAALLLYGGVFGLEVVETHKWGGLLVTLIIALVGIIAS 172

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +P+G+ LALGR S++P++R  C  +IE++RGVPL+TVLFMAS+MLPLFL    ++DKLLR
Sbjct: 173 LPIGVALALGRRSDMPIIRSLCTVYIEVWRGVPLITVLFMASVMLPLFLSQGSEIDKLLR 232

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
           AL+GV  F++AY+AEV+RGGLQ+I KGQ+EAA++LGLSY +KM LII+PQ +K  IP IV
Sbjct: 233 ALIGVVMFSAAYMAEVIRGGLQAIPKGQYEAADALGLSYWKKMGLIILPQALKITIPSIV 292

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISL 371
           NTFIGLFKD+SL+ II MFD+LGI +   ++  W+     T   +F+  VFWIFCF +S 
Sbjct: 293 NTFIGLFKDTSLVLIIGMFDVLGIGQSANTDPNWLG--FATESYVFVALVFWIFCFGMSR 350

Query: 372 YSVFIEKTLHKGSKK 386
           YS+++E  LH G K+
Sbjct: 351 YSIWLEGKLHTGHKR 365


>gi|254225348|ref|ZP_04918960.1| amino acid ABC transporter, permease protein [Vibrio cholerae V51]
 gi|125622189|gb|EAZ50511.1| amino acid ABC transporter, permease protein [Vibrio cholerae V51]
          Length = 365

 Score =  273 bits (697), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 171/375 (45%), Positives = 242/375 (64%), Gaps = 14/375 (3%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
            +      PP    G++ W+ KN F    + + T ++  L +  +  I+ W   +A W G
Sbjct: 4   HQFQPSLPPPSNTTGVVGWLRKNLFNGVFNSIATLVLGYLAIQGLLNILDWAIFNANWSG 63

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
           + R  CT              ACW FI  R+EQF++G YP A+ WRP L F T ++ +  
Sbjct: 64  TTRNDCTLE-----------GACWVFISVRWEQFMYGFYPTAELWRPRLFFFTLALFVAL 112

Query: 133 MLIPSFPRKFLNSILLFGLFPIFS-FFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIIS 191
           +     P++    ++   L+P F+   +  G  GL +VET  WGGLLVTL+I+  GII S
Sbjct: 113 LAYEKTPKRGWIWLVFVNLYPFFAALLLYGGVFGLEVVETHKWGGLLVTLIIALVGIIAS 172

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +P+G+ LALGR S++P++R  C  +IE++RGVPL+TVLFMAS+MLPLFL    ++DKLLR
Sbjct: 173 LPIGVALALGRRSDMPIIRSLCTVYIEVWRGVPLITVLFMASVMLPLFLSQGSEIDKLLR 232

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
           AL+GV  F++AY+AEV+RGGLQ+I KGQ+EAA++LGLSY +KM LII+PQ +K  IP IV
Sbjct: 233 ALIGVVMFSAAYMAEVIRGGLQAIPKGQYEAADALGLSYWKKMGLIILPQALKITIPSIV 292

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISL 371
           NTFIGLFKD+SL+ II MFD+LGI +   ++  W+     T   +F+  VFWIFCF +S 
Sbjct: 293 NTFIGLFKDTSLVLIIGMFDVLGIGQSANTDPNWLG--FATESYVFVALVFWIFCFGMSR 350

Query: 372 YSVFIEKTLHKGSKK 386
           YS+++E  LH G K+
Sbjct: 351 YSIWLEGKLHTGHKR 365


>gi|254286188|ref|ZP_04961148.1| amino acid ABC transporter, permease protein [Vibrio cholerae
           AM-19226]
 gi|262192391|ref|ZP_06050544.1| ABC-type amino acid transport system permease component [Vibrio
           cholerae CT 5369-93]
 gi|150423857|gb|EDN15798.1| amino acid ABC transporter, permease protein [Vibrio cholerae
           AM-19226]
 gi|262031744|gb|EEY50329.1| ABC-type amino acid transport system permease component [Vibrio
           cholerae CT 5369-93]
          Length = 365

 Score =  273 bits (697), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 170/375 (45%), Positives = 242/375 (64%), Gaps = 14/375 (3%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
            +      PP    G++ W+ KN F    + + T ++  L +  +  I+ W   +A W G
Sbjct: 4   HQFQPSLPPPSNTTGVVGWLRKNLFNGVFNSIATLVLGYLAIQGLLNILDWAIFNANWSG 63

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
           + R  CT              ACW FI  R+EQF++G YP A+ WRP L F T ++ +  
Sbjct: 64  TTRNDCTLE-----------GACWVFISVRWEQFMYGFYPTAELWRPRLFFFTLALFVAL 112

Query: 133 MLIPSFPRKFLNSILLFGLFPIFS-FFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIIS 191
           +     P++    ++   ++P F+   +  G  GL +VET  WGGLLVTL+I+  GII S
Sbjct: 113 LAYEKTPKRGWIWLVFVNIYPFFAALLLYGGVFGLEVVETHKWGGLLVTLIIALVGIIAS 172

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +P+G+ LALGR S++P++R  C  +IE++RGVPL+TVLFMAS+MLPLFL    ++DKLLR
Sbjct: 173 LPIGVALALGRRSDMPIIRSLCTVYIEVWRGVPLITVLFMASVMLPLFLSQGSEIDKLLR 232

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
           AL+GV  F++AY+AEV+RGGLQ+I KGQ+EAA++LGLSY +KM LII+PQ +K  IP IV
Sbjct: 233 ALIGVVMFSAAYMAEVIRGGLQAIPKGQYEAADALGLSYWKKMGLIILPQALKITIPSIV 292

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISL 371
           NTFIGLFKD+SL+ II MFD+LGI +   ++  W+     T   +F+  VFWIFCF +S 
Sbjct: 293 NTFIGLFKDTSLVLIIGMFDVLGIGQSANTDPNWLG--FATESYVFVALVFWIFCFGMSR 350

Query: 372 YSVFIEKTLHKGSKK 386
           YS+++E  LH G K+
Sbjct: 351 YSIWLEGKLHTGHKR 365


>gi|83648450|ref|YP_436885.1| amino acid ABC transporter permease [Hahella chejuensis KCTC 2396]
 gi|83636493|gb|ABC32460.1| ABC-type amino acid transport system, permease component [Hahella
           chejuensis KCTC 2396]
          Length = 365

 Score =  273 bits (697), Expect = 5e-71,   Method: Composition-based stats.
 Identities = 164/372 (44%), Positives = 236/372 (63%), Gaps = 14/372 (3%)

Query: 15  LLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSN 74
            L    PP    G++ W+  N F +P + +LT +   L+   I   + W  ++A  IG++
Sbjct: 7   PLPDLPPPSNTVGVVGWLRTNLFSSPVNSVLTIIAFYLIYSGISWFVSWGVINADVIGTS 66

Query: 75  RTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPML 134
           R  CT+             ACW FI  R  QFI+G YP  + WR  L+F    I +  ++
Sbjct: 67  REDCTS-----------GGACWVFISVRLPQFIYGFYPPDEVWRINLMFAIAIIGIVALM 115

Query: 135 IPSFPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMP 193
           I   P+K   ++ +  +FPI   F +  G  GL +VET  WGGL +TLVI+  GI++S+P
Sbjct: 116 IDKTPKKGWIALFMLVIFPIIAYFLLYGGAFGLEVVETHKWGGLTLTLVIATVGIVVSLP 175

Query: 194 LGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRAL 253
           +G+ LALGR S +P+++   + +IE +RGVPL+TVLFMAS+MLPLF+ +  + DKL+RA+
Sbjct: 176 IGVALALGRRSEMPIVKSISVVYIEFWRGVPLITVLFMASVMLPLFMSEGTETDKLVRAM 235

Query: 254 LGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNT 313
           +GV  F SAY+AEV+RGGLQ+I KGQ+EAA+SLGLSY + M  II+PQ +K +IPGIVNT
Sbjct: 236 IGVIMFQSAYMAEVVRGGLQAIPKGQYEAAHSLGLSYWKMMFFIILPQALKLMIPGIVNT 295

Query: 314 FIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYS 373
           FI LFKD+SL+ II +FDLL IV+    +  W+       G IF+ F+FW+FCF +S YS
Sbjct: 296 FIALFKDTSLVLIIGLFDLLAIVQSALHDPKWLG--FSVEGYIFVAFLFWVFCFGMSRYS 353

Query: 374 VFIEKTLHKGSK 385
             +E+ L+   +
Sbjct: 354 QALERKLNTSHR 365


>gi|261252932|ref|ZP_05945505.1| amino acid ABC transporter permease protein [Vibrio orientalis CIP
           102891]
 gi|260936323|gb|EEX92312.1| amino acid ABC transporter permease protein [Vibrio orientalis CIP
           102891]
          Length = 365

 Score =  272 bits (694), Expect = 9e-71,   Method: Composition-based stats.
 Identities = 164/375 (43%), Positives = 241/375 (64%), Gaps = 14/375 (3%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
            +      PP    G++ W+ KN F  P + ++T ++  +    +     W FL+A W+G
Sbjct: 4   HQFQPDLPPPANTVGVVGWLRKNLFNGPVNSVVTIILGYIAFMLLWNTFDWAFLNADWVG 63

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
           + R  C+              ACW FI  R+EQF++G YP A+ WRP L ++T +I    
Sbjct: 64  TTRDACS-----------REGACWVFISVRWEQFMYGFYPEAELWRPRLFYITLAIFTVL 112

Query: 133 MLIPSFPRKFLNSILLFGLFPIFSF-FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIIS 191
           +     P++    +    ++P      +  G  GL +V+T  WGGLLVTL+I+  GI++S
Sbjct: 113 LAYEKTPKRLWIWLFFVNIYPFIIAALLYGGVFGLEVVDTHKWGGLLVTLIIALVGIVVS 172

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +P+G+ LALGR S +P++R  C  +IE++RGVPL+TVLFMAS+MLPLFL +  + DKL+R
Sbjct: 173 LPIGVALALGRRSEMPIIRSMCTVYIEVWRGVPLITVLFMASVMLPLFLAEGSETDKLIR 232

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
           AL+GV  F++AY+AEV+RGGLQ+I KGQ+EAA++LGL+Y +KM LII+PQ +K  IP IV
Sbjct: 233 ALVGVVMFSAAYMAEVVRGGLQAIPKGQYEAADALGLTYWKKMGLIILPQALKITIPSIV 292

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISL 371
           NTFIGLFKD+SL+ II MFD+LGI +   ++  W+     T   +F+  VFW+FCF +S 
Sbjct: 293 NTFIGLFKDTSLVLIIGMFDVLGIGQAANTDPEWLG--FATESYVFVALVFWVFCFGMSR 350

Query: 372 YSVFIEKTLHKGSKK 386
           YS+++E  LH G K+
Sbjct: 351 YSIWLENKLHTGHKR 365


>gi|288958133|ref|YP_003448474.1| general L-amino acid transport system permease protein
           [Azospirillum sp. B510]
 gi|288910441|dbj|BAI71930.1| general L-amino acid transport system permease protein
           [Azospirillum sp. B510]
          Length = 368

 Score =  272 bits (694), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 157/376 (41%), Positives = 232/376 (61%), Gaps = 12/376 (3%)

Query: 11  VRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVW 70
           V+   L    PP    G IAW+  N F +  + +LT L+I LL  +IP  ++W+ + A  
Sbjct: 5   VQSVGLPDERPPANTVGPIAWLRNNLFNSWYNAILTILVIGLLGSAIPPFLNWLLIRAHG 64

Query: 71  IGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILL 130
             S   VC   +         + ACW FI ++    +FG +P  Q+WRP++       LL
Sbjct: 65  FESTSAVCRQDA---------SGACWGFISEKLRFIMFGMFPWEQQWRPLVTIGIFIALL 115

Query: 131 TPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIII 190
                  F + +   ++      + +  +  G LGL+ VE +LWGGL +T+++S  G+ +
Sbjct: 116 VASCDRRFWKPW-LGLVWAAGLALVAVLMWGGVLGLTYVENTLWGGLPLTIILSVIGLAV 174

Query: 191 SMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLL 250
           + PL ILLALGR SN+P ++  C+T+IEL RGVPL+++LFMAS+MLPLFLP+   +DKLL
Sbjct: 175 AFPLSILLALGRRSNMPAVKVLCVTYIELIRGVPLISLLFMASVMLPLFLPNGVSIDKLL 234

Query: 251 RALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGI 310
           RA +    FA+AY+AE +RGGLQ+I KGQ+EAA+ LGLSY QKMR I++PQ +   IP +
Sbjct: 235 RAQIAFILFAAAYMAEAIRGGLQAIPKGQYEAADGLGLSYWQKMRKIVLPQALAVAIPPL 294

Query: 311 VNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSIS 370
           VNTFI  FKD+SL+ II ++DLLG  +   S+ +W          +FIG ++WIFCFS+S
Sbjct: 295 VNTFISFFKDTSLVIIIGLYDLLGTAKAALSDPSWRGFYR--EAYLFIGVIYWIFCFSMS 352

Query: 371 LYSVFIEKTLHKGSKK 386
            YS  +E+ L++G ++
Sbjct: 353 KYSQKLERDLNRGHRR 368


>gi|323492612|ref|ZP_08097756.1| hypothetical protein VIBR0546_00040 [Vibrio brasiliensis LMG 20546]
 gi|323312987|gb|EGA66107.1| hypothetical protein VIBR0546_00040 [Vibrio brasiliensis LMG 20546]
          Length = 365

 Score =  271 bits (693), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 167/375 (44%), Positives = 245/375 (65%), Gaps = 14/375 (3%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
            +      PP    G++ W+ KN F  P + ++T ++  L    +  +++W FL+A W+G
Sbjct: 4   HQFQPDLPPPANTVGLVGWLRKNLFNGPVNSVVTVILTVLSAMLLWEVVNWAFLNADWVG 63

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
           + R  C+              ACW FI  R++QF++G YP A+ WRP L ++T +I    
Sbjct: 64  TTRDACS-----------REGACWVFIAVRWDQFMYGFYPEAELWRPQLFYVTLAIFTVL 112

Query: 133 MLIPSFPRKFLNSILLFGLFPIFSF-FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIIS 191
           +     P++    +    ++P F    +  G  GL +VET  WGGLLVTL+I+  GI++S
Sbjct: 113 LAYEKTPKRLWIWLFFVNVYPFFIAALLYGGVFGLEVVETHKWGGLLVTLIIALVGIVVS 172

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +P+G+ LALGR S +P++R  C  +IE++RGVPL+TVLFMAS+MLPLFL +  + DKL+R
Sbjct: 173 LPIGVALALGRRSEMPIIRSICTVYIEVWRGVPLITVLFMASVMLPLFLSEGSETDKLIR 232

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
           AL+GV  F++AY+AEV+RGGLQ+I KGQ+EAA++LGLSY +KM LII+PQ +K  IP IV
Sbjct: 233 ALIGVVMFSAAYMAEVVRGGLQAIPKGQYEAADALGLSYWKKMGLIILPQALKITIPSIV 292

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISL 371
           NTFIGLFKD+SL+ II MFD+LGI +   ++  W+     T   +F+  VFW+FCF +S 
Sbjct: 293 NTFIGLFKDTSLVLIIGMFDVLGIGQAANTDPEWLG--FATESYVFVALVFWVFCFGMSR 350

Query: 372 YSVFIEKTLHKGSKK 386
           YS+++E  LH G K+
Sbjct: 351 YSIWLENKLHTGHKR 365


>gi|330446207|ref|ZP_08309859.1| amino ABC transporter, permease, 3-TM region, His/Glu/Gln/Arg/opine
           family domain protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328490398|dbj|GAA04356.1| amino ABC transporter, permease, 3-TM region, His/Glu/Gln/Arg/opine
           family domain protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 365

 Score =  270 bits (691), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 167/376 (44%), Positives = 243/376 (64%), Gaps = 14/376 (3%)

Query: 12  RKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWI 71
           +   L    PP    G+I W+  N F +  + + T L+    +  I  II W F++A W 
Sbjct: 3   KHEFLPDLPPPANTVGMIGWLRTNLFSSITNSIATLLLGYFAVLGIWYIIDWAFINADWS 62

Query: 72  GSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLT 131
           G +R  CT+           + ACW FI  R++QF++G YP  + WRP L + T +I + 
Sbjct: 63  GDSRDACTS-----------SGACWTFINVRFDQFMYGFYPTEELWRPQLFYATLAIFIG 111

Query: 132 PMLIPSFPRKFLNSILLFGLFPIFS-FFVLYGGLGLSIVETSLWGGLLVTLVISFFGIII 190
            +     P +    +    ++P  + F +  G   L +VET LWGGLL+TL+I+  GI++
Sbjct: 112 LLAYEKTPYRGWIWLFFVNIYPFIAGFLLYGGVFDLPVVETHLWGGLLITLIIAIVGIVV 171

Query: 191 SMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLL 250
           S+P+G++LALGR S +P++R  C  +IEL+RGVPL+TVLFMAS+MLPLFL    + +KL+
Sbjct: 172 SLPIGVVLALGRRSEMPIIRSICTVYIELWRGVPLITVLFMASVMLPLFLSSEMETNKLI 231

Query: 251 RALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGI 310
           RAL+GV  F++AY+AEV+RGGLQ+I KGQ+EAA++LGL+Y +KM LI++PQ +K  IP I
Sbjct: 232 RALMGVVMFSAAYMAEVIRGGLQAIPKGQYEAADALGLTYWKKMYLIVLPQALKITIPSI 291

Query: 311 VNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSIS 370
           VNTFIGLFKD+SL+ II MFD+LGI +   ++  W+     T   +F+  VFWIFCF +S
Sbjct: 292 VNTFIGLFKDTSLVLIIGMFDVLGIGQAATTDPEWLG--FATESYVFVALVFWIFCFGMS 349

Query: 371 LYSVFIEKTLHKGSKK 386
            YS+++E  LH G K+
Sbjct: 350 RYSIYLENKLHTGHKR 365


>gi|197335791|ref|YP_002156347.1| general L-amino acid transport system permease protein AapM [Vibrio
           fischeri MJ11]
 gi|197317281|gb|ACH66728.1| general L-amino acid transport system permease protein AapM [Vibrio
           fischeri MJ11]
          Length = 365

 Score =  270 bits (690), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 170/375 (45%), Positives = 248/375 (66%), Gaps = 14/375 (3%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
            +      PP    G + W+ K+ F  P + +LT +I  L +  +  ++ W  ++A WIG
Sbjct: 4   HQFQPDLPPPANTVGAVTWLKKHLFNGPINSILTLIIAYLAIVGLWNVVSWGLINADWIG 63

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
           + R  C++             ACW  I  R++QF++G YP  + WRP L +   +I +  
Sbjct: 64  TTRDACSSE-----------GACWVMINVRWDQFMYGFYPSEELWRPQLFYGLLAIFVAL 112

Query: 133 MLIPSFPRKFLNSILLFGLFPIFS-FFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIIS 191
           +     P+KF   ++   +FPIF+ F +  G  GL +V+T LWGGLL+TLVI+  GI++S
Sbjct: 113 LAYEHTPKKFAIWLVFVNIFPIFAAFLLYGGVFGLPVVDTHLWGGLLITLVIAIVGIVVS 172

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +P+G+ LALGR S +P++R  C  +IE++RGVPL+TVLFMAS+MLPLFL +  ++DKL R
Sbjct: 173 LPIGVALALGRRSEMPIIRSMCTVYIEIWRGVPLITVLFMASVMLPLFLSEGMELDKLFR 232

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
           AL+GV  F++AY+AEV+RGGLQ+I KGQ+EAA++LGL Y +KMRLII+PQ +K  IP IV
Sbjct: 233 ALIGVVLFSAAYMAEVVRGGLQAIPKGQYEAADALGLGYWKKMRLIILPQALKITIPSIV 292

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISL 371
           NTFIGLFKD+SL+ II MFD+LGI +   ++  W+     T   +F+  VFW+FCFS+S 
Sbjct: 293 NTFIGLFKDTSLVLIIGMFDVLGIGQAANTDPEWLG--FSTESYVFVALVFWVFCFSMSR 350

Query: 372 YSVFIEKTLHKGSKK 386
           YS+++E  LH G K+
Sbjct: 351 YSIYLENKLHTGHKR 365


>gi|28898396|ref|NP_798001.1| amino acid ABC transporter permease [Vibrio parahaemolyticus RIMD
           2210633]
 gi|28806613|dbj|BAC59885.1| amino acid ABC transporter, permease protein [Vibrio
           parahaemolyticus RIMD 2210633]
          Length = 368

 Score =  270 bits (689), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 167/378 (44%), Positives = 245/378 (64%), Gaps = 17/378 (4%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
            +      PP    G++ W+ KN F  P + ++T ++  ++  ++  I+ W F++A WIG
Sbjct: 4   HQFQPDLPPPSNTVGVVGWLRKNLFNGPVNSIVTLILAYIVFNALWHIVDWAFINADWIG 63

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
           S R  C+              ACW FI  R+EQF++G YP A+ WRP L ++T +I    
Sbjct: 64  STRDDCS-----------REGACWVFISVRWEQFMYGFYPEAELWRPRLFYITLAIFTVL 112

Query: 133 MLIPSFPRKFLNSILLFGLFPIFSF-FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIIS 191
           +     P++    +    ++P      +  G  GL +VET  WGGLLVTL+I+  GI++S
Sbjct: 113 LAYEKTPKRLWIWLFFVNIYPFIVAALLYGGVFGLEVVETHKWGGLLVTLIIALVGIVVS 172

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +P+G+ LALGR S++P++R  C  +IE++RGVPL+TVLFMAS+MLPLFL +  + DKL+R
Sbjct: 173 LPIGVALALGRRSDMPIIRSICTIYIEVWRGVPLITVLFMASVMLPLFLAEGSETDKLIR 232

Query: 252 AL---LGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIP 308
           AL   +GV  F++AY+AEV+RGGLQ+I KGQ+EAA++LGLSY +K  LII+PQ +K  IP
Sbjct: 233 ALRALIGVVMFSAAYMAEVVRGGLQAIPKGQYEAADALGLSYWKKTGLIILPQALKITIP 292

Query: 309 GIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFS 368
            IVNTFIGLFKD+SL+ II MFD+LGI +   ++  W+     T   +F+  VFW+FCF 
Sbjct: 293 SIVNTFIGLFKDTSLVLIIGMFDVLGIGQAANTDPEWLG--FATESYVFVALVFWVFCFG 350

Query: 369 ISLYSVFIEKTLHKGSKK 386
           +S YS+++E  LH G K+
Sbjct: 351 MSRYSIWLENKLHTGHKR 368


>gi|59712141|ref|YP_204917.1| amino-acid transporter permease [Vibrio fischeri ES114]
 gi|59480242|gb|AAW86029.1| predicted amino-acid transporter permease [Vibrio fischeri ES114]
          Length = 365

 Score =  269 bits (688), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 170/375 (45%), Positives = 247/375 (65%), Gaps = 14/375 (3%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
            +      PP    G + W+ K+ F  P + +LT +I  L +  +  +I W  ++A WIG
Sbjct: 4   HQFQPDLPPPANTVGAVTWLKKHLFNGPINSILTLIIAYLAIIGLWNVISWGLINADWIG 63

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
           + R  C++             ACW  I  R++QF++G YP  + WRP L +   +I +  
Sbjct: 64  TTRDACSSE-----------GACWVMISVRWDQFMYGFYPSDELWRPQLFYGLLAIFVAL 112

Query: 133 MLIPSFPRKFLNSILLFGLFPIFS-FFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIIS 191
           +     P+KF   ++   +FPIF+ F +  G   L +V+T LWGGLL+TLVI+  GI++S
Sbjct: 113 LAYEHTPKKFAIWLIFVNIFPIFAAFLLYGGVFDLPVVDTHLWGGLLITLVIAIVGIVVS 172

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +P+G+ LALGR S +P++R  C  +IE++RGVPL+TVLFMAS+MLPLFL +  ++DKL R
Sbjct: 173 LPIGVALALGRRSEMPIIRSMCTVYIEIWRGVPLITVLFMASVMLPLFLSEGMELDKLFR 232

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
           AL+GV  F++AY+AEV+RGGLQ+I KGQ+EAA++LGL Y +KMRLII+PQ +K  IP IV
Sbjct: 233 ALIGVVLFSAAYMAEVVRGGLQAIPKGQYEAADALGLGYWKKMRLIILPQALKITIPSIV 292

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISL 371
           NTFIGLFKD+SL+ II MFD+LGI +   ++  W+     T   +F+  VFW+FCFS+S 
Sbjct: 293 NTFIGLFKDTSLVLIIGMFDVLGIGQAANTDPEWLG--FSTESYVFVALVFWVFCFSMSR 350

Query: 372 YSVFIEKTLHKGSKK 386
           YS+++E  LH G K+
Sbjct: 351 YSIYLENKLHTGHKR 365


>gi|148980392|ref|ZP_01816035.1| ABC-type amino acid transport system, permease component
           [Vibrionales bacterium SWAT-3]
 gi|145961264|gb|EDK26576.1| ABC-type amino acid transport system, permease component
           [Vibrionales bacterium SWAT-3]
          Length = 366

 Score =  269 bits (687), Expect = 7e-70,   Method: Composition-based stats.
 Identities = 164/376 (43%), Positives = 240/376 (63%), Gaps = 15/376 (3%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLF-SIPGIIHWVFLDAVWI 71
            +      PP    G++ W+ KN F  P + ++T ++  +     +     W FL+A W+
Sbjct: 4   HQFQPDLPPPANTVGVVGWLRKNLFNGPINSIVTVVLGYIAFSSLLWTTFDWAFLNADWV 63

Query: 72  GSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLT 131
           G+ R  CT+             ACW FI  R++QF++G YP A+ WRP L + T +I + 
Sbjct: 64  GTTRDACTSE-----------GACWVFISVRWDQFMYGFYPEAELWRPRLFYATLAIFVA 112

Query: 132 PMLIPSFPRKFLNSILLFGLFPIFSF-FVLYGGLGLSIVETSLWGGLLVTLVISFFGIII 190
            +     P++    +    ++P      +  G  GL +V+T  WGGLLVTL+I+  GI++
Sbjct: 113 LLAYEKTPKRTWIWLFFVNIYPFIIAGLLYGGVFGLEVVDTHKWGGLLVTLIIALVGIVV 172

Query: 191 SMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLL 250
           S+P+G+ LALGR S +P++R  C  +IE++RGVPL+TVLFMAS+MLPLFL    + DKL 
Sbjct: 173 SLPIGVALALGRRSEMPIIRSICTVYIEIWRGVPLITVLFMASVMLPLFLTAGSETDKLF 232

Query: 251 RALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGI 310
           RAL+GV  F++AY+AEV+RGGLQ+I KGQ+EAA++LGL+Y +KM LII+PQ +K  IP I
Sbjct: 233 RALVGVVLFSAAYMAEVIRGGLQAIPKGQYEAADALGLTYWKKMGLIILPQALKITIPSI 292

Query: 311 VNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSIS 370
           VNTFIGLFKD+SL+ II MFD+LGI +   ++  W+     T   +F+  VFW+FCF +S
Sbjct: 293 VNTFIGLFKDTSLVLIIGMFDVLGIGQAANTDPEWLG--FATESYVFVALVFWVFCFGMS 350

Query: 371 LYSVFIEKTLHKGSKK 386
            YS+++E  LH G K+
Sbjct: 351 RYSIWLENRLHTGHKR 366


>gi|209695502|ref|YP_002263431.1| general L-amino acid ABC transporter permease protein [Aliivibrio
           salmonicida LFI1238]
 gi|208009454|emb|CAQ79740.1| general L-amino acid ABC transporter permease protein [Aliivibrio
           salmonicida LFI1238]
          Length = 365

 Score =  268 bits (686), Expect = 7e-70,   Method: Composition-based stats.
 Identities = 168/375 (44%), Positives = 245/375 (65%), Gaps = 14/375 (3%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
            +      PP    G + W+ ++ F  P + +LT +I  L    +   + W  ++A WIG
Sbjct: 4   HQFQPDLPPPPNTVGAVTWLKRHLFNGPINSILTLIIGYLAFSGLWNAVSWALINADWIG 63

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
           + R  C++             ACW  I  R++QF++G YP A+ WRP L +   +I +  
Sbjct: 64  TTRDACSS-----------GGACWVMINVRWDQFMYGFYPTAELWRPQLFYALLAIFVAL 112

Query: 133 MLIPSFPRKFLNSILLFGLFPIFS-FFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIIS 191
           +     P+K    ++   +FP F+ F +  G  GL +V+T LWGGLL+TLVI+  GI++S
Sbjct: 113 LAYEHTPKKVAIWLVFVNIFPFFAAFLLYGGVFGLPVVDTHLWGGLLITLVIAIVGIVVS 172

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +P+G+ LALGR S +P++R  C  +IE++RGVPL+TVLFMAS+MLPLFL +  ++DKL R
Sbjct: 173 LPIGVALALGRRSEMPIIRSMCTIYIEIWRGVPLITVLFMASVMLPLFLSEGMELDKLFR 232

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
           AL+GV  F++AY+AEV+RGGLQ+I KGQ+EAA++LGL Y +KMRLII+PQ +K  IP IV
Sbjct: 233 ALIGVVLFSAAYMAEVIRGGLQAIPKGQYEAADALGLGYWKKMRLIILPQALKITIPSIV 292

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISL 371
           NTFIGLFKD+SL+ II MFD+LGI +   ++  W+     T   +F+  VFW+FCFS+S 
Sbjct: 293 NTFIGLFKDTSLVLIIGMFDVLGIGQAANTDPEWLG--FSTESYVFVALVFWVFCFSMSR 350

Query: 372 YSVFIEKTLHKGSKK 386
           YS+++E  LH G K+
Sbjct: 351 YSIYLENKLHTGHKR 365


>gi|328543626|ref|YP_004303735.1| ABC transporter, permease protein [Polymorphum gilvum SL003B-26A1]
 gi|326413370|gb|ADZ70433.1| ABC transporter, permease protein [Polymorphum gilvum SL003B-26A1]
          Length = 385

 Score =  268 bits (686), Expect = 8e-70,   Method: Composition-based stats.
 Identities = 190/381 (49%), Positives = 257/381 (67%), Gaps = 11/381 (2%)

Query: 11  VRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVW 70
           +RK        PV   G++ W+  N F +  + LLT + + L  + I   I + F+DAVW
Sbjct: 11  IRKEEAPLLPAPVSTTGVVGWMRANLFSSWSNTLLTLVGLLLAYWLIAPFIRFAFIDAVW 70

Query: 71  IGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILL 130
            G NR  C        Q  G   ACWA++   + QFI+G YP+A+ WR  +VF   + LL
Sbjct: 71  TGDNRAAC------APQDGGHVGACWAYVKAYFPQFIYGRYPVAEVWRVNVVFALFAALL 124

Query: 131 TPMLIPSFPRKFLNSILLFGLFPIFSF-----FVLYGGLGLSIVETSLWGGLLVTLVISF 185
            P+ IPS P K  N++L    FP+ ++      ++ G + L IVETS+WGGLLVTLVI+ 
Sbjct: 125 IPLAIPSVPFKRTNAVLFLVAFPVVAYFLLTGLIVNGRVILPIVETSVWGGLLVTLVIAV 184

Query: 186 FGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWD 245
            GI+ S+PLG+LLALGR S +PV+R   + FIE +RGVPL+TVLFM+S+MLPLFLP+   
Sbjct: 185 TGIVASLPLGVLLALGRRSQMPVVRLVSVIFIEFWRGVPLITVLFMSSVMLPLFLPEGVT 244

Query: 246 VDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKR 305
            +KLLR L+GV+ F++AY+AEV+RGGLQ+I KGQ+E A +LGL Y Q M LII+PQ +K 
Sbjct: 245 FNKLLRVLIGVTLFSAAYMAEVVRGGLQAIPKGQYEGAMALGLRYWQMMGLIILPQALKL 304

Query: 306 VIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIF 365
           VIPGIVNTFIGLFKD++L+ I+ MFDLLG ++ +FS+ TW S     TG +F G VFWIF
Sbjct: 305 VIPGIVNTFIGLFKDTTLVLIVGMFDLLGQIQSSFSDPTWSSPTQGHTGYLFAGMVFWIF 364

Query: 366 CFSISLYSVFIEKTLHKGSKK 386
           CF +S YS+F+EK L+ G K+
Sbjct: 365 CFGMSRYSIFMEKRLNTGHKR 385


>gi|83595861|gb|ABC25223.1| general amino acid ABC transporter, permease protein [uncultured
           marine bacterium Ant4D3]
          Length = 369

 Score =  268 bits (685), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 161/370 (43%), Positives = 231/370 (62%), Gaps = 14/370 (3%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
               PP    G+I W+ +N F +  + ++T + I LL  ++P  I+W+F+DA ++G+ R 
Sbjct: 14  PSLPPPKNTVGVIYWLRENLFSSATNSIVTLVSIYLLYLALPSAINWLFIDATYVGTTRK 73

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            C             + AC AFI +R+  F++G YP   RWR  L  L   +    +L  
Sbjct: 74  DC-----------APDGACLAFIGERFNLFVYGFYPAELRWRVNLATLLLVVAGAAVLWD 122

Query: 137 SFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGI 196
             P +    +    ++P    ++L GG GL  V T L+GGL++TL I   GI+ S+PLGI
Sbjct: 123 KIPARKH-MLKFAMVYPFIGAWLLTGGFGLESVGTHLFGGLMLTLTIGVTGIVFSLPLGI 181

Query: 197 LLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGV 256
           LLALGR SN+P+++Y CI FIE  RGVPL+T+LF+AS ML  FLP     D L+R L+ V
Sbjct: 182 LLALGRQSNLPIIKYFCIGFIEFIRGVPLITLLFVASTMLSYFLPPGTTFDLLMRVLIMV 241

Query: 257 SAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIG 316
           + FASAY+AEV+RGGLQ++ KGQ EAA SLGL+Y Q MR II+PQ +K  IPGIVNTFIG
Sbjct: 242 TLFASAYMAEVIRGGLQALPKGQLEAAESLGLNYGQAMRFIILPQALKISIPGIVNTFIG 301

Query: 317 LFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFI 376
           L+KDS+L+ +I + D LGI R + ++S W+     T   +F+   F+I CF ++ YS+++
Sbjct: 302 LYKDSTLVIVIGLLDPLGIGRASVADSDWLGL--STEVYLFVAVFFFISCFGMARYSLYL 359

Query: 377 EKTLHKGSKK 386
           E  L+ G K+
Sbjct: 360 ENKLNTGHKR 369


>gi|90578889|ref|ZP_01234699.1| putative ABC-type amino acid transport system, permease component
           [Vibrio angustum S14]
 gi|90439722|gb|EAS64903.1| putative ABC-type amino acid transport system, permease component
           [Vibrio angustum S14]
          Length = 365

 Score =  268 bits (684), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 169/376 (44%), Positives = 244/376 (64%), Gaps = 14/376 (3%)

Query: 12  RKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWI 71
           +   L    PP    GII W+  N F +  + + T L+    +  I   I W F++A W 
Sbjct: 3   KHEFLPDLPPPANTVGIIGWLRTNLFSSITNSIATLLLGYFAVLGIWYTIDWAFINADWS 62

Query: 72  GSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLT 131
           G +R  CT+           + ACW FI  R++QF++G YP  + WRP L + T +I + 
Sbjct: 63  GVSRDACTS-----------SGACWTFINVRFDQFMYGFYPTEELWRPQLFYATLAIFIG 111

Query: 132 PMLIPSFPRKFLNSILLFGLFPIFS-FFVLYGGLGLSIVETSLWGGLLVTLVISFFGIII 190
            +     P +    +    ++P  + F +  G  GL+IVET LWGGLL+TL+I+  GI++
Sbjct: 112 LLAYEKTPYRGWIWLFFVNIYPFIAGFLLYGGVFGLTIVETHLWGGLLITLIIAIVGIVV 171

Query: 191 SMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLL 250
           S+P+G++LALGR S +P++R  C  +IEL+RGVPL+TVLFMAS+MLPLFL    + +KL+
Sbjct: 172 SLPIGVVLALGRRSEMPIIRSICTVYIELWRGVPLITVLFMASVMLPLFLSSEMETNKLI 231

Query: 251 RALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGI 310
           RAL+GV  F++AY+AEV+RGGLQ+I KGQ+EAA++LGL+Y +KM LI++PQ +K  IP I
Sbjct: 232 RALMGVVMFSAAYMAEVIRGGLQAIPKGQYEAADALGLTYWKKMYLIVLPQALKITIPSI 291

Query: 311 VNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSIS 370
           VNTFIGLFKD+SL+ II MFD+LGI +   ++  W+     T   +F+  VFWIFCF +S
Sbjct: 292 VNTFIGLFKDTSLVLIIGMFDVLGIGQAATTDPEWLG--FATESYVFVALVFWIFCFGMS 349

Query: 371 LYSVFIEKTLHKGSKK 386
            YS+++E  LH G K+
Sbjct: 350 RYSIYLENKLHTGHKR 365


>gi|315122675|ref|YP_004063164.1| general L-amino acid transport system permease protein [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313496077|gb|ADR52676.1| general L-amino acid transport system permease protein [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 386

 Score =  267 bits (683), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 317/386 (82%), Positives = 346/386 (89%)

Query: 1   MIDSCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGI 60
           MI   KEFPYVRK+LL P LPPV+QRGIIAWIH +FF T KD +LT LII  LL  IP I
Sbjct: 1   MIHPLKEFPYVRKQLLPPCLPPVHQRGIIAWIHTSFFYTIKDSILTLLIIASLLSLIPDI 60

Query: 61  IHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPI 120
            HW F+DAVW G++R VCTT+SQGGIQPDGWNAACWAF+YDRY QFIFGNYP  +RWRPI
Sbjct: 61  AHWFFIDAVWTGTDRRVCTTISQGGIQPDGWNAACWAFVYDRYPQFIFGNYPAEERWRPI 120

Query: 121 LVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVT 180
           LVF+ GSILL PML+PS PRKFLN +LLF LFPIFSFFVLYGG GL+IVETSLWGGLLVT
Sbjct: 121 LVFVLGSILLIPMLMPSLPRKFLNGVLLFFLFPIFSFFVLYGGFGLTIVETSLWGGLLVT 180

Query: 181 LVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFL 240
           LVIS FGII+SMPLGILLALGR+SNI VLR  CITF+ELFRGVPLVTVLFM S+MLPLFL
Sbjct: 181 LVISLFGIIVSMPLGILLALGRSSNILVLRVVCITFVELFRGVPLVTVLFMTSVMLPLFL 240

Query: 241 PDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMP 300
           PD WDVDKLLRALLGV+AFASAYIAEV RGGLQSISKGQFEAANSLGL+Y Q MR II+P
Sbjct: 241 PDAWDVDKLLRALLGVAAFASAYIAEVFRGGLQSISKGQFEAANSLGLNYFQTMRFIIIP 300

Query: 301 QVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGF 360
           Q IKRVIPGIVNTFIGLFKDS+LISIINMFD+LG+VR NFS+S+W+SSVTPTTGLIF+GF
Sbjct: 301 QTIKRVIPGIVNTFIGLFKDSTLISIINMFDILGVVRANFSDSSWVSSVTPTTGLIFVGF 360

Query: 361 VFWIFCFSISLYSVFIEKTLHKGSKK 386
           VFWIFCFSISLYSVFIE+TLHKGSKK
Sbjct: 361 VFWIFCFSISLYSVFIERTLHKGSKK 386


>gi|327190792|gb|EGE57860.1| general L-amino acid ABC transporter, permease protein [Rhizobium
           etli CNPAF512]
          Length = 359

 Score =  267 bits (682), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 232/359 (64%), Positives = 287/359 (79%)

Query: 28  IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQ 87
           ++AWI +N   TPKD++LT L +  + +++   + W+F+ AVW G +RT C T  QGGIQ
Sbjct: 1   MVAWIRRNLLATPKDMVLTTLAVVFIAWALLHAVDWLFVQAVWRGPDRTFCATAVQGGIQ 60

Query: 88  PDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSIL 147
           PDGW+ ACWAF+  +++QFI+G YP+ +RWRP LV +   +LL PMLIPS PRK +N++L
Sbjct: 61  PDGWSGACWAFVNAKFDQFIYGRYPLDERWRPTLVGILFVLLLVPMLIPSAPRKGVNALL 120

Query: 148 LFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIP 207
           LFG  PI SFF+LYGG GL IVET LWGGLLVTLV+SF GI +S PLGI+LALGR S +P
Sbjct: 121 LFGALPIVSFFLLYGGYGLEIVETPLWGGLLVTLVLSFVGIAVSFPLGIILALGRRSQMP 180

Query: 208 VLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEV 267
           V+R  CI FIE+ RGVPL+TVLFMAS+MLPLFLP  W VDKLLRA++GVS FASAY+AEV
Sbjct: 181 VIRTVCIVFIEVVRGVPLITVLFMASVMLPLFLPAGWTVDKLLRAIIGVSIFASAYMAEV 240

Query: 268 LRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISII 327
           +RGGLQ+I KGQFE A+SLGL Y QKMRLIIMPQ IK VIPGIVNTFIG+FKD+SL+SII
Sbjct: 241 IRGGLQAIPKGQFEGADSLGLGYWQKMRLIIMPQAIKLVIPGIVNTFIGMFKDTSLVSII 300

Query: 328 NMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
           +MFDLLGIVR+NF +  W ++VTP TGLIF GF FW+FCF +S YS F+E+ L  G K+
Sbjct: 301 SMFDLLGIVRLNFVDPNWATAVTPLTGLIFAGFSFWLFCFGMSRYSAFMERHLDTGHKR 359


>gi|54309365|ref|YP_130385.1| putative ABC-type amino acid transport system, permease component
           [Photobacterium profundum SS9]
 gi|46913801|emb|CAG20583.1| putative ABC-type amino acid transport system, permease component
           [Photobacterium profundum SS9]
          Length = 365

 Score =  267 bits (682), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 170/375 (45%), Positives = 245/375 (65%), Gaps = 14/375 (3%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
                   PP    GII W  ++ F +  + ++T  +    +  +  +I W F++A WIG
Sbjct: 4   HDFQPDLPPPANTVGIIGWSRQHLFSSITNSIVTLFLAYFAITGLWAVIQWAFINADWIG 63

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
             R  C+            + ACW FI  R++QF+FG YP  Q WRP L + T +I ++ 
Sbjct: 64  DTRDACS-----------RDGACWVFINVRFDQFMFGFYPADQLWRPKLFYFTLAIFISL 112

Query: 133 MLIPSFPRKFLNSILLFGLFPIFS-FFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIIS 191
           ++I   P +    +    ++P F+ F +  G  GL +V+T LWGGLLVTLVI+  GI++S
Sbjct: 113 LVIEKTPGRKWIWLFFVNVYPFFAGFLLYGGVFGLEVVDTHLWGGLLVTLVIAIVGIVVS 172

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +P+G+ LALGR S++P++R  C  +IE++RGVPL+TVLFMAS++LPLFL    ++DKL R
Sbjct: 173 LPIGVALALGRRSDMPIIRSICTIYIEIWRGVPLITVLFMASVLLPLFLTSEMEMDKLFR 232

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
           AL+GV  F++AY+AEV+RGGLQ+I +GQ+EAA++LGLSY + M LI++PQ +K  IP IV
Sbjct: 233 ALIGVVLFSAAYMAEVVRGGLQAIPRGQYEAADALGLSYWKSMYLIVLPQALKITIPSIV 292

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISL 371
           NTFIGLFKD+SL+ II MFD+LGI +   S+  W+     T   IF+  VFW+FCFS+S 
Sbjct: 293 NTFIGLFKDTSLVLIIGMFDVLGIGQAANSDPEWLG--FSTESYIFVALVFWVFCFSMSR 350

Query: 372 YSVFIEKTLHKGSKK 386
           YS+F+E  LH G K+
Sbjct: 351 YSIFLENKLHTGHKR 365


>gi|237799857|ref|ZP_04588318.1| amino acid ABC transporter permease [Pseudomonas syringae pv.
           oryzae str. 1_6]
 gi|331022712|gb|EGI02769.1| amino acid ABC transporter permease [Pseudomonas syringae pv.
           oryzae str. 1_6]
          Length = 365

 Score =  265 bits (677), Expect = 9e-69,   Method: Composition-based stats.
 Identities = 174/375 (46%), Positives = 241/375 (64%), Gaps = 14/375 (3%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
                   PP    G +AW+ +N F +  + LLT L + L+   +P I+ W  LDA W+G
Sbjct: 4   HTFKPDMPPPGKVFGPVAWMRQNLFSSWLNTLLTLLSLYLIYLIVPPILSWALLDANWVG 63

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
           + +  CT              ACW FI  R+ QF++G +P   RWR  L  +   +   P
Sbjct: 64  TTKEDCTKA-----------GACWVFIEQRFGQFMYGYFPNELRWRVDLTAILAIVGAAP 112

Query: 133 MLIPSFPRKFLNSILLFGLFPIFSF-FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIIS 191
           + I  F RK +  I    ++P+ +F  +  G  GL+ V TS WGGL++TLVI+  GI+ +
Sbjct: 113 LFISKFQRKAVYGICFLVIYPVVAFYLLHGGVFGLTNVPTSQWGGLMLTLVIATVGIVGA 172

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +PLGILLALGR SN+P +R  C+TFIE +RGVPL+TVLFM+S+MLPLF+P+  + DKLLR
Sbjct: 173 LPLGILLALGRRSNMPAVRVVCVTFIEFWRGVPLITVLFMSSVMLPLFMPEGMNFDKLLR 232

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
           AL+GV  F SAYIAEV+RGG+Q+I KGQ+EAA+++GL Y + M L+I+PQ +K VIPGIV
Sbjct: 233 ALIGVILFQSAYIAEVVRGGMQAIPKGQYEAASAMGLGYWRSMGLVILPQALKMVIPGIV 292

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISL 371
           NTFI LFKD+SL+ II +FDLL  V+   ++  W+     T G +F   VFWIFCF +S 
Sbjct: 293 NTFIALFKDTSLVIIIGLFDLLNSVKQATADPAWLG--MATEGYVFAALVFWIFCFGMSR 350

Query: 372 YSVFIEKTLHKGSKK 386
           YS+ +E+ L  G K+
Sbjct: 351 YSMHLERKLDTGHKR 365


>gi|90410650|ref|ZP_01218666.1| putative ABC-type amino acid transport system, permease component
           [Photobacterium profundum 3TCK]
 gi|90328891|gb|EAS45175.1| putative ABC-type amino acid transport system, permease component
           [Photobacterium profundum 3TCK]
          Length = 365

 Score =  265 bits (677), Expect = 9e-69,   Method: Composition-based stats.
 Identities = 169/375 (45%), Positives = 245/375 (65%), Gaps = 14/375 (3%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
                   PP    GII W  ++ F +  + ++T  +    +  +  +I W F++A W+G
Sbjct: 4   HNFQPDLPPPANTVGIIGWARQHLFSSITNSIMTIFLAYFAITGLWAVIQWAFINADWVG 63

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
             R  C++           + ACW FI  R++QF+FG YP  Q WRP L + T +I ++ 
Sbjct: 64  DTRDACSS-----------DGACWVFINVRFDQFMFGFYPADQLWRPKLFYFTLAIFISL 112

Query: 133 MLIPSFPRKFLNSILLFGLFPIFS-FFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIIS 191
           ++I   P +    +    ++P F+ F +  G  GL +V+T LWGGLLVTLVI+  GI++S
Sbjct: 113 LVIEKTPGRKWIWLFFVNVYPFFAAFLLYGGVFGLEVVDTHLWGGLLVTLVIAIVGIVVS 172

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +P+G+ LALGR S +P++R  C  +IE++RGVPL+TVLFMAS++LPLFL    ++DKL R
Sbjct: 173 LPIGVALALGRRSEMPIIRSICTVYIEIWRGVPLITVLFMASVLLPLFLTSEMEMDKLFR 232

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
           AL+GV  F++AY+AEV+RGGLQ+I +GQ+EAA++LGLSY + M LI++PQ +K  IP IV
Sbjct: 233 ALIGVVLFSAAYMAEVIRGGLQAIPRGQYEAADALGLSYWKSMYLIVLPQALKITIPSIV 292

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISL 371
           NTFIGLFKD+SL+ II MFD+LGI +   S+  W+     T   IF+  VFW+FCFS+S 
Sbjct: 293 NTFIGLFKDTSLVLIIGMFDVLGIGQAANSDPDWLG--FATESYIFVALVFWVFCFSMSR 350

Query: 372 YSVFIEKTLHKGSKK 386
           YS+F+E  LH G K+
Sbjct: 351 YSIFLENKLHTGHKR 365


>gi|260596108|ref|YP_003208679.1| Inner membrane amino-acid ABC transporter permease yhdY
           [Cronobacter turicensis z3032]
 gi|260215285|emb|CBA27215.1| Inner membrane amino-acid ABC transporter permease protein yhdY
           [Cronobacter turicensis z3032]
          Length = 365

 Score =  265 bits (676), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 163/373 (43%), Positives = 228/373 (61%), Gaps = 14/373 (3%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
              + P+      RG + W+ KN F +  + LLT   + ++   IP +++W F  A W+G
Sbjct: 3   TNAISPAPARPVNRGALVWMRKNLFSSWGNSLLTLFCLWMMWELIPPLLNWAFFQANWVG 62

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
           S R  CT              ACW FI+ R+ QF++G YP  +RWR  L  + G + + P
Sbjct: 63  STRADCTKE-----------GACWVFIHARFGQFMYGLYPHDERWRINLALIIGLLSIAP 111

Query: 133 MLIPSFPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIIS 191
           M   + PR+          +P+   + +  G LGL  VET  WGGL +TL+I+  GI  +
Sbjct: 112 MFWHALPRRGRYIACWAVAYPVVVWWLLYGGFLGLERVETRQWGGLTLTLIIASVGIAGA 171

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +PLGILLALGR S +PV+R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+R
Sbjct: 172 LPLGILLALGRRSGMPVVRVLSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIR 231

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
           AL+GV  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+V
Sbjct: 232 ALVGVILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLV 291

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISL 371
           NT I LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S 
Sbjct: 292 NTIIALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSR 349

Query: 372 YSVFIEKTLHKGS 384
           YS  +EK  H G 
Sbjct: 350 YSQHLEKRFHTGR 362


>gi|302188402|ref|ZP_07265075.1| amino acid ABC transporter permease [Pseudomonas syringae pv.
           syringae 642]
          Length = 365

 Score =  265 bits (676), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 177/375 (47%), Positives = 242/375 (64%), Gaps = 14/375 (3%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
                   PP    G +AW+ +N F +  + LLT L + L+   +P II W  LDA WIG
Sbjct: 4   HTFKPDMPPPGKVFGPMAWMRQNLFSSWINTLLTLLSLYLIYLVVPPIISWALLDANWIG 63

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
           + +  CT              ACW FI  R+ QF++G +P   RWR  L  +   +   P
Sbjct: 64  TTKADCTKA-----------GACWVFIEQRFGQFMYGYFPNELRWRVDLTAILAIVGAAP 112

Query: 133 MLIPSFPRKFLNSILLFGLFPIFSF-FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIIS 191
           + I  FPRK +  I    ++P+ +F  +  G  GL+ V TS WGGL++TLVI+  GI+ +
Sbjct: 113 LFISKFPRKAVYGIAFLVIYPVVAFYLLHGGAFGLTNVPTSQWGGLMLTLVIATVGIVGA 172

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +PLGILLALGR SN+P +R  C+TFIE +RGVPL+TVLFM+S+MLPLF+P+  + DKLLR
Sbjct: 173 LPLGILLALGRRSNMPAVRVVCVTFIEFWRGVPLITVLFMSSVMLPLFMPEGMNFDKLLR 232

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
           AL+GV  F SAYIAEV+RGG+Q+I KGQ+EAA+++GL Y + M L+I+PQ +K VIPGIV
Sbjct: 233 ALIGVILFQSAYIAEVVRGGMQAIPKGQYEAASAMGLGYWRSMGLVILPQALKMVIPGIV 292

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISL 371
           NTFI LFKD+SL+ II +FDLL  V+   ++  W+     T G +F   VFWIFCF +S 
Sbjct: 293 NTFIALFKDTSLVIIIGLFDLLNSVKQATADPAWLG--MATEGYVFAALVFWIFCFGMSR 350

Query: 372 YSVFIEKTLHKGSKK 386
           YS+ +E+ L  G K+
Sbjct: 351 YSMHLERKLDTGHKR 365


>gi|89073070|ref|ZP_01159617.1| putative ABC-type amino acid transport system, permease component
           [Photobacterium sp. SKA34]
 gi|89051288|gb|EAR56744.1| putative ABC-type amino acid transport system, permease component
           [Photobacterium sp. SKA34]
          Length = 365

 Score =  263 bits (673), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 168/376 (44%), Positives = 244/376 (64%), Gaps = 14/376 (3%)

Query: 12  RKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWI 71
           + +      PP    G+I W+  N F +    + T ++    +  I  I+ W F++A W 
Sbjct: 3   KHQFQPDLPPPANTVGVIGWLRTNLFSSLTSSIATFILGYFAILGIWYIVEWAFINADWT 62

Query: 72  GSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLT 131
           G +R  CT+           ++ACW FI  R++QF+FG YP  + WRP L + T ++ + 
Sbjct: 63  GDSRDACTS-----------SSACWTFINVRFDQFMFGFYPTEELWRPKLFYATLALFIG 111

Query: 132 PMLIPSFPRKFLNSILLFGLFPIFS-FFVLYGGLGLSIVETSLWGGLLVTLVISFFGIII 190
            +     P +    +    ++P  + F +  G  GL IVET LWGGLL+TLVI+  GI++
Sbjct: 112 LLAYEKTPYRGWIWLFFVNIYPFLAGFLLYGGVFGLPIVETHLWGGLLITLVIAIVGIVV 171

Query: 191 SMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLL 250
           S+P+G++LALGR S +P++R  C  +IEL+RGVPL+TVLFMAS+MLPLFL    + +KL+
Sbjct: 172 SLPIGVVLALGRRSEMPIIRSICTVYIELWRGVPLITVLFMASVMLPLFLSAEMETNKLI 231

Query: 251 RALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGI 310
           RAL+GV  F++AY+AEV+RGGLQ+I KGQ+EAA++LGL+Y +KM LI++PQ +K  IP I
Sbjct: 232 RALIGVVMFSAAYMAEVIRGGLQAIPKGQYEAADALGLTYWKKMYLIVLPQALKITIPSI 291

Query: 311 VNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSIS 370
           VNTFIGLFKD+SL+ II MFD+LGI +   S+  W+     T   +F+  VFWIFCF +S
Sbjct: 292 VNTFIGLFKDTSLVLIIGMFDVLGIGQAATSDPEWLG--FATESYVFVALVFWIFCFGMS 349

Query: 371 LYSVFIEKTLHKGSKK 386
            YS+++E  LH G K+
Sbjct: 350 RYSIYLENKLHTGHKR 365


>gi|149376722|ref|ZP_01894480.1| Amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine [Marinobacter algicola DG893]
 gi|149358961|gb|EDM47427.1| Amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine [Marinobacter algicola DG893]
          Length = 361

 Score =  263 bits (673), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 164/366 (44%), Positives = 239/366 (65%), Gaps = 14/366 (3%)

Query: 21  PPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTT 80
            P  +   + W  +N F +  + +LT L+  L++ S+  +++WV LDA + GS+ + CT 
Sbjct: 8   APKKRIDPVRWARENLFSSWHNTILTLLVGYLIVTSVGPLLNWVLLDANFQGSDPSDCTG 67

Query: 81  VSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFP- 139
                        ACW FI  R   FI+G YP   +WR  ++F   ++   P  I  FP 
Sbjct: 68  A-----------GACWLFINQRLNFFIYGFYPEEFQWRVDIMFGLLALSFAPQFIERFPG 116

Query: 140 RKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLA 199
           RK+L    L GL  +  F +  G  GL  V++S WGGL++TL++++ GII S+P+G LLA
Sbjct: 117 RKWLGLFGLTGLPIVGYFLIPGGLFGLEEVQSSKWGGLMLTLILAYIGIIASLPIGTLLA 176

Query: 200 LGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAF 259
           LGR S +P++R  C+ FIE++R VPL+TVLFMAS+MLPLFLP+  + +KL RAL+G++ +
Sbjct: 177 LGRRSEMPIIRGLCVVFIEVWRAVPLITVLFMASVMLPLFLPEGMNFEKLARALIGITLW 236

Query: 260 ASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFK 319
            SAY+AEV+RGGLQ+I +GQ+EAA++LGL Y +KM LII+PQ +K VIPGIVNTFI LFK
Sbjct: 237 QSAYMAEVIRGGLQAIPRGQYEAASALGLGYWKKMGLIILPQALKLVIPGIVNTFISLFK 296

Query: 320 DSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKT 379
           D++L+ II +FD+LG V+   ++  W +      G +F+ F FW+FCF IS YS  +E+ 
Sbjct: 297 DTTLVLIIGLFDILGTVQSTVTDPAWQNV--AVEGYVFVAFCFWVFCFGISRYSQNLERK 354

Query: 380 LHKGSK 385
           L  G +
Sbjct: 355 LDTGHR 360


>gi|118589036|ref|ZP_01546443.1| amino acid ABC transporter, permease protein [Stappia aggregata IAM
           12614]
 gi|118438365|gb|EAV44999.1| amino acid ABC transporter, permease protein [Stappia aggregata IAM
           12614]
          Length = 367

 Score =  263 bits (673), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 180/372 (48%), Positives = 250/372 (67%), Gaps = 11/372 (2%)

Query: 20  LPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCT 79
             P+   G+I W+ +N F +  + +LT + I +    I  +I + F+DAVW G NR  C 
Sbjct: 2   PAPISTTGVIGWMRQNLFSSIGNTVLTVIGILIAYSLIAPLIQFAFIDAVWTGENREACL 61

Query: 80  TVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFP 139
                  Q  G + ACWA++   + QFI+G YP  + WR  +V+   + LL P+ IP+ P
Sbjct: 62  ------PQEGGHSGACWAYVEAYFPQFIYGRYPTEEVWRVNVVYFLFAALLIPLAIPNAP 115

Query: 140 RKFLNSILLFGLFPIFSF-----FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPL 194
            K +N+IL   +FPI ++      V    + L IVET++WGGLLVTLVI+  GI+ S+PL
Sbjct: 116 FKKINAILFLVVFPIVAYYLLTGLVFGDVVILPIVETAVWGGLLVTLVIAVTGIVASLPL 175

Query: 195 GILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALL 254
           GI LALGR S +P+++   I FIE +RGVPL+TVLFM+S++LPLFLPD    DKLLR L+
Sbjct: 176 GIALALGRRSKMPIIKLVSIIFIEFWRGVPLITVLFMSSVVLPLFLPDGVTFDKLLRVLI 235

Query: 255 GVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTF 314
           GV+ F++AY+AEV+RGGLQ+I KGQ+E A +LGL +   M LII+PQ +K VIPGIVNTF
Sbjct: 236 GVTLFSAAYMAEVVRGGLQAIPKGQYEGAMALGLRFWPMMYLIILPQALKLVIPGIVNTF 295

Query: 315 IGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSV 374
           IGLFKD++L+ I+ MFDLLG ++ +F++ TW +  T  TG +F   VFW FCF +S YS+
Sbjct: 296 IGLFKDTTLVLIVGMFDLLGQIQSSFTDPTWSTPSTGHTGYLFAAVVFWTFCFGMSRYSI 355

Query: 375 FIEKTLHKGSKK 386
           F+E  LH G K+
Sbjct: 356 FMENKLHTGHKR 367


>gi|319957436|ref|YP_004168699.1| amino acid ABC transporter membrane protein 2, paat family
           [Nitratifractor salsuginis DSM 16511]
 gi|319419840|gb|ADV46950.1| amino acid ABC transporter membrane protein 2, PAAT family
           [Nitratifractor salsuginis DSM 16511]
          Length = 362

 Score =  263 bits (672), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 161/370 (43%), Positives = 226/370 (61%), Gaps = 14/370 (3%)

Query: 15  LLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSN 74
             Q   PP+ +RG IAW+  N   +P +I  T L + +L ++IP  + W F+DA + G +
Sbjct: 6   PKQAKEPPLVERGPIAWVRHNLLSSPFNIAFTLLGLAILYWTIPPFVKWAFIDAHFAGHS 65

Query: 75  RTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPML 134
           +  C               ACW FI  + + F+FG YP  Q WRP  V  +   L+    
Sbjct: 66  KADCAG-----------GGACWVFIKVKLDMFLFGFYPHDQLWRPKTVLASAVALVAFAK 114

Query: 135 IPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPL 194
                 KF   + +          +  G  GL +VETS WGGLL+TLVI+  GI++S P+
Sbjct: 115 FVKGLHKFKLLL-IVLFPIYAYILLHGGYFGLPVVETSKWGGLLLTLVIASVGIVLSFPI 173

Query: 195 GILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALL 254
           GILLALGR S +P+++   + +IE  RGVPL+TVLFMAS++LPLF P+  + +KL RAL+
Sbjct: 174 GILLALGRQSKLPIIKSLSVFYIEFVRGVPLITVLFMASVVLPLFFPEGVNFNKLARALI 233

Query: 255 GVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTF 314
           G++ F +AY+AE +R G Q+I KGQ+EAA++LGL Y QKM L+I+PQ IK  IP +V TF
Sbjct: 234 GITLFEAAYVAENIRSGFQAIPKGQYEAADALGLGYWQKMALVILPQAIKVTIPNLVGTF 293

Query: 315 IGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSV 374
           I LFKD+SL+ II +FDLL +V V  ++  W+     T G +F+ FVFWIF FS+S+YS 
Sbjct: 294 ISLFKDTSLVMIIGLFDLLAMVNVTANDRDWLG--MDTEGYVFVAFVFWIFTFSMSMYSK 351

Query: 375 FIEKTLHKGS 384
            +EK L    
Sbjct: 352 RLEKKLDTNK 361


>gi|87121082|ref|ZP_01076973.1| amino acid ABC transporter, permease protein [Marinomonas sp.
           MED121]
 gi|86163574|gb|EAQ64848.1| amino acid ABC transporter, permease protein [Marinomonas sp.
           MED121]
          Length = 366

 Score =  262 bits (670), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 163/370 (44%), Positives = 235/370 (63%), Gaps = 13/370 (3%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
               PPV   G +AW+  N   +P +I LT     +L   IP ++ W  ++A + G ++ 
Sbjct: 9   PSLPPPVNSVGAVAWVRHNLLSSPLNIFLTLFSFYVLYLLIPPVVEWGLINATFEGESKA 68

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            CT              ACWAFI   +EQF++G YP  + WR  L  +   +L+    I 
Sbjct: 69  ACTA-----------GGACWAFIGVYFEQFMYGLYPADETWRIDLALILLVVLIAMFAIK 117

Query: 137 SFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGI 196
           +  + FL+  ++     I  F    G  GL IVETSLWGGL +T ++   GI+ S PLG+
Sbjct: 118 AVNKLFLSIGIIAVYPVIAYFLFAGGVFGLEIVETSLWGGLFLTTLLGVVGIVASFPLGV 177

Query: 197 LLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGV 256
           LLALGR S++P+ +  CI FIE  R VPL+T+LFMAS+M+PLFLPD  + +KL+R L+G+
Sbjct: 178 LLALGRQSSMPIAKSVCIVFIETIRAVPLITILFMASVMIPLFLPDGMNFNKLMRVLIGI 237

Query: 257 SAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIG 316
           + F++AY+AEV+RGGLQ+I KGQ+EAA+++GL+Y Q M L+I+PQ +K VIPGIVNTFIG
Sbjct: 238 TLFSAAYMAEVIRGGLQAIPKGQYEAADAMGLTYWQSMVLVILPQALKLVIPGIVNTFIG 297

Query: 317 LFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFI 376
           LFKD++L+ I+ MFDLLG ++    +S+W+ +     G  F GF++W  CF +S YS+ I
Sbjct: 298 LFKDTTLVYIVGMFDLLGRIQAATHDSSWLGTT--IEGYAFAGFIYWAACFGMSRYSMRI 355

Query: 377 EKTLHKGSKK 386
           E+ L  G K+
Sbjct: 356 ERKLETGHKR 365


>gi|126668365|ref|ZP_01739323.1| Amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine [Marinobacter sp. ELB17]
 gi|126627181|gb|EAZ97820.1| Amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine [Marinobacter sp. ELB17]
          Length = 361

 Score =  261 bits (668), Expect = 9e-68,   Method: Composition-based stats.
 Identities = 165/371 (44%), Positives = 242/371 (65%), Gaps = 14/371 (3%)

Query: 16  LQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNR 75
           L   LPP    G+I W+ KN F T  +I+LT +   L++ S   +++WV L+A + G + 
Sbjct: 3   LPSELPPRQDIGVIGWVRKNLFSTWYNIVLTLVAAYLVITSAGPLLNWVILEATFTGESA 62

Query: 76  TVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLI 135
           + C+              ACW FI  R   FI+G YP A +WR  ++F   ++   P  I
Sbjct: 63  SDCSGE-----------GACWLFIGQRLNFFIYGFYPDALQWRVDIMFGLLAVAFVPQFI 111

Query: 136 PSFPRKFLNSIL-LFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPL 194
             FPR+    I  L GL  I    +  G  GL  V++S WGGL++TL++++ GI+ ++P+
Sbjct: 112 ERFPRRKWFGIFGLTGLPLIGYILIPGGWFGLEEVQSSRWGGLMLTLILAYVGILAALPI 171

Query: 195 GILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALL 254
           G +LALGR S++P++R  C+ FIE++R VPL+TVLFMAS+MLPLFLPD  + +KL+RAL+
Sbjct: 172 GTILALGRRSDMPIIRGMCVVFIEVWRAVPLITVLFMASVMLPLFLPDGVNFEKLMRALI 231

Query: 255 GVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTF 314
           G++ + SAY+AEV+RGGLQ+I KGQ+EAA++LGL Y +K  L+++PQ +  VIPGIVNTF
Sbjct: 232 GITLWQSAYMAEVVRGGLQAIPKGQYEAASALGLGYWRKTGLVVLPQALTLVIPGIVNTF 291

Query: 315 IGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSV 374
           I LFKD++L+ II +FD+LG V+   ++  W +    T G +F+ F FWIFCF +S YS 
Sbjct: 292 ISLFKDTTLVLIIGLFDILGAVQSTITDPAWRNVT--TEGYVFVAFCFWIFCFGMSRYSQ 349

Query: 375 FIEKTLHKGSK 385
            +E+ L  G K
Sbjct: 350 NLERKLDTGHK 360


>gi|293412639|ref|ZP_06655362.1| polar amino acid ABC transporter [Escherichia coli B354]
 gi|331674785|ref|ZP_08375544.1| inner membrane amino-acid ABC transporter permease protein YhdY
           [Escherichia coli TA280]
 gi|291469410|gb|EFF11901.1| polar amino acid ABC transporter [Escherichia coli B354]
 gi|331068224|gb|EGI39620.1| inner membrane amino-acid ABC transporter permease protein YhdY
           [Escherichia coli TA280]
          Length = 367

 Score =  261 bits (668), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 163/369 (44%), Positives = 227/369 (61%), Gaps = 14/369 (3%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
            P          + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS RT
Sbjct: 9   PPRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRT 68

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM   
Sbjct: 69  DCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPMFWK 117

Query: 137 SFPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
             P +     +   ++P+   + +  G LGL  VET  WGGL +TL+I+  GI  ++P G
Sbjct: 118 ILPHRGRYIAVWAVIYPLIVWWLMYGGFLGLERVETRQWGGLTLTLIIASVGIAGALPWG 177

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           ILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+G
Sbjct: 178 ILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVG 237

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           V  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I
Sbjct: 238 VILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTII 297

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  
Sbjct: 298 ALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQH 355

Query: 376 IEKTLHKGS 384
           +EK  + G 
Sbjct: 356 LEKRFNTGR 364


>gi|259906953|ref|YP_002647309.1| transport system permease protein [Erwinia pyrifoliae Ep1/96]
 gi|224962575|emb|CAX54030.1| transport system permease protein [Erwinia pyrifoliae Ep1/96]
 gi|283476747|emb|CAY72582.1| putative ABC transport system, inner membrane component [Erwinia
           pyrifoliae DSM 12163]
          Length = 366

 Score =  261 bits (668), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 161/357 (45%), Positives = 224/357 (62%), Gaps = 14/357 (3%)

Query: 29  IAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQP 88
           +AW  KN F    + LLT L + ++  +IP  ++W+   A W G  R  CT         
Sbjct: 20  VAWARKNLFSGVGNSLLTLLCLWIMWEAIPPALNWLIFQANWTGDTRADCTKE------- 72

Query: 89  DGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILL 148
                ACW FI+ R+ Q ++G YP   RWR  L  + G + + PML+ S PR+    +  
Sbjct: 73  ----GACWVFIHARFGQLMYGLYPHELRWRINLALVIGLLSIVPMLVKSLPRRGSYLVGW 128

Query: 149 FGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIP 207
             ++P+  + ++YGG  GL  VET  WGGL +TL+I+  GI  ++P GILLALGR S +P
Sbjct: 129 AVVYPLLVWLLMYGGWLGLEQVETRQWGGLTLTLIIAAVGIAGALPAGILLALGRRSRMP 188

Query: 208 VLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEV 267
           V+R  C+ FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV  F SAY+AEV
Sbjct: 189 VVRTLCVLFIEFWRGVPLITVLFMSSVMLPLFMAEGSSIDKLIRALVGVILFQSAYVAEV 248

Query: 268 LRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISII 327
           +RGGLQ++ KGQ+E A SL L Y +   L+I+PQ +K VIPG+VNT I LFKD+SL+ II
Sbjct: 249 VRGGLQALPKGQYEGAESLALGYWKTQGLVILPQALKLVIPGLVNTIIALFKDTSLVIII 308

Query: 328 NMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
            +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  +EK  H G 
Sbjct: 309 GLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQHLEKRFHTGR 363


>gi|330504738|ref|YP_004381607.1| polar amino acid ABC transporter inner membrane subunit
           [Pseudomonas mendocina NK-01]
 gi|328919024|gb|AEB59855.1| polar amino acid ABC transporter, inner membrane subunit
           [Pseudomonas mendocina NK-01]
          Length = 365

 Score =  261 bits (667), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 168/371 (45%), Positives = 235/371 (63%), Gaps = 14/371 (3%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
               PP    G + W+  N F    + LLT L + L+   +P ++ W   DA W+GS R 
Sbjct: 8   PDLPPPTMSVGALGWLKANLFSNWFNTLLTLLALYLIWLMVPPLLQWAIFDANWVGSTRA 67

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            CT              ACW FI  R+ QF++G YP   RWR         +   P+ +P
Sbjct: 68  DCTKE-----------GACWVFIQQRFGQFMYGFYPGELRWRVDATIWLAIVGAAPLFVP 116

Query: 137 SFPRKFLNSILLFGLFPIFSF-FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
             PRK +  +    ++PI ++  +  G  GLS+V TS WGGL++TLVI++ GI  ++PLG
Sbjct: 117 QMPRKAVYGVAFLVIYPIIAWCLLHGGVFGLSVVPTSRWGGLMLTLVIAYVGITGALPLG 176

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           ILLALGR SN+P ++  C+TFIE +RGVPL+ VLFM+S+MLPLFLP+   +DKLLRAL+ 
Sbjct: 177 ILLALGRRSNLPAIKVICVTFIEFWRGVPLIIVLFMSSVMLPLFLPEGMSLDKLLRALVM 236

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           V  F +AYIAEV+RGG+Q+I KGQ+EAA ++GL Y + M L+I+PQ +K VIPGIVNTFI
Sbjct: 237 VIFFEAAYIAEVVRGGMQAIPKGQYEAAAAMGLGYWRTMGLVILPQALKLVIPGIVNTFI 296

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD+SL+ II +FDLL  ++   ++ +W+     T G +F   +FWIFCF +S YS+ 
Sbjct: 297 ALFKDTSLVIIIGLFDLLNSIKQATTDPSWLG--MATEGYVFAALIFWIFCFGMSRYSMH 354

Query: 376 IEKTLHKGSKK 386
           +E+ L  G K+
Sbjct: 355 LERKLDTGHKR 365


>gi|92112257|ref|YP_572185.1| amino acid ABC transporter permease [Chromohalobacter salexigens
           DSM 3043]
 gi|91795347|gb|ABE57486.1| amino acid ABC transporter membrane protein 2, PAAT family
           [Chromohalobacter salexigens DSM 3043]
          Length = 369

 Score =  261 bits (667), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 175/376 (46%), Positives = 241/376 (64%), Gaps = 14/376 (3%)

Query: 10  YVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAV 69
           ++R  +++   PP  +RGI  W H+N F  P + ++T + I LL + +   + W  + A 
Sbjct: 5   FMRDEMIEARRPPDARRGIWRWFHRNLFNGPINSVVTVVTIGLLAWGLWPFVQWALIQAD 64

Query: 70  WIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSIL 129
           WIG +R  C+              ACW FI  R+E  I+G YP A RWR  +VF   + L
Sbjct: 65  WIGDSRQACSGE-----------GACWVFISARFESIIYGFYPEAARWRVDIVFALMAGL 113

Query: 130 LTPMLIPSFPRKFLNSILLFGLFPIFSF-FVLYGGLGLSIVETSLWGGLLVTLVISFFGI 188
           L  + IP  P K   +++    FPI ++  +L G  GL  V T  WGGL++TL ++  GI
Sbjct: 114 LAWLAIPRVPGKRWAAVIAVIGFPIAAYVLLLGGHFGLIYVPTREWGGLMLTLTVATIGI 173

Query: 189 IISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDK 248
           + S+P+GI+LALGR SN+P +R   + FIE +RGVPL+TVLFMAS+MLPLF+P   + DK
Sbjct: 174 VGSLPIGIVLALGRRSNLPFVRAVSVVFIEFWRGVPLITVLFMASVMLPLFVPTQVEFDK 233

Query: 249 LLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIP 308
           LLRAL+G+  F SAY+AEV+RGGLQ+I  GQ EA  +LGL Y Q+M LI++PQ +K VIP
Sbjct: 234 LLRALVGIMLFWSAYMAEVVRGGLQAIPSGQDEAGKALGLGYWQRMGLIVLPQALKLVIP 293

Query: 309 GIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFS 368
           GIVNTFI LFKD+SL+ II +FDLL I+R   ++S W+     T G +F   VFW+FCFS
Sbjct: 294 GIVNTFIALFKDTSLVLIIGLFDLLAIIRAGLTDSDWLG--FATEGYVFAALVFWVFCFS 351

Query: 369 ISLYSVFIEKTLHKGS 384
           +S YS +IE+ L  G 
Sbjct: 352 MSRYSQYIERRLQTGH 367


>gi|154253426|ref|YP_001414250.1| polar amino acid ABC transporter inner membrane subunit
           [Parvibaculum lavamentivorans DS-1]
 gi|154157376|gb|ABS64593.1| polar amino acid ABC transporter, inner membrane subunit
           [Parvibaculum lavamentivorans DS-1]
          Length = 369

 Score =  261 bits (667), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 170/370 (45%), Positives = 235/370 (63%), Gaps = 11/370 (2%)

Query: 19  SLPPVYQR-GIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTV 77
              P  +    +AW  +N F +  + +LT     LL  +IP  + +    AVW G+ R  
Sbjct: 9   RPAPRSKSLTPLAWAQRNLFSSVGNTILTLASFYLLWLTIPPALDFTIFSAVWTGTTREA 68

Query: 78  CTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPS 137
           C               ACW F++   +QFI+G YP ++ WR  L F  G  ++ PMLIP 
Sbjct: 69  CLEPGA---------GACWPFVWANIDQFIYGRYPPSEIWRVNLTFALGVAVIVPMLIPG 119

Query: 138 FPRKFLNSILLFGLFPIFSF-FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGI 196
            P + LN +LL  ++P+ +   +     GL  V TS WGGLLVTLV++  GI+ S+PLG+
Sbjct: 120 LPARRLNLVLLLIVYPLVAIVLLAGDRPGLPPVPTSEWGGLLVTLVVAVTGIVASLPLGV 179

Query: 197 LLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGV 256
           LLALGR S++P +R  CI FIE +RGVPL+TVLFMAS+MLPLFLP+  + D LLR L+GV
Sbjct: 180 LLALGRRSDMPAIRMLCIIFIEFWRGVPLITVLFMASVMLPLFLPEGVNPDNLLRCLVGV 239

Query: 257 SAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIG 316
           + F+SAY+AEV+RGGLQ+I  GQ+EAA ++GL+Y Q M  +++PQ ++ VIPGIVNTFIG
Sbjct: 240 ALFSSAYMAEVVRGGLQAIPAGQYEAARAVGLTYWQAMGQVVLPQALRHVIPGIVNTFIG 299

Query: 317 LFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFI 376
           LFKD++L+ I+ +FDLLG VR   S+  W       TG IF   VFW+FCF +S YS F+
Sbjct: 300 LFKDTTLVLIVGIFDLLGQVRAQLSDPNWTIPQGALTGYIFAALVFWVFCFGMSQYSNFM 359

Query: 377 EKTLHKGSKK 386
           E+ L    ++
Sbjct: 360 ERRLDTTRER 369


>gi|110643516|ref|YP_671246.1| amino acid ABC transporter permease [Escherichia coli 536]
 gi|191173841|ref|ZP_03035362.1| amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine
           family [Escherichia coli F11]
 gi|218702042|ref|YP_002409671.1| amino-acid ABC transporter membrane protein [Escherichia coli
           IAI39]
 gi|110345108|gb|ABG71345.1| hypothetical amino-acid ABC transporter permease protein YhdY
           [Escherichia coli 536]
 gi|190905891|gb|EDV65509.1| amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine
           family [Escherichia coli F11]
 gi|218372028|emb|CAR19886.1| amino-acid transporter subunit ; membrane component of ABC
           superfamily [Escherichia coli IAI39]
 gi|323966448|gb|EGB61882.1| inner membrane transport system [Escherichia coli M863]
 gi|327251364|gb|EGE63053.1| general L-amino acid transport system permease protein aapM
           [Escherichia coli STEC_7v]
          Length = 367

 Score =  261 bits (667), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 162/369 (43%), Positives = 226/369 (61%), Gaps = 14/369 (3%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
            P          + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS R 
Sbjct: 9   PPRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRA 68

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM   
Sbjct: 69  DCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPMFWK 117

Query: 137 SFPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
             P +     +   ++P+   + +  G LGL  VET  WGGL +TL+I+  GI  ++P G
Sbjct: 118 ILPHRGRYIAVWAVIYPLIVWWLMYGGFLGLERVETRQWGGLTLTLIIASVGIAGALPWG 177

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           ILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+G
Sbjct: 178 ILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVG 237

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           V  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I
Sbjct: 238 VILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTII 297

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  
Sbjct: 298 ALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQH 355

Query: 376 IEKTLHKGS 384
           +EK  + G 
Sbjct: 356 LEKRFNTGR 364


>gi|310766168|gb|ADP11118.1| transport system permease protein [Erwinia sp. Ejp617]
          Length = 366

 Score =  261 bits (666), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 160/357 (44%), Positives = 224/357 (62%), Gaps = 14/357 (3%)

Query: 29  IAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQP 88
           +AW  KN F    + LLT L + ++  +IP  ++W+   A W G  R  CT         
Sbjct: 20  VAWARKNLFSGVGNSLLTLLCLWIMWEAIPPALNWLIFQANWTGDTRADCTKE------- 72

Query: 89  DGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILL 148
                ACW FI+ R+ Q ++G YP   RWR  L  + G + + PM + + PR+    +  
Sbjct: 73  ----GACWVFIHARFGQLMYGLYPHELRWRINLALVIGLLSIVPMFLKNLPRRSSYIVGW 128

Query: 149 FGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIP 207
             ++P+  + ++YGG  GL  VET  WGGL +TL+I+  GI  ++P GILLALGR S +P
Sbjct: 129 AVVYPLLVWLLMYGGWLGLEQVETRQWGGLTLTLIIAAVGIAGALPAGILLALGRRSQMP 188

Query: 208 VLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEV 267
           V+R  C+ FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV  F SAY+AEV
Sbjct: 189 VVRTLCVLFIEFWRGVPLITVLFMSSVMLPLFMAEGSSIDKLIRALVGVILFQSAYVAEV 248

Query: 268 LRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISII 327
           +RGGLQ++ KGQ+E A SL L Y +  RL+I+PQ +K VIPG+VNT I LFKD+SL+ II
Sbjct: 249 VRGGLQALPKGQYEGAESLALGYWKTQRLVILPQALKLVIPGLVNTIIALFKDTSLVIII 308

Query: 328 NMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
            +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  +EK  H G 
Sbjct: 309 GLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQHLEKRFHTGR 363


>gi|331664879|ref|ZP_08365784.1| inner membrane amino-acid ABC transporter permease protein YhdY
           [Escherichia coli TA143]
 gi|331058127|gb|EGI30109.1| inner membrane amino-acid ABC transporter permease protein YhdY
           [Escherichia coli TA143]
          Length = 367

 Score =  261 bits (666), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 161/369 (43%), Positives = 225/369 (60%), Gaps = 14/369 (3%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
            P          + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS R 
Sbjct: 9   PPRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRA 68

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM   
Sbjct: 69  DCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPMFWK 117

Query: 137 SFPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
             P +     +   ++P+   + +  G  GL  VET  WGGL +TL+I+  GI  ++P G
Sbjct: 118 ILPHRGRYIAVWAVMYPLIVWWLMYGGFFGLERVETRQWGGLTLTLIIASVGIAGALPWG 177

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           ILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+G
Sbjct: 178 ILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVG 237

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           V  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I
Sbjct: 238 VILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTII 297

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  
Sbjct: 298 ALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQH 355

Query: 376 IEKTLHKGS 384
           +EK  + G 
Sbjct: 356 LEKRFNTGR 364


>gi|110807126|ref|YP_690646.1| putative transport system permease [Shigella flexneri 5 str. 8401]
 gi|110616674|gb|ABF05341.1| putative transport system permease protein [Shigella flexneri 5
           str. 8401]
          Length = 367

 Score =  261 bits (666), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 161/369 (43%), Positives = 224/369 (60%), Gaps = 14/369 (3%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
                       + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS R 
Sbjct: 9   PSRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRA 68

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM   
Sbjct: 69  DCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPMFWK 117

Query: 137 SFPRKFLNSILLFGLFPIFSF-FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
             P +         ++P+  +  +  G  GL  VET  WGGL +TL+I+  GI  ++P G
Sbjct: 118 ILPHRGRYIAAWAVIYPLIVWRLMYGGFFGLERVETRQWGGLTLTLIIASVGIAGALPWG 177

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           ILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+G
Sbjct: 178 ILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVG 237

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           V  F SAY+AEV+RGGLQ++ KGQ+EAA SL LSY +   L+I+PQ +K VIPG+VNT I
Sbjct: 238 VILFQSAYVAEVVRGGLQALPKGQYEAAESLALSYRKTQGLVILPQALKLVIPGLVNTII 297

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  
Sbjct: 298 ALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQH 355

Query: 376 IEKTLHKGS 384
           +EK  + G 
Sbjct: 356 LEKRFNTGR 364


>gi|331649071|ref|ZP_08350159.1| inner membrane amino-acid ABC transporter permease protein YhdY
           [Escherichia coli M605]
 gi|330909321|gb|EGH37835.1| glutamate Aspartate transport system permease protein GltK
           [Escherichia coli AA86]
 gi|331042818|gb|EGI14960.1| inner membrane amino-acid ABC transporter permease protein YhdY
           [Escherichia coli M605]
          Length = 367

 Score =  261 bits (666), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 162/369 (43%), Positives = 226/369 (61%), Gaps = 14/369 (3%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
            P          + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS R 
Sbjct: 9   PPRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRA 68

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM   
Sbjct: 69  DCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPMFWK 117

Query: 137 SFPRKFLNSILLFGLFP-IFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
             P +     +   ++P +  + +  G LGL  VET  WGGL +TL+I+  GI  ++P G
Sbjct: 118 ILPHRGRYIAVWAVIYPLVVWWLMYGGFLGLDRVETRQWGGLTLTLIIASVGIAGALPWG 177

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           ILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+G
Sbjct: 178 ILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVG 237

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           V  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I
Sbjct: 238 VILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTII 297

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  
Sbjct: 298 ALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQH 355

Query: 376 IEKTLHKGS 384
           +EK  + G 
Sbjct: 356 LEKRFNTGR 364


>gi|157158180|ref|YP_001464745.1| His/Glu/Gln/Arg/opine ABC transporter permease [Escherichia coli
           E24377A]
 gi|193066457|ref|ZP_03047502.1| amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine
           family [Escherichia coli E22]
 gi|194430236|ref|ZP_03062733.1| amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine
           family [Escherichia coli B171]
 gi|218555835|ref|YP_002388748.1| amino-acid ABC transporter membrane protein [Escherichia coli IAI1]
 gi|218696970|ref|YP_002404637.1| amino-acid transporter subunit ; membrane component of ABC
           superfamily [Escherichia coli 55989]
 gi|260846075|ref|YP_003223853.1| putative transport system permease protein [Escherichia coli
           O103:H2 str. 12009]
 gi|307314972|ref|ZP_07594560.1| polar amino acid ABC transporter, inner membrane subunit
           [Escherichia coli W]
 gi|331670096|ref|ZP_08370941.1| inner membrane amino-acid ABC transporter permease protein YhdY
           [Escherichia coli TA271]
 gi|331679344|ref|ZP_08380016.1| putative transport system permease protein [Escherichia coli H591]
 gi|157080210|gb|ABV19918.1| amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine
           family [Escherichia coli E24377A]
 gi|192925886|gb|EDV80535.1| amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine
           family [Escherichia coli E22]
 gi|194411707|gb|EDX28032.1| amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine
           family [Escherichia coli B171]
 gi|218353702|emb|CAU99966.1| amino-acid transporter subunit ; membrane component of ABC
           superfamily [Escherichia coli 55989]
 gi|218362603|emb|CAR00228.1| amino-acid transporter subunit ; membrane component of ABC
           superfamily [Escherichia coli IAI1]
 gi|257761222|dbj|BAI32719.1| putative transport system permease protein [Escherichia coli
           O103:H2 str. 12009]
 gi|306905555|gb|EFN36087.1| polar amino acid ABC transporter, inner membrane subunit
           [Escherichia coli W]
 gi|315062569|gb|ADT76896.1| predicted amino-acid transporter subunit [Escherichia coli W]
 gi|323376844|gb|ADX49112.1| polar amino acid ABC transporter, inner membrane subunit
           [Escherichia coli KO11]
 gi|331063009|gb|EGI34923.1| inner membrane amino-acid ABC transporter permease protein YhdY
           [Escherichia coli TA271]
 gi|331073409|gb|EGI44732.1| putative transport system permease protein [Escherichia coli H591]
          Length = 367

 Score =  261 bits (666), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 161/369 (43%), Positives = 226/369 (61%), Gaps = 14/369 (3%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
                       + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS R 
Sbjct: 9   PSRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRA 68

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM   
Sbjct: 69  DCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPMFWK 117

Query: 137 SFPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
             P +     +   ++P+   + +  G  GL  VET  WGGL +TL+I+  GI  ++P G
Sbjct: 118 ILPHRGRYIAVWAVIYPLIVWWLMYGGFFGLERVETRQWGGLTLTLIIASVGIAGALPWG 177

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           ILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +  ++DKL+RAL+G
Sbjct: 178 ILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTNIDKLIRALVG 237

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           V  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I
Sbjct: 238 VILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTII 297

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD+SL+ II +FDL   V+    + TW+     T G +F   ++WIFCFS+S YS  
Sbjct: 298 ALFKDTSLVIIIGLFDLFSSVQQATVDPTWLG--MSTEGYVFAALIYWIFCFSMSRYSQH 355

Query: 376 IEKTLHKGS 384
           +EK  + G 
Sbjct: 356 LEKRFNTGR 364


>gi|218706885|ref|YP_002414404.1| amino-acid ABC transporter membrane protein [Escherichia coli
           UMN026]
 gi|293406872|ref|ZP_06650798.1| polar amino acid ABC transporter [Escherichia coli FVEC1412]
 gi|298382613|ref|ZP_06992210.1| general L-amino acid transport system permease [Escherichia coli
           FVEC1302]
 gi|218433982|emb|CAR14899.1| amino-acid transporter subunit ; membrane component of ABC
           superfamily [Escherichia coli UMN026]
 gi|291426878|gb|EFE99910.1| polar amino acid ABC transporter [Escherichia coli FVEC1412]
 gi|298277753|gb|EFI19269.1| general L-amino acid transport system permease [Escherichia coli
           FVEC1302]
          Length = 367

 Score =  261 bits (666), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 163/369 (44%), Positives = 227/369 (61%), Gaps = 14/369 (3%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
            P          + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS RT
Sbjct: 9   PPRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRT 68

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM   
Sbjct: 69  DCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPMFWK 117

Query: 137 SFPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
             P +     +   ++P+   + +  G LGL  VET  WGGL +TL+I+  GI  ++P G
Sbjct: 118 ILPNRGRYIAVWAVIYPLIVWWLMYGGFLGLERVETRQWGGLTLTLIIASVGIAGALPWG 177

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           ILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+G
Sbjct: 178 ILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVG 237

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           V  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I
Sbjct: 238 VILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTII 297

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  
Sbjct: 298 ALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQH 355

Query: 376 IEKTLHKGS 384
           +EK  + G 
Sbjct: 356 LEKRFNTGR 364


>gi|307546907|ref|YP_003899386.1| ABC transporter permease [Halomonas elongata DSM 2581]
 gi|307218931|emb|CBV44201.1| ABC-type transport system permease protein [Halomonas elongata DSM
           2581]
          Length = 364

 Score =  260 bits (665), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 173/374 (46%), Positives = 242/374 (64%), Gaps = 14/374 (3%)

Query: 12  RKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWI 71
           R  +++   PP  +RG++ W+H N F  P +  L+ + I LL  ++  +  W  +DA W+
Sbjct: 4   RTEMIEARRPPDMRRGVVGWLHANLFNGPLNSALSLVTIVLLAMALWPLAKWALIDADWL 63

Query: 72  GSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLT 131
           GS R  CT              ACW FI  R+E  I+G YP A+RWR  +V    ++L+ 
Sbjct: 64  GSTREACTGE-----------GACWVFISARFETIIYGFYPHAERWRVDIVLAMMALLIA 112

Query: 132 PMLIPSFPRKFLNSILLFGLFPIFSF-FVLYGGLGLSIVETSLWGGLLVTLVISFFGIII 190
            + IP  P K    +     FPI +F  +L G  GL  V T  WGGL++TL ++  GI+ 
Sbjct: 113 WLAIPRLPAKRWAGLFALVGFPILAFVLLLGGHFGLEAVPTRQWGGLMLTLTVATVGIVG 172

Query: 191 SMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLL 250
           S+P+G++LALGR S +P++R  C+ FIE +RGVPL+TVLFMAS+MLPLF+P   + DKLL
Sbjct: 173 SLPIGVVLALGRRSKMPLVRSLCVVFIEFWRGVPLITVLFMASVMLPLFVPTEVEFDKLL 232

Query: 251 RALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGI 310
           RAL+G+  F SAY+AEV+RGGLQ+I  GQ EAA +LG+ Y ++M LI++PQ +K VIPGI
Sbjct: 233 RALIGIMFFWSAYMAEVVRGGLQAIPSGQEEAAKALGMGYWRRMGLIVLPQALKLVIPGI 292

Query: 311 VNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSIS 370
           VNTFI LFKD+SL+ II +FDLL I+R   ++S W+     T G +F   +FW+FCFS+S
Sbjct: 293 VNTFIALFKDTSLVLIIGLFDLLAIIRAGLTDSNWLG--FATEGYVFAALMFWVFCFSMS 350

Query: 371 LYSVFIEKTLHKGS 384
            YS +IE+ LH G 
Sbjct: 351 RYSQYIERRLHTGH 364


>gi|323979010|gb|EGB74088.1| inner membrane transport system [Escherichia coli TW10509]
          Length = 367

 Score =  260 bits (665), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 162/369 (43%), Positives = 226/369 (61%), Gaps = 14/369 (3%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
            P          + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS R 
Sbjct: 9   PPRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRA 68

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM   
Sbjct: 69  DCTNA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIVPMFWK 117

Query: 137 SFPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
             P +     +   ++P+   + +  G LGL  VET  WGGL +TL+I+  GI  ++P G
Sbjct: 118 ILPHRGRYIAVWAVIYPLIVWWLMYGGFLGLERVETRQWGGLTLTLIIASVGIAGALPWG 177

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           ILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+G
Sbjct: 178 ILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVG 237

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           V  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I
Sbjct: 238 VILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTII 297

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  
Sbjct: 298 ALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQH 355

Query: 376 IEKTLHKGS 384
           +EK  + G 
Sbjct: 356 LEKRFNTGR 364


>gi|194435100|ref|ZP_03067337.1| amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine
           family [Shigella dysenteriae 1012]
 gi|194416662|gb|EDX32794.1| amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine
           family [Shigella dysenteriae 1012]
 gi|320181544|gb|EFW56462.1| Glutamate Aspartate transport system permease protein GltK
           [Shigella boydii ATCC 9905]
 gi|332087263|gb|EGI92396.1| general L-amino acid transport system permease protein aapM
           [Shigella boydii 5216-82]
          Length = 367

 Score =  260 bits (665), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 160/369 (43%), Positives = 225/369 (60%), Gaps = 14/369 (3%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
                       + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS R 
Sbjct: 9   PSRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRA 68

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM   
Sbjct: 69  DCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPMFWK 117

Query: 137 SFPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
             P +     +   ++P+   + +  G  GL  VET  WGGL +TL+I+  GI  ++P G
Sbjct: 118 ILPHRGRYIAVWAVIYPLIVWWLMYGGFFGLERVETRQWGGLTLTLIIASVGIAGALPWG 177

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           ILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +  ++DKL+RAL+G
Sbjct: 178 ILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTNIDKLIRALVG 237

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           V  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I
Sbjct: 238 VILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTII 297

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  
Sbjct: 298 ALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQH 355

Query: 376 IEKTLHKGS 384
           +EK  + G 
Sbjct: 356 LEKRFNTGR 364


>gi|284923284|emb|CBG36378.1| ABC transporter, permease protein [Escherichia coli 042]
          Length = 368

 Score =  260 bits (665), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 161/369 (43%), Positives = 225/369 (60%), Gaps = 14/369 (3%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
            P          + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS R 
Sbjct: 10  PPRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRA 69

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM   
Sbjct: 70  DCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPMFWK 118

Query: 137 SFPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
             P +     +   ++P+   + +  G  GL  VET  WGGL +TL+I+  GI  ++P G
Sbjct: 119 ILPHRGRYIAVWAVMYPLIVWWLMYGGFFGLERVETRQWGGLTLTLIIASVGIAGALPWG 178

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           ILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+G
Sbjct: 179 ILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVG 238

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           V  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I
Sbjct: 239 VILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTII 298

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  
Sbjct: 299 ALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQH 356

Query: 376 IEKTLHKGS 384
           +EK  + G 
Sbjct: 357 LEKRFNTGR 365


>gi|281180312|dbj|BAI56642.1| amino acid ABC transporter permease component [Escherichia coli
           SE15]
          Length = 368

 Score =  260 bits (665), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 162/369 (43%), Positives = 226/369 (61%), Gaps = 14/369 (3%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
            P          + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS R 
Sbjct: 10  PPRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRA 69

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM   
Sbjct: 70  DCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPMFWK 118

Query: 137 SFPRKFLNSILLFGLFP-IFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
             P +     +   ++P +  + +  G LGL  VET  WGGL +TL+I+  GI  ++P G
Sbjct: 119 ILPHRGRYIAVWAVIYPLVVWWLMYGGFLGLDRVETRQWGGLTLTLIIASVGIAGALPWG 178

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           ILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+G
Sbjct: 179 ILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVG 238

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           V  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I
Sbjct: 239 VILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTII 298

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  
Sbjct: 299 ALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQH 356

Query: 376 IEKTLHKGS 384
           +EK  + G 
Sbjct: 357 LEKRFNTGR 365


>gi|317049797|ref|YP_004117445.1| polar amino acid ABC transporter inner membrane subunit [Pantoea
           sp. At-9b]
 gi|316951414|gb|ADU70889.1| polar amino acid ABC transporter, inner membrane subunit [Pantoea
           sp. At-9b]
          Length = 366

 Score =  260 bits (664), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 171/377 (45%), Positives = 229/377 (60%), Gaps = 17/377 (4%)

Query: 11  VRKRLLQPSLP-PVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAV 69
           V      P    PV +     W  KN F +  + LLT L   ++   IP  ++W+   A 
Sbjct: 3   VTTHETPPVPTNPVSK--AWGWARKNLFSSWFNTLLTLLCFWIIWSVIPPALNWLVFQAN 60

Query: 70  WIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSIL 129
           WIGS R  CT              ACW FI+ R+ QF++G YP   RWR  L  + G + 
Sbjct: 61  WIGSTRADCTKE-----------GACWVFIHARFGQFMYGLYPHELRWRINLALVIGLLS 109

Query: 130 LTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGI 188
           + PM I S P +          +PI  +F++YGG  GL  VET  WGGL +TL+I+  GI
Sbjct: 110 IIPMFIKSMPHRGRYIACWAVAYPIIVWFLMYGGYLGLDRVETRQWGGLTLTLIIASVGI 169

Query: 189 IISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDK 248
             ++PLGILLALGR S +PV+R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DK
Sbjct: 170 AGALPLGILLALGRRSKMPVVRTLSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTTIDK 229

Query: 249 LLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIP 308
           L+RAL+GV  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K  IP
Sbjct: 230 LVRALVGVILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQILVILPQALKLTIP 289

Query: 309 GIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFS 368
           G+VNT I LFKD+SL+ II +FDL   V+    + TW+     T G +F   V+WIFCFS
Sbjct: 290 GLVNTIIALFKDTSLVIIIGLFDLFSSVQQATVDPTWLG--MSTEGYVFAALVYWIFCFS 347

Query: 369 ISLYSVFIEKTLHKGSK 385
           +S YS ++EK  H G K
Sbjct: 348 MSRYSQYLEKRFHTGRK 364


>gi|218550554|ref|YP_002384345.1| amino-acid ABC transporter membrane protein [Escherichia fergusonii
           ATCC 35469]
 gi|218358095|emb|CAQ90741.1| amino-acid transporter subunit ; membrane component of ABC
           superfamily [Escherichia fergusonii ATCC 35469]
          Length = 367

 Score =  260 bits (664), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 161/369 (43%), Positives = 226/369 (61%), Gaps = 14/369 (3%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
            P          + W+ KN F +  + LLT   + L+   IP +++W FL A W+GS R 
Sbjct: 9   PPRPTSHNSSRAMVWVRKNLFSSWSNSLLTIGCLWLMWELIPPLLNWAFLQANWVGSTRA 68

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM   
Sbjct: 69  DCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPMFWK 117

Query: 137 SFPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
             P +     +   ++P+   + +  G LGL  VET  WGGL +TL+I+  GI  ++P G
Sbjct: 118 ILPHRGRYIAVWAVIYPLIVWWLMYGGFLGLERVETRQWGGLTLTLIIASVGIAGALPWG 177

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           ILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+G
Sbjct: 178 ILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVG 237

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           V  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I
Sbjct: 238 VILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTII 297

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  
Sbjct: 298 ALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQH 355

Query: 376 IEKTLHKGS 384
           +EK  + G 
Sbjct: 356 LEKRFNTGR 364


>gi|209920743|ref|YP_002294827.1| amino acid ABC transporter permease [Escherichia coli SE11]
 gi|209914002|dbj|BAG79076.1| amino acid ABC transporter permease component [Escherichia coli
           SE11]
          Length = 368

 Score =  260 bits (664), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 161/369 (43%), Positives = 226/369 (61%), Gaps = 14/369 (3%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
                       + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS R 
Sbjct: 10  PSRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRA 69

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM   
Sbjct: 70  DCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPMFWK 118

Query: 137 SFPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
             P +     +   ++P+   + +  G  GL  VET  WGGL +TL+I+  GI  ++P G
Sbjct: 119 ILPHRGRYIAVWAVIYPLIVWWLMYGGFFGLERVETRQWGGLTLTLIIASVGIAGALPWG 178

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           ILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +  ++DKL+RAL+G
Sbjct: 179 ILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTNIDKLIRALVG 238

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           V  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I
Sbjct: 239 VILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTII 298

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD+SL+ II +FDL   V+    + TW+     T G +F   ++WIFCFS+S YS  
Sbjct: 299 ALFKDTSLVIIIGLFDLFSSVQQATVDPTWLG--MSTEGYVFAALIYWIFCFSMSRYSQH 356

Query: 376 IEKTLHKGS 384
           +EK  + G 
Sbjct: 357 LEKRFNTGR 365


>gi|293449593|ref|ZP_06664014.1| general L-amino acid transport system permease [Escherichia coli
           B088]
 gi|291322683|gb|EFE62112.1| general L-amino acid transport system permease [Escherichia coli
           B088]
 gi|320202180|gb|EFW76755.1| Glutamate Aspartate transport system permease protein GltK
           [Escherichia coli EC4100B]
 gi|323946883|gb|EGB42899.1| inner membrane transport system [Escherichia coli H120]
          Length = 367

 Score =  260 bits (664), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 161/369 (43%), Positives = 224/369 (60%), Gaps = 14/369 (3%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
                       + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS R 
Sbjct: 9   PSRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRA 68

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM   
Sbjct: 69  DCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPMFWK 117

Query: 137 SFPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
             P +         ++P+   + +  G  GL  VET  WGGL +TL+I+  GI  ++P G
Sbjct: 118 ILPHRGRYIAAWAVIYPLIVWWLMYGGFFGLERVETRQWGGLTLTLIIASVGIAGALPWG 177

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           ILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+G
Sbjct: 178 ILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVG 237

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           V  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I
Sbjct: 238 VILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTII 297

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD+SL+ II +FDL   V+    + TW+     T G +F   ++WIFCFS+S YS  
Sbjct: 298 ALFKDTSLVIIIGLFDLFSSVQQATVDPTWLG--MSTEGYVFAALIYWIFCFSMSRYSQH 355

Query: 376 IEKTLHKGS 384
           +EK  + G 
Sbjct: 356 LEKRFNTGR 364


>gi|306816386|ref|ZP_07450518.1| amino-acid transporter subunit ; membrane component of ABC
           superfamily protein [Escherichia coli NC101]
 gi|222034986|emb|CAP77729.1| Inner membrane amino-acid ABC transporter permease [Escherichia
           coli LF82]
 gi|305849951|gb|EFM50410.1| amino-acid transporter subunit ; membrane component of ABC
           superfamily protein [Escherichia coli NC101]
 gi|312947828|gb|ADR28655.1| amino-acid transporter subunit; membrane component of ABC
           superfamily protein [Escherichia coli O83:H1 str. NRG
           857C]
          Length = 367

 Score =  260 bits (664), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 163/369 (44%), Positives = 226/369 (61%), Gaps = 14/369 (3%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
            P          + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS R 
Sbjct: 9   PPRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRA 68

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            CT              ACW FI++R+ QFI+G YP  QRWR  L  L G + + PM   
Sbjct: 69  DCTKA-----------GACWVFIHERFGQFIYGLYPHDQRWRINLALLIGLVSIAPMFWK 117

Query: 137 SFPRKFLNSILLFGLFP-IFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
             P +     +   ++P +  + +  G LGL  VET  WGGL +TL+I+  GI  ++P G
Sbjct: 118 ILPHRGRYIAVWAVIYPLVVWWLMYGGFLGLDRVETRQWGGLTLTLIIASVGIAGALPWG 177

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           ILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+G
Sbjct: 178 ILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVG 237

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           V  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I
Sbjct: 238 VILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTII 297

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  
Sbjct: 298 ALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQH 355

Query: 376 IEKTLHKGS 384
           +EK  + G 
Sbjct: 356 LEKRFNTGR 364


>gi|191169154|ref|ZP_03030912.1| amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine
           family [Escherichia coli B7A]
 gi|256018816|ref|ZP_05432681.1| amino acid ABC transporter permease component [Shigella sp. D9]
 gi|260857398|ref|YP_003231289.1| putative transport system permease protein [Escherichia coli
           O26:H11 str. 11368]
 gi|190900796|gb|EDV60587.1| amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine
           family [Escherichia coli B7A]
 gi|257756047|dbj|BAI27549.1| putative transport system permease protein [Escherichia coli
           O26:H11 str. 11368]
 gi|323154325|gb|EFZ40527.1| general L-amino acid transport system permease protein aapM
           [Escherichia coli EPECa14]
          Length = 367

 Score =  260 bits (664), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 161/369 (43%), Positives = 225/369 (60%), Gaps = 14/369 (3%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
                       + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS R 
Sbjct: 9   PSRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRA 68

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM   
Sbjct: 69  DCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPMFWK 117

Query: 137 SFPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
             P +     +   ++P+   + +  G  GL  VET  WGGL +TL+I+  GI  ++P G
Sbjct: 118 ILPHRGRYIAVWAVIYPLIVWWLMYGGFFGLERVETRQWGGLTLTLIIASVGIAGALPWG 177

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           ILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+G
Sbjct: 178 ILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVG 237

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           V  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I
Sbjct: 238 VILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTII 297

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD+SL+ II +FDL   V+    + TW+     T G +F   ++WIFCFS+S YS  
Sbjct: 298 ALFKDTSLVIIIGLFDLFSSVQQATVDPTWLG--MSTEGYVFAALIYWIFCFSMSRYSQH 355

Query: 376 IEKTLHKGS 384
           +EK  + G 
Sbjct: 356 LEKRFNTGR 364


>gi|74313797|ref|YP_312216.1| putative transport system permease [Shigella sonnei Ss046]
 gi|73857274|gb|AAZ89981.1| putative transport system permease protein [Shigella sonnei Ss046]
 gi|332086438|gb|EGI91585.1| general L-amino acid transport system permease protein aapM
           [Shigella dysenteriae 155-74]
          Length = 368

 Score =  260 bits (663), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 160/369 (43%), Positives = 225/369 (60%), Gaps = 14/369 (3%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
                       + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS R 
Sbjct: 10  PSRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRA 69

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM   
Sbjct: 70  DCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPMFWK 118

Query: 137 SFPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
             P +     +   ++P+   + +  G  GL  VET  WGGL +TL+I+  GI  ++P G
Sbjct: 119 ILPHRGRYIAVWAVIYPLIVWWLMYGGFFGLERVETRQWGGLTLTLIIASVGIAGALPWG 178

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           ILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +  ++DKL+RAL+G
Sbjct: 179 ILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTNIDKLIRALVG 238

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           V  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I
Sbjct: 239 VILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTII 298

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  
Sbjct: 299 ALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQH 356

Query: 376 IEKTLHKGS 384
           +EK  + G 
Sbjct: 357 LEKRFNTGR 365


>gi|311695085|gb|ADP97958.1| amino acid ABC transporter, permease protein [marine bacterium
           HP15]
          Length = 362

 Score =  260 bits (663), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 166/366 (45%), Positives = 242/366 (66%), Gaps = 14/366 (3%)

Query: 21  PPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTT 80
            P      + W+ +N F    + +LT  +  LL+ S+  +++W FLDA ++GS+ + CT 
Sbjct: 9   APKKALRPVKWMRENLFSGWFNTVLTLGVAYLLVTSVGPLLNWFFLDANFVGSDPSACTG 68

Query: 81  VSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFP- 139
                        ACW FI  R   FI+G YP   +WR  ++FL  ++   P  I  FP 
Sbjct: 69  A-----------GACWLFISQRLNFFIYGFYPDELQWRVDVMFLLLAVSFVPQFIERFPG 117

Query: 140 RKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLA 199
           RK+L    +FGL  +  F +  G  GL  V++S WGGL++TL++++ GII S+P+GILLA
Sbjct: 118 RKWLGLFGIFGLPIVGYFLIPGGSFGLEEVQSSKWGGLMLTLILAYIGIIASLPIGILLA 177

Query: 200 LGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAF 259
           LGR S++P++R  C+ FIE++R VPL+TVLFMAS+MLPLFLP+  + +KL RAL+G++ +
Sbjct: 178 LGRRSDMPIIRGICVVFIEVWRAVPLITVLFMASVMLPLFLPEGVNFEKLARALIGITLW 237

Query: 260 ASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFK 319
            SAY+AEV+RGGLQ+I +GQ+EAA++LGL Y +KM L+I+PQ +K VIPGIVNTFI LFK
Sbjct: 238 QSAYMAEVIRGGLQAIPRGQYEAADALGLGYWRKMGLVILPQALKMVIPGIVNTFISLFK 297

Query: 320 DSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKT 379
           D++L+ II +FD+LG V+   ++  W +      G +F+ F FW+FCF IS YS  +E+ 
Sbjct: 298 DTTLVLIIGLFDILGTVQSTVTDPAWQNV--AIEGYVFVAFCFWVFCFGISRYSQNLERK 355

Query: 380 LHKGSK 385
           L  G K
Sbjct: 356 LDTGHK 361


>gi|30064599|ref|NP_838770.1| putative transport system permease protein [Shigella flexneri 2a
           str. 2457T]
 gi|56480303|ref|NP_709065.2| putative transport system permease protein [Shigella flexneri 2a
           str. 301]
 gi|30042858|gb|AAP18581.1| putative transport system permease protein [Shigella flexneri 2a
           str. 2457T]
 gi|56383854|gb|AAN44772.2| putative transport system permease protein [Shigella flexneri 2a
           str. 301]
 gi|313648621|gb|EFS13062.1| general L-amino acid transport system permease protein aapM
           [Shigella flexneri 2a str. 2457T]
 gi|324119450|gb|EGC13333.1| inner membrane transport system [Escherichia coli E1167]
          Length = 367

 Score =  260 bits (663), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 160/369 (43%), Positives = 223/369 (60%), Gaps = 14/369 (3%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
                       + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS R 
Sbjct: 9   PSRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRA 68

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM   
Sbjct: 69  DCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPMFWK 117

Query: 137 SFPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
             P +         ++P+   + +  G  GL  VET  WGGL +TL+I+  GI  ++P G
Sbjct: 118 ILPHRGRYIAAWAVIYPLIVWWLMYGGFFGLERVETRQWGGLTLTLIIASVGIAGALPWG 177

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           ILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+G
Sbjct: 178 ILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVG 237

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           V  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I
Sbjct: 238 VILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTII 297

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  
Sbjct: 298 ALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQH 355

Query: 376 IEKTLHKGS 384
           +EK  + G 
Sbjct: 356 LEKRFNTGR 364


>gi|296104985|ref|YP_003615131.1| general L-amino acid transport system permease protein
           [Enterobacter cloacae subsp. cloacae ATCC 13047]
 gi|295059444|gb|ADF64182.1| general L-amino acid transport system permease protein
           [Enterobacter cloacae subsp. cloacae ATCC 13047]
          Length = 367

 Score =  260 bits (663), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 164/366 (44%), Positives = 225/366 (61%), Gaps = 16/366 (4%)

Query: 22  PVYQRG--IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCT 79
           P    G   I W  KN F +  + LLT + + L+   IP +I+W FL A W+GS R  CT
Sbjct: 12  PANPTGGRFILWARKNLFSSWGNSLLTIICLWLMWELIPPLINWAFLQANWVGSTRADCT 71

Query: 80  TVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFP 139
                         ACW FI++R+ QF++G YP  QRWR  L  + G + +  M     P
Sbjct: 72  KA-----------GACWVFIHERFGQFMYGLYPHEQRWRINLALVIGLLSIAVMFWKRLP 120

Query: 140 RKFLNSILLFGLFPIFSF-FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILL 198
           ++         ++PI  +  +  G LGL  VET  WGGL +TL+I+  GI  ++P GILL
Sbjct: 121 QRGQYIACWAVVYPIVVWVLLYGGFLGLERVETRQWGGLTLTLIIASVGIAGALPWGILL 180

Query: 199 ALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSA 258
           ALGR S +PV+R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV  
Sbjct: 181 ALGRRSKMPVVRVLSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTTIDKLIRALVGVIL 240

Query: 259 FASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLF 318
           F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I LF
Sbjct: 241 FQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTIIALF 300

Query: 319 KDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEK 378
           KD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  +EK
Sbjct: 301 KDTSLVIIIGLFDLFSSVQQATVDPVWLG--MSTEGYVFAALIYWIFCFSMSRYSQHLEK 358

Query: 379 TLHKGS 384
             + G 
Sbjct: 359 RFNTGR 364


>gi|33596742|ref|NP_884385.1| ABC transporter transmembrane protein [Bordetella parapertussis
           12822]
 gi|33600510|ref|NP_888070.1| ABC transporter transmembrane protein [Bordetella bronchiseptica
           RB50]
 gi|33568109|emb|CAE32022.1| Putative ABC transport system, integral membrane protein
           [Bordetella bronchiseptica RB50]
 gi|33573443|emb|CAE37428.1| Putative ABC transport system, integral membrane protein
           [Bordetella parapertussis]
          Length = 384

 Score =  260 bits (663), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 162/386 (41%), Positives = 234/386 (60%), Gaps = 7/386 (1%)

Query: 3   DSCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIH 62
            + K+  +V+ + +Q   PP       AW+ +  F +P+   LT     +L + + G++ 
Sbjct: 4   STTKQPAFVQAQAVQERPPPHQAGTAWAWVRQYVFESPRTFALTLACAAILYWVLRGLLD 63

Query: 63  WVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILV 122
           ++ LDA W G     C           G   ACW FI  +   F+FG YP  QRWR +L 
Sbjct: 64  FLVLDATWSGGAVQACQA-----SIAQGRYGACWPFIDAKLGYFVFGGYPPPQRWRVVLF 118

Query: 123 FLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSF--FVLYGGLGLSIVETSLWGGLLVT 180
           F+  +  +  +L      K + +   F + P  S+   V    LGL  V T LWGG+LVT
Sbjct: 119 FVLAAAGIVWLLARRIRAKRVGAAYFFVVLPPLSYALLVGADALGLPHVSTDLWGGILVT 178

Query: 181 LVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFL 240
           LV+S  GI+ S+P+GI+LALGR S +P +R A    IEL RGVPL+TVLFM + MLPLFL
Sbjct: 179 LVVSLVGIVFSLPIGIVLALGRRSELPFVRLASTVAIELGRGVPLITVLFMFNTMLPLFL 238

Query: 241 PDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMP 300
           P+    D+LLR L+GV+ FASAY+AEV+RGGLQ++ KGQ+E A SLGL Y Q   LI++P
Sbjct: 239 PEGLRPDRLLRPLVGVTLFASAYMAEVVRGGLQALPKGQYEGAQSLGLGYWQTTFLIVLP 298

Query: 301 QVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGF 360
           Q ++ V+PGIVNTFIGLFKD++L++++ + DLL +V V  ++  W + VT  TG  F+ F
Sbjct: 299 QALRIVVPGIVNTFIGLFKDTTLVAMVGILDLLKVVEVAINDPAWATPVTRYTGYAFLAF 358

Query: 361 VFWIFCFSISLYSVFIEKTLHKGSKK 386
            +   C+++S YS  +E+TL +  K+
Sbjct: 359 FYCACCYAMSRYSRSVERTLARSEKR 384


>gi|89110030|ref|AP_003810.1| predicted amino-acid transporter subunit [Escherichia coli str.
           K-12 substr. W3110]
 gi|90111567|ref|NP_417736.2| predicted amino-acid transporter subunit [Escherichia coli str.
           K-12 substr. MG1655]
 gi|170082798|ref|YP_001732118.1| amino-acid ABC transporter membrane protein [Escherichia coli str.
           K-12 substr. DH10B]
 gi|188494363|ref|ZP_03001633.1| amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine
           family [Escherichia coli 53638]
 gi|238902368|ref|YP_002928164.1| putative amino-acid transporter subunit [Escherichia coli BW2952]
 gi|254038436|ref|ZP_04872494.1| inner membrane amino-acid ABC transporter permease yhdY
           [Escherichia sp. 1_1_43]
 gi|256024156|ref|ZP_05438021.1| putative amino-acid transporter subunit [Escherichia sp. 4_1_40B]
 gi|307139958|ref|ZP_07499314.1| putative amino-acid transporter subunit [Escherichia coli H736]
 gi|331643970|ref|ZP_08345101.1| inner membrane amino-acid ABC transporter permease protein YhdY
           [Escherichia coli H736]
 gi|3916018|sp|P45768|YHDY_ECOLI RecName: Full=Inner membrane amino-acid ABC transporter permease
           protein yhdY
 gi|85676061|dbj|BAE77311.1| predicted amino-acid transporter subunit [Escherichia coli str. K12
           substr. W3110]
 gi|87082239|gb|AAC76302.2| predicted amino-acid transporter subunit [Escherichia coli str.
           K-12 substr. MG1655]
 gi|169890633|gb|ACB04340.1| predicted amino-acid transporter subunit; membrane component of ABC
           superfamily [Escherichia coli str. K-12 substr. DH10B]
 gi|188489562|gb|EDU64665.1| amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine
           family [Escherichia coli 53638]
 gi|226840060|gb|EEH72081.1| inner membrane amino-acid ABC transporter permease yhdY
           [Escherichia sp. 1_1_43]
 gi|238862153|gb|ACR64151.1| predicted amino-acid transporter subunit [Escherichia coli BW2952]
 gi|260447704|gb|ACX38126.1| polar amino acid ABC transporter, inner membrane subunit
           [Escherichia coli DH1]
 gi|309703689|emb|CBJ03030.1| ABC transporter, permease protein [Escherichia coli ETEC H10407]
 gi|315137853|dbj|BAJ45012.1| putative amino-acid transporter subunit [Escherichia coli DH1]
 gi|323936246|gb|EGB32538.1| inner membrane transport system [Escherichia coli E1520]
 gi|331037441|gb|EGI09665.1| inner membrane amino-acid ABC transporter permease protein YhdY
           [Escherichia coli H736]
          Length = 367

 Score =  260 bits (663), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 160/369 (43%), Positives = 224/369 (60%), Gaps = 14/369 (3%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
            P          + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS R 
Sbjct: 9   PPRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRA 68

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM   
Sbjct: 69  DCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPMFWK 117

Query: 137 SFPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
             P +         ++P+   + +  G   L  VET  WGGL +TL+I+  GI  ++P G
Sbjct: 118 ILPHRGRYIAAWAVIYPLIVWWLMYGGFFALERVETRQWGGLTLTLIIASVGIAGALPWG 177

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           ILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+G
Sbjct: 178 ILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVG 237

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           V  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I
Sbjct: 238 VILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTII 297

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS +
Sbjct: 298 ALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQY 355

Query: 376 IEKTLHKGS 384
           +EK  + G 
Sbjct: 356 LEKRFNTGR 364


>gi|237730188|ref|ZP_04560669.1| conserved hypothetical protein [Citrobacter sp. 30_2]
 gi|226908794|gb|EEH94712.1| conserved hypothetical protein [Citrobacter sp. 30_2]
          Length = 368

 Score =  259 bits (662), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 160/355 (45%), Positives = 224/355 (63%), Gaps = 14/355 (3%)

Query: 31  WIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDG 90
           W+ KN F +  + LLT L + L+   +P +++WVF  A W+GS R  CT           
Sbjct: 24  WVRKNLFSSWSNSLLTLLCVWLIWSFLPPLLNWVFFQANWVGSTRADCTKA--------- 74

Query: 91  WNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFG 150
              ACW FI++R+ QF++G YP  QRWR  L  + G   + PM   + P +     +   
Sbjct: 75  --GACWVFIHERFGQFMYGLYPHDQRWRVNLALIIGLASIVPMFWKTIPHRGRYIAIWAV 132

Query: 151 LFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVL 209
           ++PI   + +  G  GL  VET  WGGL +TL+I+  GI  ++P GILLALGR S++PV+
Sbjct: 133 IYPIVVWWLMYGGFFGLERVETRQWGGLTLTLIIASVGIAGALPWGILLALGRRSHMPVV 192

Query: 210 RYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLR 269
           R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV  F SAY+AEV+R
Sbjct: 193 RVLSVIFIEFWRGVPLITVLFMSSVMLPLFMSEGTSIDKLIRALVGVILFQSAYVAEVVR 252

Query: 270 GGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINM 329
           GGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I LFKD+SL+ II +
Sbjct: 253 GGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTIIALFKDTSLVIIIGL 312

Query: 330 FDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
           FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  +EK  + G 
Sbjct: 313 FDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQHLEKRFNTGR 365


>gi|332098839|gb|EGJ03796.1| general L-amino acid transport system permease protein aapM
           [Shigella boydii 3594-74]
          Length = 367

 Score =  259 bits (662), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 161/369 (43%), Positives = 225/369 (60%), Gaps = 14/369 (3%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
                       + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS R 
Sbjct: 9   PSRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRA 68

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            CT              ACW FI++R+ QF++G YP  QRWR  LV L G + + PM   
Sbjct: 69  DCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLVLLIGLVSIAPMFWK 117

Query: 137 SFPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
             P +     +   ++P+   + +  G  GL  VET  WGGL +TL+I+  GI  ++P G
Sbjct: 118 ILPHRGRYIAVWAVIYPLIVWWLMYGGFFGLERVETRQWGGLTLTLIIASVGIAGALPWG 177

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           ILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+G
Sbjct: 178 ILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVG 237

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           V  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I
Sbjct: 238 VILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTII 297

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  
Sbjct: 298 ALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQH 355

Query: 376 IEKTLHKGS 384
           +EK  + G 
Sbjct: 356 LEKRFNTGR 364


>gi|332102248|gb|EGJ05594.1| his/Glu/Gln/Arg/opine ABC transporter permease [Shigella sp. D9]
          Length = 368

 Score =  259 bits (662), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 161/369 (43%), Positives = 225/369 (60%), Gaps = 14/369 (3%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
                       + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS R 
Sbjct: 10  PSRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRA 69

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM   
Sbjct: 70  DCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPMFWK 118

Query: 137 SFPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
             P +     +   ++P+   + +  G  GL  VET  WGGL +TL+I+  GI  ++P G
Sbjct: 119 ILPHRGRYIAVWAVIYPLIVWWLMYGGFFGLERVETRQWGGLTLTLIIASVGIAGALPWG 178

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           ILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+G
Sbjct: 179 ILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVG 238

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           V  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I
Sbjct: 239 VILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTII 298

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD+SL+ II +FDL   V+    + TW+     T G +F   ++WIFCFS+S YS  
Sbjct: 299 ALFKDTSLVIIIGLFDLFSSVQQATVDPTWLG--MSTEGYVFAALIYWIFCFSMSRYSQH 356

Query: 376 IEKTLHKGS 384
           +EK  + G 
Sbjct: 357 LEKRFNTGR 365


>gi|324115126|gb|EGC09090.1| inner membrane transport system [Escherichia fergusonii B253]
          Length = 367

 Score =  259 bits (662), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 161/369 (43%), Positives = 225/369 (60%), Gaps = 14/369 (3%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
            P          + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS R 
Sbjct: 9   PPRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRA 68

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM   
Sbjct: 69  DCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIVPMFWK 117

Query: 137 SFPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
             P +     +   ++P+   + +  G LGL  VET  WGGL +TL+I+  GI  ++P G
Sbjct: 118 ILPHRGRYIAVWAVIYPLIVWWLMYGGFLGLERVETRQWGGLTLTLIIASVGIAGALPWG 177

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           ILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+G
Sbjct: 178 ILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVG 237

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           V  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I
Sbjct: 238 VILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTII 297

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  
Sbjct: 298 ALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQH 355

Query: 376 IEKTLHKGS 384
           +E   + G 
Sbjct: 356 LENRFNTGR 364


>gi|193071516|ref|ZP_03052426.1| amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine
           family [Escherichia coli E110019]
 gi|192955153|gb|EDV85646.1| amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine
           family [Escherichia coli E110019]
          Length = 367

 Score =  259 bits (662), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 161/369 (43%), Positives = 225/369 (60%), Gaps = 14/369 (3%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
                       + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS R 
Sbjct: 9   PSRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRA 68

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM   
Sbjct: 69  DCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPMFWK 117

Query: 137 SFPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
             P +     +   ++P+   + +  G  GL  VET  WGGL +TL+I+  GI  ++P G
Sbjct: 118 ILPHRGRYIAVWAVIYPLIVWWLMYGGFFGLERVETRQWGGLTLTLIIASVGIAGALPWG 177

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           ILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+G
Sbjct: 178 ILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVG 237

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           V  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I
Sbjct: 238 VILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTII 297

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD+SL+ II +FDL   V+    + TW+     T G +F   ++WIFCFS+S YS  
Sbjct: 298 ALFKDTSLVIIIGLFDLFSSVQQATVDPTWLG--MSTEGYVFAALLYWIFCFSMSRYSQH 355

Query: 376 IEKTLHKGS 384
           +EK  + G 
Sbjct: 356 LEKRFNTGR 364


>gi|281602646|gb|ADA75630.1| putative transport system permease protein [Shigella flexneri
           2002017]
          Length = 368

 Score =  259 bits (662), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 160/369 (43%), Positives = 223/369 (60%), Gaps = 14/369 (3%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
                       + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS R 
Sbjct: 10  PSRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRA 69

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM   
Sbjct: 70  DCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPMFWK 118

Query: 137 SFPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
             P +         ++P+   + +  G  GL  VET  WGGL +TL+I+  GI  ++P G
Sbjct: 119 ILPHRGRYIAAWAVIYPLIVWWLMYGGFFGLERVETRQWGGLTLTLIIASVGIAGALPWG 178

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           ILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+G
Sbjct: 179 ILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVG 238

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           V  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I
Sbjct: 239 VILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTII 298

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  
Sbjct: 299 ALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQH 356

Query: 376 IEKTLHKGS 384
           +EK  + G 
Sbjct: 357 LEKRFNTGR 365


>gi|301028302|ref|ZP_07191562.1| ABC transporter, permease protein [Escherichia coli MS 196-1]
 gi|299878645|gb|EFI86856.1| ABC transporter, permease protein [Escherichia coli MS 196-1]
          Length = 367

 Score =  259 bits (662), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 159/369 (43%), Positives = 223/369 (60%), Gaps = 14/369 (3%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
            P          + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS R 
Sbjct: 9   PPRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRA 68

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM   
Sbjct: 69  DCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPMFWK 117

Query: 137 SFPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
             P +         ++P+   + +  G   L  VET  WGGL +TL+I+  GI  ++P G
Sbjct: 118 ILPHRGRYIAAWAVIYPLIVWWLMYGGFFALERVETRQWGGLTLTLIIASVGIAGALPWG 177

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           ILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+G
Sbjct: 178 ILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVG 237

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           V  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I
Sbjct: 238 VILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTII 297

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD+SL+ II +FDL   V+    +  W+     T   +F   ++WIFCFS+S YS +
Sbjct: 298 ALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEEYVFAALIYWIFCFSMSRYSQY 355

Query: 376 IEKTLHKGS 384
           +EK  + G 
Sbjct: 356 LEKRFNTGR 364


>gi|320184056|gb|EFW58876.1| Glutamate Aspartate transport system permease protein GltK
           [Shigella flexneri CDC 796-83]
          Length = 367

 Score =  259 bits (661), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 161/369 (43%), Positives = 225/369 (60%), Gaps = 14/369 (3%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
                       + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS R 
Sbjct: 9   PSRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRA 68

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            CT              ACW FI++R+ QF++G YP  QRWR  LV L G + + PM   
Sbjct: 69  DCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLVLLIGLVSIAPMFWK 117

Query: 137 SFPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
             P +     +   ++P+   + +  G  GL  VET  WGGL +TL+I+  GI  ++P G
Sbjct: 118 ILPHRGRYIAVWAVIYPLIVWWLMYGGFFGLERVETRQWGGLTLTLIIASVGIAGALPWG 177

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           ILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+G
Sbjct: 178 ILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVG 237

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           V  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I
Sbjct: 238 VILFQSAYVAEVVRGGLQALPKGQYEAAESLTLGYWKTQGLVILPQALKLVIPGLVNTII 297

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  
Sbjct: 298 ALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQH 355

Query: 376 IEKTLHKGS 384
           +EK  + G 
Sbjct: 356 LEKRFNTGR 364


>gi|170018487|ref|YP_001723441.1| polar amino acid ABC transporter, inner membrane subunit
           [Escherichia coli ATCC 8739]
 gi|194440026|ref|ZP_03072083.1| amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine
           family [Escherichia coli 101-1]
 gi|253771899|ref|YP_003034730.1| polar amino acid ABC transporter inner membrane subunit
           [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|254163205|ref|YP_003046313.1| putative amino-acid transporter subunit [Escherichia coli B str.
           REL606]
 gi|169753415|gb|ACA76114.1| polar amino acid ABC transporter, inner membrane subunit
           [Escherichia coli ATCC 8739]
 gi|194421030|gb|EDX37060.1| amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine
           family [Escherichia coli 101-1]
 gi|242378804|emb|CAQ33596.1| yhdY, subunit of YhdW/YhdX/YhdY/YhdZ ABC transporter [Escherichia
           coli BL21(DE3)]
 gi|253322943|gb|ACT27545.1| polar amino acid ABC transporter, inner membrane subunit
           [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|253975106|gb|ACT40777.1| predicted amino-acid transporter subunit [Escherichia coli B str.
           REL606]
 gi|253979262|gb|ACT44932.1| predicted amino-acid transporter subunit [Escherichia coli
           BL21(DE3)]
 gi|323941637|gb|EGB37816.1| inner membrane transport system [Escherichia coli E482]
 gi|323970315|gb|EGB65585.1| inner membrane transport system [Escherichia coli TA007]
          Length = 367

 Score =  259 bits (661), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 160/369 (43%), Positives = 223/369 (60%), Gaps = 14/369 (3%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
            P          + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS R 
Sbjct: 9   PPRPASHNSNRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRA 68

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM   
Sbjct: 69  DCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPMFWK 117

Query: 137 SFPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
             P +         ++P+   + +  G   L  VET  WGGL +TL+I+  GI  ++P G
Sbjct: 118 ILPHRGRYIAAWAVIYPLIVWWLMYGGFFALERVETRQWGGLTLTLIIASVGIAGALPWG 177

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           ILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+G
Sbjct: 178 ILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVG 237

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           V  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I
Sbjct: 238 VILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTII 297

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  
Sbjct: 298 ALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQH 355

Query: 376 IEKTLHKGS 384
           +EK  + G 
Sbjct: 356 LEKRFNTGR 364


>gi|606211|gb|AAA58074.1| ORF_o368b [Escherichia coli str. K-12 substr. MG1655]
 gi|315617080|gb|EFU97690.1| general L-amino acid transport system permease protein aapM
           [Escherichia coli 3431]
          Length = 368

 Score =  259 bits (661), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 160/369 (43%), Positives = 224/369 (60%), Gaps = 14/369 (3%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
            P          + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS R 
Sbjct: 10  PPRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRA 69

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM   
Sbjct: 70  DCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPMFWK 118

Query: 137 SFPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
             P +         ++P+   + +  G   L  VET  WGGL +TL+I+  GI  ++P G
Sbjct: 119 ILPHRGRYIAAWAVIYPLIVWWLMYGGFFALERVETRQWGGLTLTLIIASVGIAGALPWG 178

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           ILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+G
Sbjct: 179 ILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVG 238

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           V  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I
Sbjct: 239 VILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTII 298

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS +
Sbjct: 299 ALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQY 356

Query: 376 IEKTLHKGS 384
           +EK  + G 
Sbjct: 357 LEKRFNTGR 365


>gi|82545640|ref|YP_409587.1| transport system permease protein [Shigella boydii Sb227]
 gi|81247051|gb|ABB67759.1| putative transport system permease protein [Shigella boydii Sb227]
          Length = 368

 Score =  259 bits (661), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 161/369 (43%), Positives = 225/369 (60%), Gaps = 14/369 (3%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
                       + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS R 
Sbjct: 10  PSRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRA 69

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            CT              ACW FI++R+ QF++G YP  QRWR  LV L G + + PM   
Sbjct: 70  DCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLVLLIGLVSIAPMFWK 118

Query: 137 SFPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
             P +     +   ++P+   + +  G  GL  VET  WGGL +TL+I+  GI  ++P G
Sbjct: 119 ILPHRGRYIAVWAVIYPLIVWWLMYGGFFGLERVETRQWGGLTLTLIIASVGIAGALPWG 178

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           ILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+G
Sbjct: 179 ILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVG 238

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           V  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I
Sbjct: 239 VILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTII 298

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  
Sbjct: 299 ALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQH 356

Query: 376 IEKTLHKGS 384
           +EK  + G 
Sbjct: 357 LEKRFNTGR 365


>gi|283788087|ref|YP_003367952.1| ABC transporter, permease protein [Citrobacter rodentium ICC168]
 gi|282951541|emb|CBG91240.1| ABC transporter, permease protein [Citrobacter rodentium ICC168]
          Length = 368

 Score =  258 bits (660), Expect = 7e-67,   Method: Composition-based stats.
 Identities = 164/355 (46%), Positives = 224/355 (63%), Gaps = 14/355 (3%)

Query: 31  WIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDG 90
           W  KN F +  + LLT L   L+   IP +++W FL A W+GS R  CT           
Sbjct: 24  WARKNLFSSWFNSLLTILCGWLMWELIPPLLNWAFLQANWVGSTRADCTKA--------- 74

Query: 91  WNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFG 150
              ACW FI  R+ QF++G YP  QRWR  L  + G + + PM   + PR+     +   
Sbjct: 75  --GACWVFIQQRFGQFMYGLYPHDQRWRINLALVIGLVSIIPMFWKAIPRRGRYIAVWAV 132

Query: 151 LFPIFSF-FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVL 209
           ++PI ++  +  G  GL  VET  WGGL +TL+I+  GI  ++PLGILLALGR S++P++
Sbjct: 133 IYPIIAWGLLYGGSAGLERVETRQWGGLTLTLIIAAVGIAGALPLGILLALGRRSHMPIV 192

Query: 210 RYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLR 269
           R   +TFIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV  F SAY+AEV+R
Sbjct: 193 RVLSVTFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLVRALVGVILFQSAYVAEVVR 252

Query: 270 GGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINM 329
           GGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I LFKD+SL+ II +
Sbjct: 253 GGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTIIALFKDTSLVIIIGL 312

Query: 330 FDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
           FDL   V+    +  W+     T G +F   V+WIFCFS S YS  +EK  + G 
Sbjct: 313 FDLFSSVQQATVDPAWLG--MSTEGYVFAALVYWIFCFSTSRYSQHLEKRFNTGR 365


>gi|218560339|ref|YP_002393252.1| amino-acid transporter subunit ; membrane component of ABC
           superfamily [Escherichia coli S88]
 gi|218367108|emb|CAR04882.1| amino-acid transporter subunit ; membrane component of ABC
           superfamily [Escherichia coli S88]
 gi|323951210|gb|EGB47085.1| inner membrane transport system [Escherichia coli H252]
          Length = 367

 Score =  258 bits (659), Expect = 9e-67,   Method: Composition-based stats.
 Identities = 163/369 (44%), Positives = 228/369 (61%), Gaps = 14/369 (3%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
            P L        + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS R 
Sbjct: 9   PPRLASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRA 68

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            CT            + ACW FI++R+ QF++G YP  QRWR  L  L G + + PM   
Sbjct: 69  DCTK-----------SGACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPMFWK 117

Query: 137 SFPRKFLNSILLFGLFP-IFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
             P +     +   ++P +  + +  G LGL  VET  WGGL +TL+I+  GI  ++P G
Sbjct: 118 ILPHRSRYIAVWAVIYPLVVWWLMYGGFLGLDRVETRQWGGLTLTLIIASVGIAGALPWG 177

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           ILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+G
Sbjct: 178 ILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVG 237

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           V  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I
Sbjct: 238 VILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTII 297

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  
Sbjct: 298 ALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQH 355

Query: 376 IEKTLHKGS 384
           +EK  + G 
Sbjct: 356 LEKRFNTGR 364


>gi|157148850|ref|YP_001456169.1| hypothetical protein CKO_04683 [Citrobacter koseri ATCC BAA-895]
 gi|157086055|gb|ABV15733.1| hypothetical protein CKO_04683 [Citrobacter koseri ATCC BAA-895]
          Length = 368

 Score =  258 bits (659), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 164/369 (44%), Positives = 226/369 (61%), Gaps = 14/369 (3%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
                      II W+ KN F +  + LLT   + L+   IP +++W FL A W+GS R 
Sbjct: 10  PMRPANNGAGRIILWVRKNLFSSWSNSLLTLFCLWLMWILIPPLLNWAFLQANWVGSTRA 69

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            CT              ACW FI++R+ QF++G YP  QRWR  L  L G   + PM   
Sbjct: 70  DCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLVGLASIVPMFWK 118

Query: 137 SFPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
           + PR+         ++PI   + +  G  GL  VET  WGGL +TL+I+  GI  ++PLG
Sbjct: 119 AMPRRGRYIAAWAVIYPIVVWWLMYGGFFGLERVETRQWGGLTLTLIIASVGIAGALPLG 178

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           ILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+G
Sbjct: 179 ILLALGRRSHMPIVRMLSVIFIEFWRGVPLITVLFMSSVMLPLFMSEGTSIDKLIRALVG 238

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           V  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I
Sbjct: 239 VILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTII 298

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  
Sbjct: 299 ALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQH 356

Query: 376 IEKTLHKGS 384
           +EK  + G 
Sbjct: 357 LEKRFNTGR 365


>gi|168764867|ref|ZP_02789874.1| amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine
           family [Escherichia coli O157:H7 str. EC4501]
 gi|217327153|ref|ZP_03443236.1| amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine
           family [Escherichia coli O157:H7 str. TW14588]
 gi|189365197|gb|EDU83613.1| amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine
           family [Escherichia coli O157:H7 str. EC4501]
 gi|217319520|gb|EEC27945.1| amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine
           family [Escherichia coli O157:H7 str. TW14588]
 gi|326347536|gb|EGD71261.1| Glutamate Aspartate transport system permease protein GltK
           [Escherichia coli O157:H7 str. 1044]
          Length = 367

 Score =  258 bits (659), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 159/369 (43%), Positives = 223/369 (60%), Gaps = 14/369 (3%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
                       + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS R 
Sbjct: 9   PSRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRA 68

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM   
Sbjct: 69  DCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPMFWK 117

Query: 137 SFPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
             P +     +   ++P+   + +  G   L  VET  WGGL +TL+I+  GI  ++P G
Sbjct: 118 ILPHRGRYIAVWVVIYPLIVWWLMYGGFFALERVETRQWGGLTLTLIIASVGIAGALPWG 177

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           ILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+G
Sbjct: 178 ILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVG 237

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           V  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I
Sbjct: 238 VILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTII 297

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  
Sbjct: 298 ALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQH 355

Query: 376 IEKTLHKGS 384
           +EK  + G 
Sbjct: 356 LEKRFNTGR 364


>gi|294084019|ref|YP_003550776.1| amino acid ABC transporter permease [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292663591|gb|ADE38692.1| ABC-type amino acid transport system, permease component
           [Candidatus Puniceispirillum marinum IMCC1322]
          Length = 379

 Score =  258 bits (659), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 164/366 (44%), Positives = 228/366 (62%), Gaps = 8/366 (2%)

Query: 20  LPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCT 79
           LPP  + GI+ W+ KN F TP D +LT + I +L   +PG++ W  +DAVW  S R  C 
Sbjct: 18  LPPRGETGIVLWLRKNLFATPADTVLTLVCIYILYLFVPGLVQWGIIDAVWSASGRVDCW 77

Query: 80  TVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFP 139
              +        +AACWAF+  R +   +G YP    WR  L F+   I L P+L  + P
Sbjct: 78  EQMEEP-----NSAACWAFVSTRLQLLTYGFYPEEYIWRVNLSFVLFLIALVPILWDNTP 132

Query: 140 RKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLA 199
           R+   ++L   LFP  + ++++GGLGL  VET   GG+ +TL+I   GI  S+P+GI+LA
Sbjct: 133 RR-PLALLYSALFPFIATWLVFGGLGLDPVETKKIGGIALTLLIGVTGIAFSLPIGIMLA 191

Query: 200 LGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAF 259
           LGR S +PVL+   + FIE  RGVPL+ +LF+AS ML  FLP     D L+R L+ V+ F
Sbjct: 192 LGRTSKLPVLKMLSVIFIEFIRGVPLIALLFIASTMLNYFLPPGTTFDLLVRVLIMVTFF 251

Query: 260 ASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFK 319
           ASAY+AEV+RGGL  I KGQ EAA + GL+Y +   LI+MPQV+K  IPGIVNTFIGLFK
Sbjct: 252 ASAYMAEVIRGGLAGIPKGQIEAAQASGLTYWKTTYLIVMPQVLKISIPGIVNTFIGLFK 311

Query: 320 DSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKT 379
           D++L+ II MFD+LG+ R + ++  W          IF+   F+I C+ +S YS ++E+ 
Sbjct: 312 DTTLVLIIGMFDVLGMGRSSLADPNWNGLAR--EVYIFVAIFFFICCYGMSYYSAYLERK 369

Query: 380 LHKGSK 385
           L   +K
Sbjct: 370 LDTENK 375


>gi|187732545|ref|YP_001881961.1| amino acid ABC transporter permease, His/Glu/Gln/Arg/opine family
           [Shigella boydii CDC 3083-94]
 gi|187429537|gb|ACD08811.1| amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine
           family [Shigella boydii CDC 3083-94]
          Length = 367

 Score =  258 bits (659), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 159/369 (43%), Positives = 223/369 (60%), Gaps = 14/369 (3%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
                       + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS R 
Sbjct: 9   PSRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRA 68

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM   
Sbjct: 69  DCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPMFWK 117

Query: 137 SFPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
             P +     +   ++P+   + +  G  GL  VET  WGGL +TL+I+  GI  ++P G
Sbjct: 118 ILPHRGRYIAVWAVIYPLIVWWLMYGGFFGLERVETRQWGGLTLTLIIASVGIAGALPWG 177

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           ILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+R L+G
Sbjct: 178 ILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRVLVG 237

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           V  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I
Sbjct: 238 VILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTII 297

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  
Sbjct: 298 ALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQH 355

Query: 376 IEKTLHKGS 384
           +EK  + G 
Sbjct: 356 LEKRFNAGR 364


>gi|293416695|ref|ZP_06659334.1| inner membrane amino-acid ABC transporter permease yhdY
           [Escherichia coli B185]
 gi|331654869|ref|ZP_08355869.1| inner membrane amino-acid ABC transporter permease protein YhdY
           [Escherichia coli M718]
 gi|291432051|gb|EFF05034.1| inner membrane amino-acid ABC transporter permease yhdY
           [Escherichia coli B185]
 gi|331048251|gb|EGI20328.1| inner membrane amino-acid ABC transporter permease protein YhdY
           [Escherichia coli M718]
          Length = 367

 Score =  258 bits (659), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 159/369 (43%), Positives = 222/369 (60%), Gaps = 14/369 (3%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
                       + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS R 
Sbjct: 9   PSRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRA 68

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM   
Sbjct: 69  DCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPMFWK 117

Query: 137 SFPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
             P +         ++P+   + +  G   L  VET  WGGL +TL+I+  GI  ++P G
Sbjct: 118 ILPHRGRYIAAWAVIYPLIVWWLMYGGFFALERVETRQWGGLTLTLIIASVGIAGALPWG 177

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           ILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+G
Sbjct: 178 ILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVG 237

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           V  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I
Sbjct: 238 VILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTII 297

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  
Sbjct: 298 ALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQH 355

Query: 376 IEKTLHKGS 384
           +EK  + G 
Sbjct: 356 LEKRFNTGR 364


>gi|168802618|ref|ZP_02827625.1| amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine
           family [Escherichia coli O157:H7 str. EC508]
 gi|189375435|gb|EDU93851.1| amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine
           family [Escherichia coli O157:H7 str. EC508]
 gi|320189619|gb|EFW64278.1| Glutamate Aspartate transport system permease protein GltK
           [Escherichia coli O157:H7 str. EC1212]
 gi|320639916|gb|EFX09507.1| putative transport system permease protein [Escherichia coli
           O157:H7 str. G5101]
 gi|320645632|gb|EFX14641.1| putative transport system permease protein [Escherichia coli
           O157:H- str. 493-89]
 gi|320650942|gb|EFX19399.1| putative transport system permease protein [Escherichia coli
           O157:H- str. H 2687]
 gi|320662013|gb|EFX29421.1| putative transport system permease protein [Escherichia coli O55:H7
           str. USDA 5905]
 gi|320666849|gb|EFX33828.1| putative transport system permease protein [Escherichia coli
           O157:H7 str. LSU-61]
 gi|326337967|gb|EGD61801.1| Glutamate Aspartate transport system permease protein GltK
           [Escherichia coli O157:H7 str. 1125]
          Length = 367

 Score =  258 bits (659), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 159/369 (43%), Positives = 223/369 (60%), Gaps = 14/369 (3%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
                       + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS R 
Sbjct: 9   PSRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRA 68

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM   
Sbjct: 69  DCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPMFWK 117

Query: 137 SFPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
             P +     +   ++P+   + +  G   L  VET  WGGL +TL+I+  GI  ++P G
Sbjct: 118 ILPHRGRYIAVWAVIYPLIVWWLMYGGFFALERVETRQWGGLTLTLIIASVGIAGALPWG 177

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           ILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+G
Sbjct: 178 ILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVG 237

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           V  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I
Sbjct: 238 VILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTII 297

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  
Sbjct: 298 ALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQH 355

Query: 376 IEKTLHKGS 384
           +EK  + G 
Sbjct: 356 LEKRFNTGR 364


>gi|326797353|ref|YP_004315173.1| polar amino acid ABC transporter inner membrane subunit
           [Marinomonas mediterranea MMB-1]
 gi|326548117|gb|ADZ93337.1| polar amino acid ABC transporter, inner membrane subunit
           [Marinomonas mediterranea MMB-1]
          Length = 366

 Score =  258 bits (658), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 163/361 (45%), Positives = 235/361 (65%), Gaps = 13/361 (3%)

Query: 26  RGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGG 85
            G +AW+  NFF +P +I LT   + +L   IP ++ W FLDA W GS++  CT      
Sbjct: 18  VGPVAWVRANFFSSPLNIALTLFSVYVLYLMIPPVLQWGFLDATWEGSSKAACTA----- 72

Query: 86  IQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNS 145
                   ACWAFI   +EQF++G YP  + WR  L  +   +L+    I +  + FL+ 
Sbjct: 73  ------GGACWAFIGAYFEQFMYGLYPETEYWRINLALILLIVLVGMFAIKAVNKLFLSI 126

Query: 146 ILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSN 205
            ++     +       G  GL  VETS WGGL +T ++   GI+ S PLG+LLALGR SN
Sbjct: 127 AIIVVYPIVAFILFSGGMFGLETVETSNWGGLFLTTLLGVVGIVASFPLGVLLALGRRSN 186

Query: 206 IPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIA 265
           +P+++  C+ FIE  R VPL+T+LFMAS+M+PLFLP+  + +KLLR L+G++ F++AY+A
Sbjct: 187 MPIVKSVCVVFIETIRAVPLITILFMASVMIPLFLPEGLNFNKLLRVLIGITLFSAAYMA 246

Query: 266 EVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLIS 325
           EV+RGGLQ+I KGQ+EAA+++GL+Y Q M L+I+PQ +K VIPGIVNTFIGLFKD++L+ 
Sbjct: 247 EVIRGGLQAIPKGQYEAADAMGLTYWQSMCLVILPQALKLVIPGIVNTFIGLFKDTTLVY 306

Query: 326 IINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSK 385
           I+ MFDLLG ++    ++ W+ +     G  F GFV+WI CF +S YS+ +E+ L  G K
Sbjct: 307 IVGMFDLLGRIQAANHDANWLGTT--IEGYAFAGFVYWIICFGMSRYSMAVERKLDTGHK 364

Query: 386 K 386
           +
Sbjct: 365 R 365


>gi|327479740|gb|AEA83050.1| polar amino acid ABC transporter, inner membrane subunit
           [Pseudomonas stutzeri DSM 4166]
          Length = 365

 Score =  258 bits (658), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 161/375 (42%), Positives = 226/375 (60%), Gaps = 14/375 (3%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
                   PP    G + W+  N F +  + LLT + + LL   +P ++ W    A W G
Sbjct: 4   HSFKPDLPPPTISIGALGWLRANLFSSWINTLLTLVGLYLLWLIVPPVLEWAIFKADWTG 63

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
             R  C+              ACW F+  R+ QF++G YP   RWR         I   P
Sbjct: 64  DTRADCS-----------REGACWVFVQVRFGQFMYGFYPTELRWRVDAAAWLAIIGAAP 112

Query: 133 MLIPSFPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIIS 191
           + +   P K    I    ++P+   + +  G LGL  V TS WGGL++T+VI+  GI  +
Sbjct: 113 LFLRQMPHKLRYGIGYLLVYPLLAYWLLHGGFLGLQTVPTSQWGGLMLTVVIAAVGIAGA 172

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +PLGILLALGR S++P +R  C+TFIE +RGVPL+TVLFM+S+MLPLFLP+  ++DKLLR
Sbjct: 173 LPLGILLALGRRSDMPAIRVLCVTFIEFWRGVPLITVLFMSSVMLPLFLPEGMNLDKLLR 232

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
           A+L V  F +AYIAEV+RGGLQ+I KGQ+EAA ++GL Y +   L+I+PQ +K VIPGIV
Sbjct: 233 AMLMVVFFEAAYIAEVVRGGLQAIPKGQYEAAAAMGLGYWRSTLLVILPQALKLVIPGIV 292

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISL 371
           NTFI LFKD+SL+ II +FD L  ++   ++  W+     T G +F   V+W+FCF +S 
Sbjct: 293 NTFIALFKDTSLVIIIGLFDFLNSIKRATADPAWLG--MSTEGYVFAALVYWMFCFGMSR 350

Query: 372 YSVFIEKTLHKGSKK 386
           YS+ +E+ L  G K+
Sbjct: 351 YSMRLERKLDTGHKR 365


>gi|291086480|ref|ZP_06355922.2| general amino acid ABC transporter, permease protein [Citrobacter
           youngae ATCC 29220]
 gi|291067532|gb|EFE05641.1| general amino acid ABC transporter, permease protein [Citrobacter
           youngae ATCC 29220]
          Length = 368

 Score =  258 bits (658), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 158/355 (44%), Positives = 225/355 (63%), Gaps = 14/355 (3%)

Query: 31  WIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDG 90
           W+ KN F +  + LLT L + L+   +P +++WVF  A W+GS R  CT           
Sbjct: 24  WVRKNLFSSWSNSLLTLLCVWLIWSFLPPLLNWVFFQANWVGSTRADCTKA--------- 74

Query: 91  WNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFG 150
              ACW FI++R+ QF++G YP  QRWR  +  + G + + PM   + P +     +   
Sbjct: 75  --GACWVFIHERFGQFMYGLYPHDQRWRINMALIIGLLSIVPMFCKTLPHRGRYIAVWAV 132

Query: 151 LFP-IFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVL 209
           ++P +  + +  G  GL  VET  WGGL +TL+I+  GI  ++P GILLALGR S++PV+
Sbjct: 133 VYPLVVWWLMYGGFFGLERVETRQWGGLTLTLIIASVGIAGALPWGILLALGRRSHMPVV 192

Query: 210 RYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLR 269
           R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV  F SAY+AEV+R
Sbjct: 193 RILSVIFIEFWRGVPLITVLFMSSVMLPLFMSEGTSIDKLIRALVGVILFQSAYVAEVVR 252

Query: 270 GGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINM 329
           GGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I LFKD+SL+ II +
Sbjct: 253 GGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTIIALFKDTSLVIIIGL 312

Query: 330 FDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
           FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  +EK  + G 
Sbjct: 313 FDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQHLEKRFNTGR 365


>gi|15803805|ref|NP_289839.1| putative transport system permease protein [Escherichia coli
           O157:H7 EDL933]
 gi|15833397|ref|NP_312170.1| transport system permease protein [Escherichia coli O157:H7 str.
           Sakai]
 gi|12517901|gb|AAG58399.1|AE005554_10 putative transport system permease protein [Escherichia coli
           O157:H7 str. EDL933]
 gi|13363616|dbj|BAB37566.1| putative transport system permease protein [Escherichia coli
           O157:H7 str. Sakai]
          Length = 368

 Score =  258 bits (658), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 159/369 (43%), Positives = 223/369 (60%), Gaps = 14/369 (3%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
                       + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS R 
Sbjct: 10  PSRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRA 69

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM   
Sbjct: 70  DCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPMFWK 118

Query: 137 SFPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
             P +     +   ++P+   + +  G   L  VET  WGGL +TL+I+  GI  ++P G
Sbjct: 119 ILPHRGRYIAVWVVIYPLIVWWLMYGGFFALERVETRQWGGLTLTLIIASVGIAGALPWG 178

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           ILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+G
Sbjct: 179 ILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVG 238

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           V  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I
Sbjct: 239 VILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTII 298

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  
Sbjct: 299 ALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQH 356

Query: 376 IEKTLHKGS 384
           +EK  + G 
Sbjct: 357 LEKRFNTGR 365


>gi|117625559|ref|YP_858882.1| putative transport system permease protein [Escherichia coli APEC
           O1]
 gi|115514683|gb|ABJ02758.1| putative transport system permease protein [Escherichia coli APEC
           O1]
          Length = 368

 Score =  258 bits (658), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 163/369 (44%), Positives = 228/369 (61%), Gaps = 14/369 (3%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
            P L        + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS R 
Sbjct: 10  PPRLASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRA 69

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            CT            + ACW FI++R+ QF++G YP  QRWR  L  L G + + PM   
Sbjct: 70  DCTK-----------SGACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPMFWK 118

Query: 137 SFPRKFLNSILLFGLFP-IFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
             P +     +   ++P +  + +  G LGL  VET  WGGL +TL+I+  GI  ++P G
Sbjct: 119 ILPHRSRYIAVWAVIYPLVVWWLMYGGFLGLDRVETRQWGGLTLTLIIASVGIAGALPWG 178

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           ILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+G
Sbjct: 179 ILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVG 238

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           V  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I
Sbjct: 239 VILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTII 298

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  
Sbjct: 299 ALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQH 356

Query: 376 IEKTLHKGS 384
           +EK  + G 
Sbjct: 357 LEKRFNTGR 365


>gi|260870021|ref|YP_003236423.1| putative transport system permease protein [Escherichia coli
           O111:H- str. 11128]
 gi|257766377|dbj|BAI37872.1| putative transport system permease protein [Escherichia coli
           O111:H- str. 11128]
          Length = 367

 Score =  257 bits (657), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 160/369 (43%), Positives = 224/369 (60%), Gaps = 14/369 (3%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
                       + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS R 
Sbjct: 9   PSRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRA 68

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            CT              ACW FI++R+ QF++G YP  QR R  L  L G + + PM   
Sbjct: 69  DCTKA-----------GACWVFIHERFGQFMYGLYPHDQRRRINLALLIGLVSIAPMFWK 117

Query: 137 SFPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
             P +     +   ++P+   + +  G  GL  VET  WGGL +TL+I+  GI  ++P G
Sbjct: 118 ILPHRGRYIAVWAVIYPLIVWWLMYGGFFGLERVETRQWGGLTLTLIIASVGIAGALPWG 177

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           ILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+G
Sbjct: 178 ILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVG 237

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           V  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I
Sbjct: 238 VILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTII 297

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD+SL+ II +FDL   V+    + TW+     T G +F   ++WIFCFS+S YS  
Sbjct: 298 ALFKDTSLVIIIGLFDLFSSVQQATVDPTWLG--MSTEGYVFAALIYWIFCFSMSRYSQH 355

Query: 376 IEKTLHKGS 384
           +EK  + G 
Sbjct: 356 LEKRFNTGR 364


>gi|320656323|gb|EFX24235.1| putative transport system permease protein [Escherichia coli O55:H7
           str. 3256-97 TW 07815]
          Length = 367

 Score =  257 bits (657), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 160/369 (43%), Positives = 223/369 (60%), Gaps = 14/369 (3%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
                       + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS R 
Sbjct: 9   PSRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRA 68

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM   
Sbjct: 69  DCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPMFWK 117

Query: 137 SFPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
             P +     +   ++P+   + +  G   L  VET  WGGL +TL+I+  GI  ++P G
Sbjct: 118 ILPHRGRYIAVWAVIYPLIVWWLMYGGFFALERVETRQWGGLTLTLIIASVGIAGALPWG 177

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           ILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+G
Sbjct: 178 ILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVG 237

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           V  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I
Sbjct: 238 VILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTII 297

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD+SL+ II +FDL   V+    E  W+     T G +F   ++WIFCFS+S YS  
Sbjct: 298 ALFKDTSLVIIIGLFDLFSSVQQATVEPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQH 355

Query: 376 IEKTLHKGS 384
           +EK  + G 
Sbjct: 356 LEKRFNTGR 364


>gi|320177113|gb|EFW52129.1| Glutamate Aspartate transport system permease protein GltK
           [Shigella dysenteriae CDC 74-1112]
          Length = 367

 Score =  257 bits (657), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 161/369 (43%), Positives = 225/369 (60%), Gaps = 14/369 (3%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
                       + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS R 
Sbjct: 9   PSRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRA 68

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM   
Sbjct: 69  DCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPMFWK 117

Query: 137 SFPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
             P +     +   ++P+   + +  G  GL  VET  WGGL +TL+I+  GI  ++P G
Sbjct: 118 ILPHRGRYIAVWAVIYPLIVWWLMYGGFFGLERVETRQWGGLTLTLIIASVGIAGALPWG 177

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           ILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+G
Sbjct: 178 ILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVG 237

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           V  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQV+K VIPG+VNT I
Sbjct: 238 VILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQVLKLVIPGLVNTII 297

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  
Sbjct: 298 ALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQH 355

Query: 376 IEKTLHKGS 384
           +EK  + G 
Sbjct: 356 LEKRFNAGR 364


>gi|294492998|gb|ADE91754.1| amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine
           family [Escherichia coli IHE3034]
 gi|307625129|gb|ADN69433.1| putative transport system permease protein [Escherichia coli UM146]
 gi|323957582|gb|EGB53296.1| inner membrane transport system [Escherichia coli H263]
          Length = 367

 Score =  257 bits (657), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 164/369 (44%), Positives = 229/369 (62%), Gaps = 14/369 (3%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
            P L        + W+ KN F +  + LLT   I L+   IP +++WVFL A W+GS R 
Sbjct: 9   PPRLASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWVFLQANWVGSTRA 68

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            CT            + ACW FI++R+ QF++G YP  QRWR  L  L G + + PM   
Sbjct: 69  DCTK-----------SGACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPMFWK 117

Query: 137 SFPRKFLNSILLFGLFP-IFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
             P +     +   ++P +  + +  G LGL  VET  WGGL +TL+I+  GI  ++P G
Sbjct: 118 ILPHRSRYIAVWAVIYPLVVWWLMYGGFLGLDRVETRQWGGLTLTLIIASVGIAGALPWG 177

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           ILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+G
Sbjct: 178 ILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVG 237

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           V  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I
Sbjct: 238 VILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTII 297

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  
Sbjct: 298 ALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQH 355

Query: 376 IEKTLHKGS 384
           +EK  + G 
Sbjct: 356 LEKRFNTGR 364


>gi|304396997|ref|ZP_07378877.1| polar amino acid ABC transporter, inner membrane subunit [Pantoea
           sp. aB]
 gi|304355793|gb|EFM20160.1| polar amino acid ABC transporter, inner membrane subunit [Pantoea
           sp. aB]
          Length = 366

 Score =  257 bits (656), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 166/368 (45%), Positives = 226/368 (61%), Gaps = 17/368 (4%)

Query: 21  PPVYQRGI---IAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTV 77
           PPV    +     W  KN F +  + LLT   I ++   IP  ++W+   A WIG+ R  
Sbjct: 9   PPVPTTPVSRAWLWARKNLFSSWFNTLLTLFCIWVIWHVIPPALNWLVFQANWIGTTRAD 68

Query: 78  CTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPS 137
           CT              ACW FI+ R+ QF++G YP   RWR  L  + G + + PM + S
Sbjct: 69  CTKE-----------GACWVFIHARFGQFMYGLYPHELRWRINLALVIGLVSIVPMFLKS 117

Query: 138 FPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGI 196
            P +         ++P+   F +  G LGL  VET  WGGL +TL+I+  GI  ++PLGI
Sbjct: 118 LPYRGRYIAAWAVIYPVIVWFLLYGGYLGLERVETRQWGGLTLTLIIASVGIAGALPLGI 177

Query: 197 LLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGV 256
           LLALGR S +PV+R   I FIE +RGVPL+TVLFM+S+MLPLF+ +  ++DKL+RAL+GV
Sbjct: 178 LLALGRRSRMPVVRTLSIIFIEFWRGVPLITVLFMSSVMLPLFMSEGTNIDKLVRALVGV 237

Query: 257 SAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIG 316
             F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K  IPG+VNT I 
Sbjct: 238 ILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQMLVILPQALKLTIPGLVNTIIA 297

Query: 317 LFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFI 376
           LFKD+SL+ II +FDL   V+    + TW+     T G +F   V+WIFCFS+S YS ++
Sbjct: 298 LFKDTSLVIIIGLFDLFSSVQQATVDPTWLG--MSTEGYVFAALVYWIFCFSMSRYSQYL 355

Query: 377 EKTLHKGS 384
           EK  H G 
Sbjct: 356 EKRFHTGR 363


>gi|82778576|ref|YP_404925.1| putative transport system permease protein [Shigella dysenteriae
           Sd197]
 gi|309785601|ref|ZP_07680232.1| general L-amino acid transport system permease protein aapM
           [Shigella dysenteriae 1617]
 gi|81242724|gb|ABB63434.1| putative transport system permease protein [Shigella dysenteriae
           Sd197]
 gi|308926721|gb|EFP72197.1| general L-amino acid transport system permease protein aapM
           [Shigella dysenteriae 1617]
          Length = 368

 Score =  256 bits (655), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 160/369 (43%), Positives = 223/369 (60%), Gaps = 14/369 (3%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
                       + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS R 
Sbjct: 10  PSRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRA 69

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM   
Sbjct: 70  DCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPMFWK 118

Query: 137 SFPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
             P +     L   ++P+   + +  G   L  VET  WGGL +TL+I+  GI  ++P G
Sbjct: 119 ILPHRGRYIALWAVIYPLIVWWLMYGGFFALDRVETRQWGGLTLTLIIASVGIAGALPWG 178

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           ILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+G
Sbjct: 179 ILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVG 238

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           V  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I
Sbjct: 239 VILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTII 298

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  
Sbjct: 299 ALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQH 356

Query: 376 IEKTLHKGS 384
           +EK  + G 
Sbjct: 357 LEKRFNTGR 365


>gi|91212701|ref|YP_542687.1| putative transport system permease [Escherichia coli UTI89]
 gi|237705971|ref|ZP_04536452.1| amino acid ABC transporter permease [Escherichia sp. 3_2_53FAA]
 gi|91074275|gb|ABE09156.1| putative transport system permease protein [Escherichia coli UTI89]
 gi|226899011|gb|EEH85270.1| amino acid ABC transporter permease [Escherichia sp. 3_2_53FAA]
          Length = 368

 Score =  256 bits (655), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 164/369 (44%), Positives = 229/369 (62%), Gaps = 14/369 (3%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
            P L        + W+ KN F +  + LLT   I L+   IP +++WVFL A W+GS R 
Sbjct: 10  PPRLASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWVFLQANWVGSTRA 69

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            CT            + ACW FI++R+ QF++G YP  QRWR  L  L G + + PM   
Sbjct: 70  DCTK-----------SGACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPMFWK 118

Query: 137 SFPRKFLNSILLFGLFP-IFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
             P +     +   ++P +  + +  G LGL  VET  WGGL +TL+I+  GI  ++P G
Sbjct: 119 ILPHRSRYIAVWAVIYPLVVWWLMYGGFLGLDRVETRQWGGLTLTLIIASVGIAGALPWG 178

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           ILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+G
Sbjct: 179 ILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVG 238

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           V  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I
Sbjct: 239 VILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTII 298

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  
Sbjct: 299 ALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQH 356

Query: 376 IEKTLHKGS 384
           +EK  + G 
Sbjct: 357 LEKRFNTGR 365


>gi|218691564|ref|YP_002399776.1| amino-acid ABC transporter membrane protein [Escherichia coli ED1a]
 gi|218429128|emb|CAR10071.2| amino-acid transporter subunit ; membrane component of ABC
           superfamily [Escherichia coli ED1a]
          Length = 367

 Score =  256 bits (654), Expect = 4e-66,   Method: Composition-based stats.
 Identities = 163/369 (44%), Positives = 226/369 (61%), Gaps = 14/369 (3%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
            P          + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS R 
Sbjct: 9   PPRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRA 68

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            CT              ACW FI++R+ QFI+G YP  QRWR  L  L G + + PM   
Sbjct: 69  DCTKA-----------GACWVFIHERFGQFIYGLYPHDQRWRINLALLIGLVSIAPMFWK 117

Query: 137 SFPRKFLNSILLFGLFP-IFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
             P +     +   ++P +  + +  G LGL  VET  WGGL +TL+I+  GI  ++P G
Sbjct: 118 ILPHRGRYIAVWAVIYPLVVWWLMYGGFLGLDRVETRQWGGLTLTLIIASVGIAGALPWG 177

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           ILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+G
Sbjct: 178 ILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVG 237

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           V  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I
Sbjct: 238 VILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTII 297

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  
Sbjct: 298 ALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQH 355

Query: 376 IEKTLHKGS 384
           +EK  + G 
Sbjct: 356 LEKCFNTGR 364


>gi|146313343|ref|YP_001178417.1| polar amino acid ABC transporter, inner membrane subunit
           [Enterobacter sp. 638]
 gi|145320219|gb|ABP62366.1| amino acid ABC transporter membrane protein 2, PAAT family
           [Enterobacter sp. 638]
          Length = 367

 Score =  256 bits (653), Expect = 5e-66,   Method: Composition-based stats.
 Identities = 167/368 (45%), Positives = 229/368 (62%), Gaps = 16/368 (4%)

Query: 20  LPPVYQRG--IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTV 77
             P   RG   IAW  KN F +  + LLT +   L+   IP +I+W FL A W+GS R  
Sbjct: 10  PRPSSARGWRFIAWARKNLFSSWSNSLLTIICFWLMWELIPPLINWAFLQANWVGSTRAD 69

Query: 78  CTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPS 137
           CT              ACW FI++R+ QF++G YP  QRWR  +  + G + + PM    
Sbjct: 70  CTKA-----------GACWVFIHERFGQFMYGLYPHEQRWRINVALIVGLLSIAPMFWKH 118

Query: 138 FPRKFLNSILLFGLFPIFSFFVLYGGLGL-SIVETSLWGGLLVTLVISFFGIIISMPLGI 196
            PR+         ++P+  + +LYGG+     VET  WGGL +TL+I+  GI  ++PLGI
Sbjct: 119 LPRRGRYIACWAVVYPLVVWLLLYGGVLGLERVETRQWGGLTLTLIIASVGIAGALPLGI 178

Query: 197 LLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGV 256
           LLALGR S +PV+R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV
Sbjct: 179 LLALGRRSTMPVVRVLSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTTIDKLIRALVGV 238

Query: 257 SAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIG 316
             F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I 
Sbjct: 239 ILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTIIA 298

Query: 317 LFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFI 376
           LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  +
Sbjct: 299 LFKDTSLVIIIGLFDLFSSVQQATVDPVWLG--MSTEGYVFAALIYWIFCFSMSRYSQHL 356

Query: 377 EKTLHKGS 384
           EK  + G 
Sbjct: 357 EKRFNTGR 364


>gi|330429590|gb|AEC20924.1| putative amino acid ABC transporter permease protein [Pusillimonas
           sp. T7-7]
          Length = 365

 Score =  256 bits (653), Expect = 6e-66,   Method: Composition-based stats.
 Identities = 157/374 (41%), Positives = 235/374 (62%), Gaps = 13/374 (3%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
              +Q   PP   +G++ W+  + F +P + LLT L+  LLL ++P +I W+F+ A +  
Sbjct: 5   TATVQSLPPPRAHQGVLGWLRASLFSSPLNTLLTVLVAWLLLMAVPALIDWLFISANFNA 64

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
            N   C               ACWAFI +++   +FG YP  ++WRP+L  +    ++  
Sbjct: 65  QNAQECRQSG----------GACWAFIAEKHRLILFGVYPYDEQWRPLLASIILIAVIVC 114

Query: 133 MLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISM 192
             I  F + FL  I +  L  +    +  G  GLS VE S WGGL +TL+++ FGI ++ 
Sbjct: 115 SCIRWFWKPFLGVIWIVAL-VVVGILMWGGVFGLSHVENSRWGGLPLTLILATFGIAVAF 173

Query: 193 PLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRA 252
           P G+LLALGR S++P ++  C+ +IEL RGVPL+++LFM+S+MLPLFLP+ + +DKLLRA
Sbjct: 174 PFGLLLALGRRSHMPAVKALCVVYIELIRGVPLISLLFMSSVMLPLFLPEGFSIDKLLRA 233

Query: 253 LLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVN 312
            + +  FA+AY+AE +RGGLQ+I KGQ+E A+S+GLSY Q+MR II+PQ +K VIP +V 
Sbjct: 234 QIAIILFAAAYVAETVRGGLQAIPKGQYEGADSIGLSYWQQMRKIILPQALKVVIPPLVG 293

Query: 313 TFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLY 372
            FI LFKD+SL+ II +FDL    +   +++ W      T   +FI F+++IFC+SIS Y
Sbjct: 294 IFISLFKDTSLVVIIGIFDLTQAAKTAVADAAWRG--FSTEAYLFIAFIYFIFCYSISRY 351

Query: 373 SVFIEKTLHKGSKK 386
           S  +EK L  G ++
Sbjct: 352 SQSLEKHLQTGYQR 365


>gi|308188313|ref|YP_003932444.1| Inner membrane amino-acid ABC transporter permease protein yhdY
           [Pantoea vagans C9-1]
 gi|308058823|gb|ADO10995.1| Inner membrane amino-acid ABC transporter permease protein yhdY
           [Pantoea vagans C9-1]
          Length = 366

 Score =  255 bits (652), Expect = 6e-66,   Method: Composition-based stats.
 Identities = 166/368 (45%), Positives = 225/368 (61%), Gaps = 17/368 (4%)

Query: 21  PPVYQRGI---IAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTV 77
           PPV    +     W  KN F +  + LLT   I ++   IP  ++W+   A WIG+ R  
Sbjct: 9   PPVPTTPVSRAWLWARKNLFSSWFNTLLTLFCIWVIWHVIPPALNWLVFQANWIGTTRAD 68

Query: 78  CTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPS 137
           CT              ACW FI+ R+ QF++G YP   RWR  L  + G + + PM + S
Sbjct: 69  CTKE-----------GACWVFIHARFGQFMYGLYPHELRWRINLALVIGLLSIVPMFLKS 117

Query: 138 FPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGI 196
            P +         ++P+   F +  G LGL  VET  WGGL +TL+I+  GI  ++PLGI
Sbjct: 118 LPYRGRYIAAWAVIYPVIVWFLLYGGYLGLERVETRQWGGLTLTLIIASVGIAGALPLGI 177

Query: 197 LLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGV 256
           LLALGR S +PV+R   I FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV
Sbjct: 178 LLALGRRSRMPVVRTLSIIFIEFWRGVPLITVLFMSSVMLPLFMSEGTTIDKLVRALVGV 237

Query: 257 SAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIG 316
             F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K  IPG+VNT I 
Sbjct: 238 ILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQMLVILPQALKLTIPGLVNTIIA 297

Query: 317 LFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFI 376
           LFKD+SL+ II +FDL   V+    + TW+     T G +F   V+WIFCFS+S YS ++
Sbjct: 298 LFKDTSLVIIIGLFDLFSSVQQATVDPTWLG--MSTEGYVFAALVYWIFCFSMSRYSQYL 355

Query: 377 EKTLHKGS 384
           EK  H G 
Sbjct: 356 EKRFHTGR 363


>gi|271498818|ref|YP_003331843.1| polar amino acid ABC transporter inner membrane subunit [Dickeya
           dadantii Ech586]
 gi|270342373|gb|ACZ75138.1| polar amino acid ABC transporter, inner membrane subunit [Dickeya
           dadantii Ech586]
          Length = 362

 Score =  255 bits (652), Expect = 7e-66,   Method: Composition-based stats.
 Identities = 162/374 (43%), Positives = 229/374 (61%), Gaps = 16/374 (4%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
                 +  P+     I W  +N F    + +LT + + LL   IP +++W    A W+G
Sbjct: 2   TTHTPSNPTPISN--AIVWARRNLFSNVTNSVLTLVCLWLLWTLIPPLLNWAIFKANWVG 59

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
           S R  CT+           + ACW F++ R+EQF++G YP  + WR     +   I + P
Sbjct: 60  STRADCTS-----------DGACWVFVHARFEQFMYGLYPREELWRINFALVLALISILP 108

Query: 133 MLIPSFPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIIS 191
           M   + PR+     +   ++P+   + +  G  GLS VET  WGGL +T++I+  GI  +
Sbjct: 109 MFWRNLPRRGRYIAIWCVVYPLLAWWLLFGGFGGLSRVETRQWGGLTLTIIIAAIGIAGA 168

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +PLGILLALGR SN+PVLR  C+ FIE +RGVPL+TVLFM+S+MLPLFL +  ++DKLLR
Sbjct: 169 LPLGILLALGRRSNMPVLRALCVIFIEFWRGVPLITVLFMSSVMLPLFLTEGTNIDKLLR 228

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
           AL+GV  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+V
Sbjct: 229 ALVGVILFQSAYVAEVVRGGLQALPKGQYEAAQSLALGYWRMQGLVILPQALKMVIPGLV 288

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISL 371
           NT I LFKD+SL+ II +FDL   ++    +  W+     T G +F   ++WIFCFS+S 
Sbjct: 289 NTIIALFKDTSLVIIIGLFDLFSSIQQATVDPAWLG--MSTEGYVFAAIIYWIFCFSMSR 346

Query: 372 YSVFIEKTLHKGSK 385
           YS  +EK    G K
Sbjct: 347 YSQHLEKRFDTGHK 360


>gi|291619133|ref|YP_003521875.1| YhdY [Pantoea ananatis LMG 20103]
 gi|291154163|gb|ADD78747.1| YhdY [Pantoea ananatis LMG 20103]
          Length = 366

 Score =  255 bits (652), Expect = 7e-66,   Method: Composition-based stats.
 Identities = 163/359 (45%), Positives = 217/359 (60%), Gaps = 14/359 (3%)

Query: 28  IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQ 87
              W  KN F    +  LT L I L+   IP  ++W+  DA W G+ R  CT        
Sbjct: 19  AWLWARKNLFSGWFNTCLTLLCIWLIWHVIPPALNWLIFDANWFGTTRADCTKE------ 72

Query: 88  PDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSIL 147
                 ACW FI+ R+ QF++G YP   RWR  L  + G   + PM I   P +      
Sbjct: 73  -----GACWVFIHARFGQFMYGLYPHELRWRINLALVIGLASIVPMFIKRLPYRGRYIAA 127

Query: 148 LFGLFP-IFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNI 206
               +P +  F +  G LGL  VET  WGGL +TL+I+  GI  ++PLGILLALGR S +
Sbjct: 128 WAVCYPLVVWFLLYGGFLGLDRVETRQWGGLTLTLIIASVGIAGALPLGILLALGRRSRM 187

Query: 207 PVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAE 266
           PV+R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV  F SAY+AE
Sbjct: 188 PVVRTLSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTTIDKLVRALVGVILFQSAYVAE 247

Query: 267 VLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISI 326
           V+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K  IPG+VNT I LFKD+SL+ I
Sbjct: 248 VVRGGLQALPKGQYEAAESLALGYWKTQMLVILPQALKLTIPGLVNTIIALFKDTSLVII 307

Query: 327 INMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSK 385
           I +FDL   V+    +  W+     T G +F   V+WIFCFS+S YS ++EK  H G K
Sbjct: 308 IGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALVYWIFCFSMSRYSQYLEKRFHTGRK 364


>gi|261314497|ref|ZP_05953694.1| polar amino acid ABC transporter [Brucella pinnipedialis
           M163/99/10]
 gi|261303523|gb|EEY07020.1| polar amino acid ABC transporter [Brucella pinnipedialis
           M163/99/10]
          Length = 357

 Score =  255 bits (652), Expect = 8e-66,   Method: Composition-based stats.
 Identities = 207/343 (60%), Positives = 267/343 (77%), Gaps = 1/343 (0%)

Query: 45  LTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYE 104
           +T   + L+++ +P II W+F++A W G++RT C T +QGG QPDGW+ ACWAF+  +YE
Sbjct: 15  VTIFGLVLVVWFVPPIIEWLFINAAWTGTSRTACLTAAQGGAQPDGWSGACWAFVNAKYE 74

Query: 105 QFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIF-SFFVLYGG 163
           QF++G YP+++RWR  L  L  + LL P+LIP  P+K LN+IL F +FP+   F ++ G 
Sbjct: 75  QFLYGRYPISERWRVDLTALIFAALLVPLLIPKIPKKGLNAILFFLVFPVVAFFLLVGGW 134

Query: 164 LGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGV 223
            GL  VET LWGGLLVTLV+SF GI +S+PLGI+LALGR S +PV++   I FIE+ RGV
Sbjct: 135 FGLPYVETPLWGGLLVTLVLSFVGIAVSLPLGIVLALGRRSKLPVIKTLSIIFIEMVRGV 194

Query: 224 PLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAA 283
           PLVTVLFMAS+MLPLFLP     DKLLRAL+GV+ FASAY+AEV+RGGLQ+I +GQ+E A
Sbjct: 195 PLVTVLFMASVMLPLFLPPGVTFDKLLRALIGVALFASAYMAEVVRGGLQAIPRGQYEGA 254

Query: 284 NSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSES 343
           ++LGLSY QK  L+++PQ +K VIPGIVNTFIGLFKD+SL+ II MFDLLGIVR NFS++
Sbjct: 255 DALGLSYWQKTGLVVLPQALKLVIPGIVNTFIGLFKDTSLVYIIGMFDLLGIVRQNFSDA 314

Query: 344 TWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
            W S  TP TGLIF GFVFWIFCF++S YS+F+E+ L  G K+
Sbjct: 315 NWASPQTPATGLIFAGFVFWIFCFAMSRYSIFMERRLDTGHKR 357


>gi|188532409|ref|YP_001906206.1| Putative transport system permease protein [Erwinia tasmaniensis
           Et1/99]
 gi|188027451|emb|CAO95298.1| Putative transport system permease protein [Erwinia tasmaniensis
           Et1/99]
          Length = 366

 Score =  255 bits (651), Expect = 8e-66,   Method: Composition-based stats.
 Identities = 158/357 (44%), Positives = 225/357 (63%), Gaps = 14/357 (3%)

Query: 29  IAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQP 88
           IAW  KN F +  + LLT L + ++  ++P  ++W+   A W G  RT C+         
Sbjct: 20  IAWARKNLFSSIGNSLLTLLCLWIMWEALPPALNWLVFQANWTGDTRTDCSKE------- 72

Query: 89  DGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILL 148
                ACW FI+ R+ Q ++G YP   RWR  L  + G + + PM + + PR+    I  
Sbjct: 73  ----GACWVFIHARFGQLMYGLYPHELRWRINLALIVGLLSIVPMFLKNLPRRGSYIIGW 128

Query: 149 FGLFPIFSFFVLYGGLGL-SIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIP 207
             ++P+  + ++YGGL     VET  WGGL +TL+I+  GI  ++P G+LLALGR S +P
Sbjct: 129 AVVYPLLVWLLMYGGLLGLERVETRQWGGLTLTLIIAAVGIAGALPTGVLLALGRRSQMP 188

Query: 208 VLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEV 267
           V+R  C+ FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV  F SAY+AEV
Sbjct: 189 VVRTLCVLFIEFWRGVPLITVLFMSSVMLPLFMAEGSSIDKLIRALVGVILFQSAYVAEV 248

Query: 268 LRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISII 327
           +RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I LFKD+SL+ II
Sbjct: 249 VRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTIIALFKDTSLVIII 308

Query: 328 NMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
            +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  +E+  H G 
Sbjct: 309 GLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQHLEQRFHTGR 363


>gi|300718664|ref|YP_003743467.1| L-amino acid ABC transporter, permease protein [Erwinia billingiae
           Eb661]
 gi|299064500|emb|CAX61620.1| L-amino acid ABC transporter, permease protein [Erwinia billingiae
           Eb661]
          Length = 366

 Score =  255 bits (651), Expect = 8e-66,   Method: Composition-based stats.
 Identities = 165/368 (44%), Positives = 228/368 (61%), Gaps = 17/368 (4%)

Query: 21  PPVYQRGI---IAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTV 77
           PPV        ++W  KN F +  + LLT   I ++   IP  ++W+   A WIG+ R  
Sbjct: 9   PPVPTNAFSRTVSWARKNLFSSWGNSLLTLFCIWVIWTVIPPALNWLVFQANWIGTTRAD 68

Query: 78  CTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPS 137
           CT            + ACW FI+ R+ QF++G YP   RWR  L  + G + + PM + S
Sbjct: 69  CTK-----------DGACWVFIHARFGQFMYGLYPHELRWRINLALVIGLLSILPMFLKS 117

Query: 138 FPRKFLNSILLFGLFPIFSF-FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGI 196
            PR+ L   +   ++PI  +  +  G  GL  VET  WGGL +TL+I+  GI  ++PLGI
Sbjct: 118 MPRRGLYIAVWAVVYPIAVWVLLYGGFFGLERVETRQWGGLTLTLIIASIGIAGALPLGI 177

Query: 197 LLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGV 256
           LLAL R S++PV+R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV
Sbjct: 178 LLALARRSSMPVVRALSVIFIEFWRGVPLITVLFMSSVMLPLFMSEGNSIDKLIRALVGV 237

Query: 257 SAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIG 316
             F SAY+AEV+RGGLQ++ KGQ EAA SL L Y +   L+I+PQ +K VIPG+VNT I 
Sbjct: 238 ILFQSAYVAEVVRGGLQALPKGQTEAAESLALGYWKTQGLVILPQALKLVIPGLVNTIIA 297

Query: 317 LFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFI 376
           LFKD+SL+ II +FDL   V+    +  W+     T G +F   V+WIFCFS+S YS ++
Sbjct: 298 LFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALVYWIFCFSMSRYSQYL 355

Query: 377 EKTLHKGS 384
           EK  H G 
Sbjct: 356 EKRFHTGR 363


>gi|296272119|ref|YP_003654750.1| polar amino acid ABC transporter inner membrane subunit [Arcobacter
           nitrofigilis DSM 7299]
 gi|296096294|gb|ADG92244.1| polar amino acid ABC transporter, inner membrane subunit
           [Arcobacter nitrofigilis DSM 7299]
          Length = 359

 Score =  255 bits (651), Expect = 8e-66,   Method: Composition-based stats.
 Identities = 150/372 (40%), Positives = 233/372 (62%), Gaps = 17/372 (4%)

Query: 14  RLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGS 73
             L+    P+   G + WI +N F +P   +LT L + LL + +P +++W+  DA W G+
Sbjct: 5   EKLETRPAPLGVSGPVKWIKENLFPSPVSSILTILSLVLLYYIVPPLLNWMIFDATWTGT 64

Query: 74  NRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPM 133
              +              + A W FIY+++ QF++G YP    WRP L+       +   
Sbjct: 65  KEEI------------TKHGARWIFIYEKFNQFMYGFYPENLYWRPNLILGLFVASIVLF 112

Query: 134 LIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMP 193
                 +       +  LFPI SF +++GGLGL +V T+ WGGL++T+V++  GI++S P
Sbjct: 113 KKIKHIK---VRASILILFPIVSFILIHGGLGLEVVPTTKWGGLMLTMVVASVGIVVSFP 169

Query: 194 LGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRAL 253
           +GI+ ALGR SN+P+++   + +IE  RGVPL+T+LFM+S++LPLF P+    DKLLRAL
Sbjct: 170 IGIIFALGRQSNMPIIKTISVLYIEFIRGVPLITLLFMSSVILPLFFPEGVTFDKLLRAL 229

Query: 254 LGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNT 313
           +GV+ F +AY+AEV+RGGLQ+I KGQ+EAA+S+GLSY Q M L+I+PQ +K  IP IV +
Sbjct: 230 IGVTLFQAAYLAEVVRGGLQAIPKGQYEAADSVGLSYWQAMGLVILPQALKISIPNIVGS 289

Query: 314 FIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYS 373
           F+ LFKD++L+ II +FD+L +V +  S+  W+     T G +F+  ++WI CF++S Y+
Sbjct: 290 FVALFKDTTLVLIIGLFDVLAMVTLTTSDPHWLG--FETEGYVFVTMIYWIICFTMSKYA 347

Query: 374 VFIEKTLHKGSK 385
             +E   +   K
Sbjct: 348 QSVENRFNTDHK 359


>gi|327395463|dbj|BAK12885.1| inner membrane amino-acid ABC transporter permease protein YhdY
           [Pantoea ananatis AJ13355]
          Length = 366

 Score =  255 bits (650), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 163/359 (45%), Positives = 217/359 (60%), Gaps = 14/359 (3%)

Query: 28  IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQ 87
              W  KN F    +  LT L I L+   IP  ++W+  DA W G+ R  CT        
Sbjct: 19  AWLWARKNLFSGWFNTFLTLLCIWLIWHVIPPALNWLIFDANWFGTTRADCTKE------ 72

Query: 88  PDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSIL 147
                 ACW FI+ R+ QF++G YP   RWR  L  + G   + PM I   P +      
Sbjct: 73  -----GACWVFIHARFGQFMYGLYPHELRWRINLALVIGLASIVPMFIKRLPYRGRYIAA 127

Query: 148 LFGLFP-IFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNI 206
               +P +  F +  G LGL  VET  WGGL +TL+I+  GI  ++PLGILLALGR S +
Sbjct: 128 WAVCYPLVVWFLLYGGFLGLDRVETRQWGGLTLTLIIASVGIAGALPLGILLALGRRSRM 187

Query: 207 PVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAE 266
           PV+R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV  F SAY+AE
Sbjct: 188 PVVRTLSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTTIDKLVRALVGVILFQSAYVAE 247

Query: 267 VLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISI 326
           V+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K  IPG+VNT I LFKD+SL+ I
Sbjct: 248 VVRGGLQALPKGQYEAAESLALGYWKTQMLVILPQALKLTIPGLVNTIIALFKDTSLVII 307

Query: 327 INMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSK 385
           I +FDL   V+    +  W+     T G +F   V+WIFCFS+S YS ++EK  H G K
Sbjct: 308 IGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALVYWIFCFSMSRYSQYLEKRFHTGRK 364


>gi|317404418|gb|EFV84835.1| amino acid ABC transporter permease [Achromobacter xylosoxidans
           C54]
          Length = 367

 Score =  254 bits (648), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 151/374 (40%), Positives = 227/374 (60%), Gaps = 12/374 (3%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
               +   PP    G  AW+    F +P +IL+T L+   LL S+P ++ W F+ A +  
Sbjct: 6   HTPSEGLPPPKTHVGAWAWLRSRLFSSPLNILITVLLAWFLLMSVPALVEWAFIKANFTA 65

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
           +N   C               ACWAFI +++   +FG YP  ++WRP++  +    ++  
Sbjct: 66  ANAQECRASVG---------GACWAFIIEKHRLILFGTYPYDEQWRPLIATIILVAVIVC 116

Query: 133 MLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISM 192
             I  F   +  +I+        +  +  G LGL+ VE + WGGL +TL++S FGI  + 
Sbjct: 117 SGIRRFW-NWKLAIIWTVGLTAVAILMWGGVLGLTYVENARWGGLPLTLILSTFGIAFAF 175

Query: 193 PLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRA 252
           P+G+LLALGR S +P ++  C+ +IEL RGVPL+++LFM+S+MLPLFLP+ + +DKLLRA
Sbjct: 176 PIGVLLALGRRSKMPAIKALCVVYIELIRGVPLISLLFMSSVMLPLFLPEGFSIDKLLRA 235

Query: 253 LLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVN 312
            + +  FA+AYIAE +RGGLQ+I KGQ+E A+SLGL+Y Q+MR II+PQ +K VIP +V+
Sbjct: 236 QIAIIMFAAAYIAETVRGGLQAIPKGQYEGADSLGLNYWQQMRKIILPQALKIVIPPLVS 295

Query: 313 TFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLY 372
            FI LFKD+SL+ II +FDL    +   S++ W          +FI  ++++FCFS+S Y
Sbjct: 296 IFIALFKDTSLVVIIGIFDLTLAAKAALSDAAWRGFG--VEAYLFISLIYFVFCFSMSKY 353

Query: 373 SVFIEKTLHKGSKK 386
           S  +EK L  G  +
Sbjct: 354 SQALEKRLATGHAR 367


>gi|312170820|emb|CBX79080.1| putative ABC transport system, inner membrane component [Erwinia
           amylovora ATCC BAA-2158]
          Length = 368

 Score =  253 bits (647), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 159/357 (44%), Positives = 223/357 (62%), Gaps = 14/357 (3%)

Query: 29  IAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQP 88
           +AW  KN F +    LLT   + ++  +IP  ++W+   A W G  R  C+         
Sbjct: 22  VAWARKNLFSSVGSSLLTLFCLWIMWETIPPALNWLIFKANWTGDTRADCSKE------- 74

Query: 89  DGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILL 148
                ACW FI+ R+ Q ++G YP   RWR  L  + G + + PM + S PR+    +  
Sbjct: 75  ----GACWVFIHARFGQLMYGLYPHELRWRINLALVIGLLSVIPMFVKSLPRRGSYIVGW 130

Query: 149 FGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIP 207
             ++P+  + ++YGG  GL  VET  WGGL +TL+I+  GI  ++P GILLALGR S +P
Sbjct: 131 AVVYPLLVWLLMYGGWLGLERVETRQWGGLTLTLIIAAVGIAGALPTGILLALGRRSQMP 190

Query: 208 VLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEV 267
           V+R  C+ FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV  F SAY+AEV
Sbjct: 191 VVRTLCVLFIEFWRGVPLITVLFMSSVMLPLFMAEGSSIDKLIRALVGVILFQSAYVAEV 250

Query: 268 LRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISII 327
           +RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I LFKD+SL+ II
Sbjct: 251 VRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTIIALFKDTSLVIII 310

Query: 328 NMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
            +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  +EK  H G 
Sbjct: 311 GLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQHLEKRFHTGR 365


>gi|163854809|ref|YP_001629107.1| putative amino acid ABC transporter permease protein [Bordetella
           petrii DSM 12804]
 gi|163258537|emb|CAP40836.1| putative amino acid ABC transporter permease protein [Bordetella
           petrii]
          Length = 366

 Score =  253 bits (647), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 155/376 (41%), Positives = 229/376 (60%), Gaps = 15/376 (3%)

Query: 13  KRLLQP--SLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVW 70
              +      PP  Q G+  W+ +  F +P  IL T L+  +LL ++P ++ W FL A +
Sbjct: 4   TTPIPSEGLPPPRSQVGVWPWLKERLFSSPVSILATVLVAWILLMAVPALVEWAFLQADF 63

Query: 71  IGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILL 130
             +    C   +           ACWAFI +++   +FG YP  ++WRP+L  +    ++
Sbjct: 64  TSTTSQECRKAA----------GACWAFIAEKHRLILFGTYPYDEQWRPLLATIILIGVI 113

Query: 131 TPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIII 190
               +  F    L  I + GL    +  +  G LGL+ VE SLWGGL +TL++S FGI  
Sbjct: 114 VCSGLRRFWNARLALIWVVGLT-AVAVLMWGGVLGLTYVENSLWGGLPLTLILSTFGIAF 172

Query: 191 SMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLL 250
           + P G+LLALGR S +P ++  C+ +IEL RGVPL+++LFM+S+MLPLFLP  + +DKLL
Sbjct: 173 AFPFGVLLALGRKSKMPAIKALCVVYIELIRGVPLISLLFMSSVMLPLFLPVGFSIDKLL 232

Query: 251 RALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGI 310
           RA + +  FA+AYIAE +RGGLQ+I KGQ+E A+SLGL+Y Q+MR II+PQ ++ VIP +
Sbjct: 233 RAQIAIIMFAAAYIAETVRGGLQAIPKGQYEGADSLGLNYWQQMRKIILPQALRIVIPPL 292

Query: 311 VNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSIS 370
           V+ FI LFKD+SL+ II +FDL    +   S++ W          +FI  ++++FCFS+S
Sbjct: 293 VSIFIALFKDTSLVVIIGIFDLTLAAKAALSDAAWRG--FGVEAYVFISLIYFVFCFSMS 350

Query: 371 LYSVFIEKTLHKGSKK 386
            YS  +EK L  G K+
Sbjct: 351 KYSQRLEKRLATGHKR 366


>gi|292486752|ref|YP_003529622.1| putative ABC transporter inner membrane protein [Erwinia amylovora
           CFBP1430]
 gi|292900846|ref|YP_003540215.1| ABC transporter permease [Erwinia amylovora ATCC 49946]
 gi|291200694|emb|CBJ47827.1| ABC transporter, permease protein [Erwinia amylovora ATCC 49946]
 gi|291552169|emb|CBA19206.1| putative ABC transport system, inner membrane component [Erwinia
           amylovora CFBP1430]
          Length = 368

 Score =  253 bits (647), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 160/357 (44%), Positives = 223/357 (62%), Gaps = 14/357 (3%)

Query: 29  IAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQP 88
           +AW  KN F +    LLT   + ++  +IP  ++W+   A W G  R  C+         
Sbjct: 22  VAWARKNLFSSVGSSLLTLFCLWIMWETIPPALNWLIFKANWTGDTRADCSKE------- 74

Query: 89  DGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILL 148
                ACW FI+ R+ Q ++G YP   RWR  L  + G + + PM + S PR+    +  
Sbjct: 75  ----GACWVFIHARFGQLMYGLYPHELRWRINLALVIGLLSVIPMFVKSLPRRGSYIVGW 130

Query: 149 FGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIP 207
             ++P+  + ++YGG  GL  VET  WGGL +TL+I+  GI  ++P GILLALGR S +P
Sbjct: 131 AVVYPLLVWLLMYGGWLGLERVETRQWGGLTLTLIIAAVGIAGALPTGILLALGRRSQMP 190

Query: 208 VLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEV 267
           V+R  CI FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV  F SAY+AEV
Sbjct: 191 VVRTLCILFIEFWRGVPLITVLFMSSVMLPLFMAEGSSIDKLIRALVGVILFQSAYVAEV 250

Query: 268 LRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISII 327
           +RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I LFKD+SL+ II
Sbjct: 251 VRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTIIALFKDTSLVIII 310

Query: 328 NMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
            +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  +EK  H G 
Sbjct: 311 GLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQHLEKRFHTGR 365


>gi|254469494|ref|ZP_05082899.1| amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine [Pseudovibrio sp. JE062]
 gi|211961329|gb|EEA96524.1| amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine [Pseudovibrio sp. JE062]
          Length = 372

 Score =  253 bits (646), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 160/382 (41%), Positives = 244/382 (63%), Gaps = 11/382 (2%)

Query: 4   SCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHW 63
           S   F YV         PP    G + W  +N F +P + +LT + + ++  ++PGI +W
Sbjct: 2   SENTFAYVATSEKPQLPPPQGTTGAVGWARENLFSSPLNTILTLVSVFVVFSTVPGIFNW 61

Query: 64  VFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVF 123
            F+++VW  ++   C  +++        N ACWA I +RY QF+FG YP    WRPIL F
Sbjct: 62  AFVNSVWNANSLDECRALTE--------NGACWAVIRERYHQFLFGFYPTELYWRPILAF 113

Query: 124 LTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVI 183
           +   + L P L    P++   +++    +P  +F++++GG GL  V ++  GGLL+T++I
Sbjct: 114 VLLFVALVPALWDGMPKR-GAALMASMTYPFVAFWLIWGGFGLEPVSSTKLGGLLLTMII 172

Query: 184 SFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDT 243
              GI  S+P+GI+LAL R+SN+P+++   + FIE  RGVPL+T+LF+A ++L  FLP  
Sbjct: 173 GVSGISFSLPIGIVLALSRSSNLPIVKSLAVIFIEFIRGVPLITLLFVAHVLLNYFLPKG 232

Query: 244 WDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVI 303
            + D +LR ++ V+ FASAY+AEV+RGGL ++ KGQ+EAA++LGLSY Q MRLII+PQ +
Sbjct: 233 VNFDIVLRVVIMVTLFASAYMAEVIRGGLAALPKGQYEAADALGLSYWQSMRLIILPQAL 292

Query: 304 KRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFW 363
           K  IPGIVNTFIGLFKD++L+ II + D LG+V    ++  W           FI F+F+
Sbjct: 293 KISIPGIVNTFIGLFKDTTLVLIIGLMDPLGLVAPTLADQRWNGIF--VELYAFIAFMFF 350

Query: 364 IFCFSISLYSVFIEKTLHKGSK 385
           IFCF++S YS+++E+ LH G +
Sbjct: 351 IFCFAMSRYSMYLERKLHTGHR 372


>gi|251791417|ref|YP_003006138.1| polar amino acid ABC transporter inner membrane subunit [Dickeya
           zeae Ech1591]
 gi|247540038|gb|ACT08659.1| polar amino acid ABC transporter, inner membrane subunit [Dickeya
           zeae Ech1591]
          Length = 364

 Score =  253 bits (645), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 162/374 (43%), Positives = 231/374 (61%), Gaps = 16/374 (4%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
                    P+     I W  +N F +  + +LT + + LL   IP +++W  + A WIG
Sbjct: 4   TTHTPSHPTPINY--AITWARRNLFSSISNSILTLVCLWLLWTLIPPLLNWAIIKASWIG 61

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
           S R+ CT+           + ACW F++ R+EQF++G YP  + WR     +   I + P
Sbjct: 62  STRSDCTS-----------DGACWVFVHARFEQFMYGLYPREELWRINFALVLALISILP 110

Query: 133 MLIPSFPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIIS 191
           M   + PR+     +   ++P+   + +  G  GL+ VET  WGGL +T++I+  GI  +
Sbjct: 111 MFWRNLPRRGRYIAIWCIVYPLIAWWLLFGGFGGLTRVETRQWGGLTLTIIIAAIGIAGA 170

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +PLGILLALGR SN+PVLR  C+ FIE +RGVPL+TVLFM+S+MLPLFL +  ++DKLLR
Sbjct: 171 LPLGILLALGRRSNMPVLRALCVIFIEFWRGVPLITVLFMSSVMLPLFLTEGTNIDKLLR 230

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
           AL+GV  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+V
Sbjct: 231 ALVGVILFQSAYVAEVVRGGLQALPKGQYEAAQSLALGYWRMQGLVILPQALKMVIPGLV 290

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISL 371
           NT I LFKD+SL+ II +FDL   ++    +  W+     T G +F   ++WIFCFS+S 
Sbjct: 291 NTIIALFKDTSLVIIIGLFDLFSSIQQATVDPAWLG--MSTEGYVFAAIIYWIFCFSMSR 348

Query: 372 YSVFIEKTLHKGSK 385
           YS  +EK    G K
Sbjct: 349 YSQHLEKRFDTGHK 362


>gi|17987492|ref|NP_540126.1| general L-amino acid transport system permease protein AAPM
           [Brucella melitensis bv. 1 str. 16M]
 gi|256044434|ref|ZP_05447338.1| general L-amino acid transport system permease protein AAPM
           [Brucella melitensis bv. 1 str. Rev.1]
 gi|260563785|ref|ZP_05834271.1| polar amino acid ABC transporter [Brucella melitensis bv. 1 str.
           16M]
 gi|265990854|ref|ZP_06103411.1| amino acid ABC transporter permease [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|17983190|gb|AAL52390.1| general l-amino acid transport system permease protein aapm
           [Brucella melitensis bv. 1 str. 16M]
 gi|260153801|gb|EEW88893.1| polar amino acid ABC transporter [Brucella melitensis bv. 1 str.
           16M]
 gi|263001638|gb|EEZ14213.1| amino acid ABC transporter permease [Brucella melitensis bv. 1 str.
           Rev.1]
          Length = 343

 Score =  253 bits (645), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 206/343 (60%), Positives = 266/343 (77%), Gaps = 1/343 (0%)

Query: 45  LTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYE 104
           +T   + L+++ +P II W+F++A W G++RT C T +QGG QPDGW+ ACWAF+  +YE
Sbjct: 1   MTIFGLVLVVWFVPPIIEWLFINAAWTGTSRTACLTAAQGGAQPDGWSGACWAFVNAKYE 60

Query: 105 QFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIF-SFFVLYGG 163
           QF++G YP+++RWR  L  L  + LL P+LIP  P+K LN+IL F +FP+   F ++ G 
Sbjct: 61  QFLYGRYPISERWRVDLTALIFAALLVPLLIPKIPKKGLNAILFFLVFPVVAFFLLVGGW 120

Query: 164 LGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGV 223
            GL  VET LWGGLLVTLV+SF GI +S+PLGI+ ALGR S +PV++   I FIE+ RGV
Sbjct: 121 FGLPYVETPLWGGLLVTLVLSFVGIAVSLPLGIVPALGRRSKLPVIKTLSIIFIEMVRGV 180

Query: 224 PLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAA 283
           PLVTVLFMAS+MLPLFLP     DKLLRAL+GV+ FASAY+AEV+RGGLQ+I +GQ+E A
Sbjct: 181 PLVTVLFMASVMLPLFLPPGVTFDKLLRALIGVALFASAYMAEVVRGGLQAIPRGQYEGA 240

Query: 284 NSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSES 343
           ++LGLSY QK  L+++PQ +K VIPGIVNTFIGLFKD+SL+ II MFDLLGIVR NFS++
Sbjct: 241 DALGLSYWQKTGLVVLPQALKLVIPGIVNTFIGLFKDTSLVYIIGMFDLLGIVRQNFSDA 300

Query: 344 TWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
            W S  TP TGLIF GFVFWIFCF++S YS+F+E+ L  G K+
Sbjct: 301 NWASPQTPATGLIFAGFVFWIFCFAMSRYSIFMERRLDTGHKR 343


>gi|238798510|ref|ZP_04641989.1| Inner membrane amino-acid ABC transporter permease protein yhdY
           [Yersinia mollaretii ATCC 43969]
 gi|238717672|gb|EEQ09509.1| Inner membrane amino-acid ABC transporter permease protein yhdY
           [Yersinia mollaretii ATCC 43969]
          Length = 367

 Score =  253 bits (645), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 167/377 (44%), Positives = 232/377 (61%), Gaps = 20/377 (5%)

Query: 15  LLQPSLPPVYQRG------IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDA 68
           +     PP   R       ++ W  KN F +  + LLT   + L+   IP +++W   +A
Sbjct: 1   MTLTREPPRTVRPGNPLSRMVFWARKNLFSSWSNSLLTLFCLWLMWQLIPPLLNWTIFNA 60

Query: 69  VWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSI 128
            W+G++RT CT              ACW FI+ R+ QF++G YP+ QRWR     + G +
Sbjct: 61  NWLGTSRTDCT-----------REGACWVFIHARFGQFMYGLYPIEQRWRINTTLIIGLL 109

Query: 129 LLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFG 187
            L P+     PR+     +    +P+  + +LYGG  GLS VET  WGGL +TL+I+  G
Sbjct: 110 TLIPLFWRGMPRRGRYLAVWMVAYPLLVWVMLYGGFLGLSRVETHQWGGLTLTLIIAAVG 169

Query: 188 IIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVD 247
           I  ++PLGILLAL R S++PV+R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +D
Sbjct: 170 IAGALPLGILLALARRSSMPVVRILSVAFIEFWRGVPLITVLFMSSVMLPLFMTEGTSID 229

Query: 248 KLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVI 307
           KL+RAL+GV  F SAY+AEV+RGGLQ++ KGQ EAA SLGL Y +   L+I+PQ +K VI
Sbjct: 230 KLIRALVGVVLFQSAYVAEVVRGGLQALPKGQTEAAESLGLGYWKTQGLVILPQALKMVI 289

Query: 308 PGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCF 367
           PG+VNT I LFKD+SL+ II +FDL   V+    +  W+     T G +F   V+WIFCF
Sbjct: 290 PGLVNTIIALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAAAVYWIFCF 347

Query: 368 SISLYSVFIEKTLHKGS 384
           S+S YS  +EK  H G 
Sbjct: 348 SMSRYSQHLEKRFHTGR 364


>gi|300817472|ref|ZP_07097688.1| ABC transporter, permease protein [Escherichia coli MS 107-1]
 gi|300824984|ref|ZP_07105083.1| ABC transporter, permease protein [Escherichia coli MS 119-7]
 gi|300925984|ref|ZP_07141807.1| ABC transporter, permease protein [Escherichia coli MS 182-1]
 gi|301326286|ref|ZP_07219659.1| ABC transporter, permease protein [Escherichia coli MS 78-1]
 gi|300417928|gb|EFK01239.1| ABC transporter, permease protein [Escherichia coli MS 182-1]
 gi|300522550|gb|EFK43619.1| ABC transporter, permease protein [Escherichia coli MS 119-7]
 gi|300529770|gb|EFK50832.1| ABC transporter, permease protein [Escherichia coli MS 107-1]
 gi|300846987|gb|EFK74747.1| ABC transporter, permease protein [Escherichia coli MS 78-1]
 gi|323183030|gb|EFZ68429.1| general L-amino acid transport system permease protein aapM
           [Escherichia coli 1357]
 gi|324020753|gb|EGB89972.1| ABC transporter, permease protein [Escherichia coli MS 117-3]
          Length = 347

 Score =  253 bits (645), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 161/355 (45%), Positives = 225/355 (63%), Gaps = 14/355 (3%)

Query: 31  WIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDG 90
           W+ KN F +  + LLT   I L+   IP +++W FL A W+GS R  CT           
Sbjct: 3   WVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRADCTKA--------- 53

Query: 91  WNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFG 150
              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM     P +     +   
Sbjct: 54  --GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPMFWKILPHRGRYIAVWAV 111

Query: 151 LFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVL 209
           ++P+   + +  G  GL  VET  WGGL +TL+I+  GI  ++P GILLALGR S++P++
Sbjct: 112 IYPLIVWWLMYGGFFGLERVETRQWGGLTLTLIIASVGIAGALPWGILLALGRRSHMPIV 171

Query: 210 RYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLR 269
           R   + FIE +RGVPL+TVLFM+S+MLPLF+ +  ++DKL+RAL+GV  F SAY+AEV+R
Sbjct: 172 RILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTNIDKLIRALVGVILFQSAYVAEVVR 231

Query: 270 GGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINM 329
           GGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I LFKD+SL+ II +
Sbjct: 232 GGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTIIALFKDTSLVIIIGL 291

Query: 330 FDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
           FDL   V+    + TW+     T G +F   ++WIFCFS+S YS  +EK  + G 
Sbjct: 292 FDLFSSVQQATVDPTWLG--MSTEGYVFAALIYWIFCFSMSRYSQHLEKRFNTGR 344


>gi|237807993|ref|YP_002892433.1| polar amino acid ABC transporter, inner membrane subunit [Tolumonas
           auensis DSM 9187]
 gi|237500254|gb|ACQ92847.1| polar amino acid ABC transporter, inner membrane subunit [Tolumonas
           auensis DSM 9187]
          Length = 365

 Score =  253 bits (645), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 158/371 (42%), Positives = 228/371 (61%), Gaps = 14/371 (3%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
                P  Q   + W+HKN F    + ++T  ++  L+  +  +I W FL + W+G NR+
Sbjct: 8   PTLPAPASQTSFVGWMHKNLFSNWVNSIITLALLYFLVPQLWSLIQWAFLKSDWVGDNRS 67

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            C +             ACW FI +R   FI+G YP ++ WR   ++   ++ +  +L P
Sbjct: 68  QCVS-----------GGACWVFITNRLNLFIYGFYPESEHWRVNWIYALTALQVAALLYP 116

Query: 137 SFPRKFLN-SILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
             P K +   I       +  F +  G  GL +VET  WGGL++TL++   G + ++P+G
Sbjct: 117 KTPHKSILTGIFFVVYPFVVFFLLYGGVFGLDVVETHKWGGLMLTLLLGIIGTVAALPIG 176

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           ILLALGR S +P++R   I FIE +R VPL+TVLFMAS+MLPLFL     +DKLLRA++G
Sbjct: 177 ILLALGRRSEMPIIRSLSIVFIEFWRAVPLITVLFMASVMLPLFLSGEVSMDKLLRAMIG 236

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           +  F SAY+AEV+RGGLQ+I KGQ+EAA +LGL+Y + M LIIMPQ +K  IP +VNTFI
Sbjct: 237 IILFESAYVAEVIRGGLQAIPKGQYEAAKALGLNYWKSMGLIIMPQALKLTIPSLVNTFI 296

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD+SL++II +FDLL + +   S+  W+     T    F+  VFW+FCF +S YS++
Sbjct: 297 ELFKDTSLVTIIGLFDLLAVAKAGLSDPAWLG--FSTEAYTFVALVFWVFCFGMSRYSMY 354

Query: 376 IEKTLHKGSKK 386
           +E  LH G K+
Sbjct: 355 LENLLHTGHKR 365


>gi|293602097|ref|ZP_06684550.1| amino acid ABC superfamily ATP binding cassette transporter,
           permease protein [Achromobacter piechaudii ATCC 43553]
 gi|292819499|gb|EFF78527.1| amino acid ABC superfamily ATP binding cassette transporter,
           permease protein [Achromobacter piechaudii ATCC 43553]
          Length = 366

 Score =  252 bits (644), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 151/374 (40%), Positives = 224/374 (59%), Gaps = 13/374 (3%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
                   PP    G   W+    F +P +IL+T L+   LL ++P ++ W F  A +  
Sbjct: 6   HTPTDAMPPPSTHVGAWPWLKARLFSSPLNILITVLLAWFLLMAVPALLEWAFFKADFNA 65

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
           +N   C               ACWAFI +++   +FG YP  ++WRP++  +    ++  
Sbjct: 66  ANAQECRASG----------GACWAFIIEKHRLILFGTYPFDEQWRPLIATIILVGVIIC 115

Query: 133 MLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISM 192
             I  F    L +I   GL    +  +  G  GL+ VE + WGGL +TL++S FGI  + 
Sbjct: 116 SGIRYFWNWKLAAIWTVGLT-AVALLMWGGVFGLTYVENARWGGLPLTLILSTFGIAFAF 174

Query: 193 PLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRA 252
           P+G+LLALGR S +P ++  C+ +IEL RGVPL+++LFM+S+MLPLFLP+ + +DKLLRA
Sbjct: 175 PIGVLLALGRRSKMPAIKALCVVYIELIRGVPLISLLFMSSVMLPLFLPEGFSIDKLLRA 234

Query: 253 LLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVN 312
            + +  FA+AYIAE +RGGLQ+I KGQ+E A+SLGL+Y Q+MR II+PQ +K VIP +V+
Sbjct: 235 QIAIILFAAAYIAETVRGGLQAIPKGQYEGADSLGLNYWQQMRKIILPQALKIVIPPLVS 294

Query: 313 TFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLY 372
            FI LFKD+SL+ II +FDL    +   S++ W          +FI  ++++FCFS+S Y
Sbjct: 295 IFIALFKDTSLVVIIGIFDLTLAAKAALSDAAWRGFG--VEAYLFISAIYFVFCFSMSKY 352

Query: 373 SVFIEKTLHKGSKK 386
           S  +EK L    K+
Sbjct: 353 SQALEKRLATDHKR 366


>gi|323173470|gb|EFZ59099.1| general L-amino acid transport system permease protein aapM
           [Escherichia coli LT-68]
          Length = 347

 Score =  252 bits (644), Expect = 6e-65,   Method: Composition-based stats.
 Identities = 160/355 (45%), Positives = 224/355 (63%), Gaps = 14/355 (3%)

Query: 31  WIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDG 90
           W+ KN F +  + LLT   I L+   IP +++W FL A W+GS R  CT           
Sbjct: 3   WVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRADCTKA--------- 53

Query: 91  WNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFG 150
              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM     P +     +   
Sbjct: 54  --GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPMFWKILPHRGRYIAVWAV 111

Query: 151 LFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVL 209
           ++P+   + +  G  GL  VET  WGGL +TL+I+  GI  ++P GILLALGR S++P++
Sbjct: 112 IYPLIVWWLMYGGFFGLERVETRQWGGLTLTLIIASVGIAGALPWGILLALGRRSHMPIV 171

Query: 210 RYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLR 269
           R   + FIE +RGVPL+TVLFM+S+MLPLF+ +  ++DKL+RAL+GV  F SAY+AEV+R
Sbjct: 172 RILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTNIDKLIRALVGVILFQSAYVAEVVR 231

Query: 270 GGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINM 329
           GGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I LFKD+SL+ II +
Sbjct: 232 GGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTIIALFKDTSLVIIIGL 291

Query: 330 FDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
           FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  +EK  + G 
Sbjct: 292 FDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQHLEKRFNTGR 344


>gi|254693492|ref|ZP_05155320.1| binding-protein dependent transport system inner membrane protein
           [Brucella abortus bv. 3 str. Tulya]
 gi|261213750|ref|ZP_05928031.1| ABC-type amino acid transporter permease [Brucella abortus bv. 3
           str. Tulya]
 gi|260915357|gb|EEX82218.1| ABC-type amino acid transporter permease [Brucella abortus bv. 3
           str. Tulya]
          Length = 343

 Score =  252 bits (644), Expect = 7e-65,   Method: Composition-based stats.
 Identities = 206/343 (60%), Positives = 266/343 (77%), Gaps = 1/343 (0%)

Query: 45  LTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYE 104
           +T   + L+++ +P II W+F++A W G++RT C T +QGG QPDGW+ ACWAF+  +YE
Sbjct: 1   MTIFGLVLVVWFVPPIIEWLFINAAWTGTSRTACLTAAQGGAQPDGWSGACWAFVNAKYE 60

Query: 105 QFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIF-SFFVLYGG 163
           QF++G YP+++RWR  L  L  + LL P+LIP  P+K LN+IL F +FP+   F ++ G 
Sbjct: 61  QFLYGRYPISERWRVDLTALIFAALLVPLLIPKIPKKGLNAILFFLVFPVVAFFLLVGGW 120

Query: 164 LGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGV 223
            GL  VET LWGGLLVT V+SF GI +S+PLGI+LALGR S +PV++   I FIE+ RGV
Sbjct: 121 FGLPYVETPLWGGLLVTQVLSFVGIAVSLPLGIVLALGRRSKLPVIKTLSIIFIEMVRGV 180

Query: 224 PLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAA 283
           PLVTVLFMAS+MLPLFLP     DKLLRAL+GV+ FASAY+AEV+RGGLQ+I +GQ+E A
Sbjct: 181 PLVTVLFMASVMLPLFLPPGVTFDKLLRALIGVALFASAYMAEVVRGGLQAIPRGQYEGA 240

Query: 284 NSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSES 343
           ++LGLSY QK  L+++PQ +K VIPGIVNTFIGLFKD+SL+ II MFDLLGIVR NFS++
Sbjct: 241 DALGLSYWQKTGLVVLPQALKLVIPGIVNTFIGLFKDTSLVYIIGMFDLLGIVRQNFSDA 300

Query: 344 TWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
            W S  TP TGLIF GFVFWIFCF++S YS+F+E+ L  G K+
Sbjct: 301 NWASPQTPATGLIFAGFVFWIFCFAMSRYSIFMERRLDTGHKR 343


>gi|156935790|ref|YP_001439706.1| hypothetical protein ESA_03661 [Cronobacter sakazakii ATCC BAA-894]
 gi|156534044|gb|ABU78870.1| hypothetical protein ESA_03661 [Cronobacter sakazakii ATCC BAA-894]
          Length = 344

 Score =  252 bits (643), Expect = 7e-65,   Method: Composition-based stats.
 Identities = 159/354 (44%), Positives = 221/354 (62%), Gaps = 14/354 (3%)

Query: 32  IHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGW 91
           + KN F +  + LLT   + ++   IP +++W FL A W+GS R  CT            
Sbjct: 1   MRKNLFSSWINSLLTLFCLWMMWELIPPLLNWAFLQANWVGSTRADCTKE---------- 50

Query: 92  NAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFGL 151
             ACW FI+ R+ QF++G YP  +RWR  L  + G + + PM     P++          
Sbjct: 51  -GACWVFIHARFGQFMYGLYPHDERWRINLALIVGLVSIVPMFWKGLPQRGRYITCWAIA 109

Query: 152 FP-IFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLR 210
           +P +  + +  G LGL  VET  WGGL +TL+I+  GI  ++PLGILLALGR S +PV+R
Sbjct: 110 YPLVVWWLMYGGFLGLERVETRQWGGLTLTLIIASVGIAGALPLGILLALGRRSRMPVVR 169

Query: 211 YACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRG 270
              + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV  F SAY+AEV+RG
Sbjct: 170 VLSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVGVILFQSAYVAEVVRG 229

Query: 271 GLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMF 330
           GLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I LFKD+SL+ II +F
Sbjct: 230 GLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTIIALFKDTSLVIIIGLF 289

Query: 331 DLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
           DL   V+    +  W+     T G +F   ++WIFCFS+S YS  +EK  H G 
Sbjct: 290 DLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQHLEKRFHTGR 341


>gi|325498848|gb|EGC96707.1| amino-acid transporter subunit ; membrane component of ABC
           superfamily [Escherichia fergusonii ECD227]
          Length = 347

 Score =  252 bits (643), Expect = 8e-65,   Method: Composition-based stats.
 Identities = 160/355 (45%), Positives = 224/355 (63%), Gaps = 14/355 (3%)

Query: 31  WIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDG 90
           W+ KN F +  + LLT   + L+   IP +++W FL A W+GS R  CT           
Sbjct: 3   WVRKNLFSSWSNSLLTIGCLWLMWELIPPLLNWAFLQANWVGSTRADCTKA--------- 53

Query: 91  WNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFG 150
              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM     P +     +   
Sbjct: 54  --GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPMFWKILPHRGRYIAVWAV 111

Query: 151 LFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVL 209
           ++P+   + +  G LGL  VET  WGGL +TL+I+  GI  ++P GILLALGR S++P++
Sbjct: 112 IYPLIVWWLMYGGFLGLERVETRQWGGLTLTLIIASVGIAGALPWGILLALGRRSHMPIV 171

Query: 210 RYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLR 269
           R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV  F SAY+AEV+R
Sbjct: 172 RILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVGVILFQSAYVAEVVR 231

Query: 270 GGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINM 329
           GGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I LFKD+SL+ II +
Sbjct: 232 GGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTIIALFKDTSLVIIIGL 291

Query: 330 FDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
           FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  +EK  + G 
Sbjct: 292 FDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQHLEKRFNTGR 344


>gi|300904466|ref|ZP_07122312.1| ABC transporter, permease protein [Escherichia coli MS 84-1]
 gi|301304261|ref|ZP_07210375.1| ABC transporter, permease protein [Escherichia coli MS 124-1]
 gi|309793851|ref|ZP_07688277.1| ABC transporter, permease protein [Escherichia coli MS 145-7]
 gi|300403628|gb|EFJ87166.1| ABC transporter, permease protein [Escherichia coli MS 84-1]
 gi|300840387|gb|EFK68147.1| ABC transporter, permease protein [Escherichia coli MS 124-1]
 gi|308122808|gb|EFO60070.1| ABC transporter, permease protein [Escherichia coli MS 145-7]
 gi|315257198|gb|EFU37166.1| ABC transporter, permease protein [Escherichia coli MS 85-1]
          Length = 347

 Score =  252 bits (643), Expect = 8e-65,   Method: Composition-based stats.
 Identities = 161/355 (45%), Positives = 224/355 (63%), Gaps = 14/355 (3%)

Query: 31  WIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDG 90
           W+ KN F +  + LLT   I L+   IP +++W FL A W+GS R  CT           
Sbjct: 3   WVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRADCTKA--------- 53

Query: 91  WNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFG 150
              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM     P +     +   
Sbjct: 54  --GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPMFWKILPHRGRYIAVWAV 111

Query: 151 LFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVL 209
           ++P+   + +  G  GL  VET  WGGL +TL+I+  GI  ++P GILLALGR S++P++
Sbjct: 112 IYPLIVWWLMYGGFFGLERVETRQWGGLTLTLIIASVGIAGALPWGILLALGRRSHMPIV 171

Query: 210 RYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLR 269
           R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV  F SAY+AEV+R
Sbjct: 172 RILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVGVILFQSAYVAEVVR 231

Query: 270 GGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINM 329
           GGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I LFKD+SL+ II +
Sbjct: 232 GGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTIIALFKDTSLVIIIGL 291

Query: 330 FDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
           FDL   V+    + TW+     T G +F   ++WIFCFS+S YS  +EK  + G 
Sbjct: 292 FDLFSSVQQATVDPTWLG--MSTEGYVFAALIYWIFCFSMSRYSQHLEKRFNTGR 344


>gi|82699627|ref|YP_414201.1| binding-protein dependent transport system inner membrane protein
           [Brucella melitensis biovar Abortus 2308]
 gi|254689009|ref|ZP_05152263.1| binding-protein dependent transport system inner membrane protein
           [Brucella abortus bv. 6 str. 870]
 gi|254697144|ref|ZP_05158972.1| binding-protein dependent transport system inner membrane protein
           [Brucella abortus bv. 2 str. 86/8/59]
 gi|254707028|ref|ZP_05168856.1| binding-protein dependent transport system inner membrane protein
           [Brucella pinnipedialis M163/99/10]
 gi|254730040|ref|ZP_05188618.1| binding-protein dependent transport system inner membrane protein
           [Brucella abortus bv. 4 str. 292]
 gi|256113278|ref|ZP_05454146.1| binding-protein dependent transport system inner membrane protein
           [Brucella melitensis bv. 3 str. Ether]
 gi|256257259|ref|ZP_05462795.1| binding-protein dependent transport system inner membrane protein
           [Brucella abortus bv. 9 str. C68]
 gi|256264231|ref|ZP_05466763.1| amino acid ABC transporter permease [Brucella melitensis bv. 2 str.
           63/9]
 gi|260545547|ref|ZP_05821288.1| polar amino acid ABC transporter [Brucella abortus NCTC 8038]
 gi|260754502|ref|ZP_05866850.1| ABC-type arginine transport system, permease component [Brucella
           abortus bv. 6 str. 870]
 gi|260757723|ref|ZP_05870071.1| ABC transporter permease [Brucella abortus bv. 4 str. 292]
 gi|260761548|ref|ZP_05873891.1| ABC transporter permease [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883531|ref|ZP_05895145.1| polar amino acid ABC transporter [Brucella abortus bv. 9 str. C68]
 gi|265994690|ref|ZP_06107247.1| polar amino acid ABC transporter [Brucella melitensis bv. 3 str.
           Ether]
 gi|82615728|emb|CAJ10724.1| Binding-protein-dependent transport systems inner membrane
           component:Tetracycline resistance protein [Brucella
           melitensis biovar Abortus 2308]
 gi|260096954|gb|EEW80829.1| polar amino acid ABC transporter [Brucella abortus NCTC 8038]
 gi|260668041|gb|EEX54981.1| ABC transporter permease [Brucella abortus bv. 4 str. 292]
 gi|260671980|gb|EEX58801.1| ABC transporter permease [Brucella abortus bv. 2 str. 86/8/59]
 gi|260674610|gb|EEX61431.1| ABC-type arginine transport system, permease component [Brucella
           abortus bv. 6 str. 870]
 gi|260873059|gb|EEX80128.1| polar amino acid ABC transporter [Brucella abortus bv. 9 str. C68]
 gi|262765803|gb|EEZ11592.1| polar amino acid ABC transporter [Brucella melitensis bv. 3 str.
           Ether]
 gi|263094477|gb|EEZ18299.1| amino acid ABC transporter permease [Brucella melitensis bv. 2 str.
           63/9]
 gi|326408767|gb|ADZ65832.1| His/Glu/Gln/Arg/opine amino acid ABC transporter permease [Brucella
           melitensis M28]
 gi|326538485|gb|ADZ86700.1| binding-protein-dependent transport systems inner membrane
           component:Tetracycline resistance protein [Brucella
           melitensis M5-90]
          Length = 343

 Score =  252 bits (643), Expect = 8e-65,   Method: Composition-based stats.
 Identities = 207/343 (60%), Positives = 267/343 (77%), Gaps = 1/343 (0%)

Query: 45  LTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYE 104
           +T   + L+++ +P II W+F++A W G++RT C T +QGG QPDGW+ ACWAF+  +YE
Sbjct: 1   MTIFGLVLVVWFVPPIIEWLFINAAWTGTSRTACLTAAQGGAQPDGWSGACWAFVNAKYE 60

Query: 105 QFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIF-SFFVLYGG 163
           QF++G YP+++RWR  L  L  + LL P+LIP  P+K LN+IL F +FP+   F ++ G 
Sbjct: 61  QFLYGRYPISERWRVDLTALIFAALLVPLLIPKIPKKGLNAILFFLVFPVVAFFLLVGGW 120

Query: 164 LGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGV 223
            GL  VET LWGGLLVTLV+SF GI +S+PLGI+LALGR S +PV++   I FIE+ RGV
Sbjct: 121 FGLPYVETPLWGGLLVTLVLSFVGIAVSLPLGIVLALGRRSKLPVIKTLSIIFIEMVRGV 180

Query: 224 PLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAA 283
           PLVTVLFMAS+MLPLFLP     DKLLRAL+GV+ FASAY+AEV+RGGLQ+I +GQ+E A
Sbjct: 181 PLVTVLFMASVMLPLFLPPGVTFDKLLRALIGVALFASAYMAEVVRGGLQAIPRGQYEGA 240

Query: 284 NSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSES 343
           ++LGLSY QK  L+++PQ +K VIPGIVNTFIGLFKD+SL+ II MFDLLGIVR NFS++
Sbjct: 241 DALGLSYWQKTGLVVLPQALKLVIPGIVNTFIGLFKDTSLVYIIGMFDLLGIVRQNFSDA 300

Query: 344 TWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
            W S  TP TGLIF GFVFWIFCF++S YS+F+E+ L  G K+
Sbjct: 301 NWASPQTPATGLIFAGFVFWIFCFAMSRYSIFMERRLDTGHKR 343


>gi|301022229|ref|ZP_07186144.1| ABC transporter, permease protein [Escherichia coli MS 69-1]
 gi|300397642|gb|EFJ81180.1| ABC transporter, permease protein [Escherichia coli MS 69-1]
          Length = 347

 Score =  252 bits (643), Expect = 8e-65,   Method: Composition-based stats.
 Identities = 162/355 (45%), Positives = 225/355 (63%), Gaps = 14/355 (3%)

Query: 31  WIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDG 90
           W+ KN F +  + LLT   I L+   IP +++W FL A W+GS RT CT           
Sbjct: 3   WVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRTDCTKA--------- 53

Query: 91  WNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFG 150
              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM     P +     +   
Sbjct: 54  --GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPMFWKILPHRGRYIAVWAV 111

Query: 151 LFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVL 209
           ++P+   + +  G LGL  VET  WGGL +TL+I+  GI  ++P GILLALGR S++P++
Sbjct: 112 IYPLIVWWLMYGGFLGLERVETRQWGGLTLTLIIASVGIAGALPWGILLALGRRSHMPIV 171

Query: 210 RYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLR 269
           R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV  F SAY+AEV+R
Sbjct: 172 RILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVGVILFQSAYVAEVVR 231

Query: 270 GGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINM 329
           GGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I LFKD+SL+ II +
Sbjct: 232 GGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTIIALFKDTSLVIIIGL 291

Query: 330 FDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
           FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  +EK  + G 
Sbjct: 292 FDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQHLEKRFNTGR 344


>gi|300937397|ref|ZP_07152232.1| ABC transporter, permease protein [Escherichia coli MS 21-1]
 gi|300979703|ref|ZP_07174653.1| ABC transporter, permease protein [Escherichia coli MS 200-1]
 gi|300307921|gb|EFJ62441.1| ABC transporter, permease protein [Escherichia coli MS 200-1]
 gi|300457571|gb|EFK21064.1| ABC transporter, permease protein [Escherichia coli MS 21-1]
 gi|324015880|gb|EGB85099.1| ABC transporter, permease protein [Escherichia coli MS 60-1]
          Length = 347

 Score =  251 bits (642), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 161/355 (45%), Positives = 224/355 (63%), Gaps = 14/355 (3%)

Query: 31  WIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDG 90
           W+ KN F +  + LLT   I L+   IP +++W FL A W+GS R  CT           
Sbjct: 3   WVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRADCTKA--------- 53

Query: 91  WNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFG 150
              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM     P +     +   
Sbjct: 54  --GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPMFWKILPHRGRYIAVWAV 111

Query: 151 LFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVL 209
           ++P+   + +  G LGL  VET  WGGL +TL+I+  GI  ++P GILLALGR S++P++
Sbjct: 112 IYPLIVWWLMYGGFLGLERVETRQWGGLTLTLIIASVGIAGALPWGILLALGRRSHMPIV 171

Query: 210 RYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLR 269
           R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV  F SAY+AEV+R
Sbjct: 172 RILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVGVILFQSAYVAEVVR 231

Query: 270 GGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINM 329
           GGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I LFKD+SL+ II +
Sbjct: 232 GGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTIIALFKDTSLVIIIGL 291

Query: 330 FDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
           FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  +EK  + G 
Sbjct: 292 FDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQHLEKRFNTGR 344


>gi|33594683|ref|NP_882327.1| putative amino acid ABC transporter permease protein [Bordetella
           pertussis Tohama I]
 gi|33598477|ref|NP_886120.1| putative amino acid ABC transporter permease protein [Bordetella
           parapertussis 12822]
 gi|33603420|ref|NP_890980.1| putative amino acid ABC transporter permease protein [Bordetella
           bronchiseptica RB50]
 gi|33564759|emb|CAE44084.1| putative amino acid ABC transporter permease protein [Bordetella
           pertussis Tohama I]
 gi|33574606|emb|CAE39256.1| putative amino acid ABC transporter permease protein [Bordetella
           parapertussis]
 gi|33577544|emb|CAE34809.1| putative amino acid ABC transporter permease protein [Bordetella
           bronchiseptica RB50]
          Length = 366

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 146/374 (39%), Positives = 227/374 (60%), Gaps = 13/374 (3%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
               +   PP    G+  W+    F +P  IL T L+  L+L ++P ++ W  + A +  
Sbjct: 6   HTPGEALPPPSGHVGVWHWLRTRLFSSPLSILATVLLAWLVLMAVPALVEWALIGANFTA 65

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
           ++   C               ACWAFI +++   +FG YP  ++WRP+L  +    ++  
Sbjct: 66  TSAQECRQSE----------GACWAFIVEKHRLILFGTYPYDEQWRPLLATIILIAVIVC 115

Query: 133 MLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISM 192
             +  F +  L  + + GL    +  +  G LGL+ VE + WGGL +TL+++ FGI ++ 
Sbjct: 116 SGMRRFWKPSLALVWIVGLS-AVAVLMWGGVLGLTYVENARWGGLPLTLILATFGIALAF 174

Query: 193 PLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRA 252
           P G+LLALGR S +P ++  C+ +IEL RGVPL+++LFM+S+MLPLFLP+ + +DKLLRA
Sbjct: 175 PFGVLLALGRRSRMPAIKALCVVYIELIRGVPLISLLFMSSVMLPLFLPEGFSIDKLLRA 234

Query: 253 LLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVN 312
            + +  FA+AYIAE +RGGLQ+I KGQ+E A+SLGL+Y Q+MR +I+PQ +K VIP +V+
Sbjct: 235 QIAIIMFAAAYIAETVRGGLQAIPKGQYEGADSLGLTYWQQMRKVILPQALKIVIPPLVS 294

Query: 313 TFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLY 372
            FI LFKD+SL+ II +FDL    +   S++ W          +FI  ++++FCFS+S Y
Sbjct: 295 IFIALFKDTSLVVIIGIFDLTLAAKAALSDAAWRG--FGVEAYVFIALIYFVFCFSMSKY 352

Query: 373 SVFIEKTLHKGSKK 386
           S  +E  L  G ++
Sbjct: 353 SQALEHRLATGHQR 366


>gi|300898042|ref|ZP_07116413.1| ABC transporter, permease protein [Escherichia coli MS 198-1]
 gi|300358261|gb|EFJ74131.1| ABC transporter, permease protein [Escherichia coli MS 198-1]
          Length = 347

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 162/355 (45%), Positives = 225/355 (63%), Gaps = 14/355 (3%)

Query: 31  WIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDG 90
           W+ KN F +  + LLT   I L+   IP +++W FL A W+GS RT CT           
Sbjct: 3   WVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRTDCTKA--------- 53

Query: 91  WNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFG 150
              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM     P +     +   
Sbjct: 54  --GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPMFWKILPNRGRYIAVWAV 111

Query: 151 LFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVL 209
           ++P+   + +  G LGL  VET  WGGL +TL+I+  GI  ++P GILLALGR S++P++
Sbjct: 112 IYPLIVWWLMYGGFLGLERVETRQWGGLTLTLIIASVGIAGALPWGILLALGRRSHMPIV 171

Query: 210 RYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLR 269
           R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV  F SAY+AEV+R
Sbjct: 172 RILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVGVILFQSAYVAEVVR 231

Query: 270 GGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINM 329
           GGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I LFKD+SL+ II +
Sbjct: 232 GGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTIIALFKDTSLVIIIGL 291

Query: 330 FDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
           FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  +EK  + G 
Sbjct: 292 FDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQHLEKRFNTGR 344


>gi|322834720|ref|YP_004214747.1| polar amino acid ABC transporter inner membrane subunit [Rahnella
           sp. Y9602]
 gi|321169921|gb|ADW75620.1| polar amino acid ABC transporter, inner membrane subunit [Rahnella
           sp. Y9602]
          Length = 357

 Score =  251 bits (640), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 166/358 (46%), Positives = 228/358 (63%), Gaps = 14/358 (3%)

Query: 28  IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQ 87
            + W  KN F +  + LLT   + L+   IP +++WV   A W+G+ RT CT        
Sbjct: 10  AVLWARKNLFSSWFNSLLTLFCLWLMWLLIPPLLNWVIFQANWVGTARTDCTKA------ 63

Query: 88  PDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSIL 147
                 ACW FI+ R+ QF++G YP  QRWR  +  + G + L P+   + PR+      
Sbjct: 64  -----GACWVFIHARFGQFMYGLYPFDQRWRINVTLIVGLLTLAPIFFKAMPRRGRYIAC 118

Query: 148 LFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNI 206
              LFPIF++ +LYGG  GLS VET  WGGL +TL+I+  GI  ++PLGI+LAL R S++
Sbjct: 119 WMVLFPIFTWIMLYGGFLGLSRVETRQWGGLTLTLIIAAVGIAGALPLGIMLALARRSSL 178

Query: 207 PVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAE 266
           PV+R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV  F SAY+AE
Sbjct: 179 PVVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMTEGTSIDKLVRALVGVVLFQSAYVAE 238

Query: 267 VLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISI 326
           V+RGGLQ++ KGQ EAA SL L Y +   L+I+PQ +K VIPG+VNT I LFKD+SL+ I
Sbjct: 239 VVRGGLQALPKGQTEAAESLALGYWKTQGLVILPQALKMVIPGLVNTIIALFKDTSLVII 298

Query: 327 INMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
           I +FDL   V+    +  W+     T G +F   V+WIFCFS+S YS  +E+  H G 
Sbjct: 299 IGLFDLFSSVQQATVDPEWLG--MSTEGYVFAAAVYWIFCFSMSRYSQHLERRFHTGR 354


>gi|311109072|ref|YP_003981925.1| general L-amino acid transporter permease AAPM [Achromobacter
           xylosoxidans A8]
 gi|310763761|gb|ADP19210.1| general L-amino acid transport system permease protein AAPM
           [Achromobacter xylosoxidans A8]
          Length = 366

 Score =  251 bits (640), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 149/374 (39%), Positives = 226/374 (60%), Gaps = 13/374 (3%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
               +   PP    G  AW+    F +P +IL+T L+   LL ++P ++ W F+ A +  
Sbjct: 6   HIPAEGLPPPSTHVGFWAWLKSRLFSSPLNILITVLLAWFLLMAVPALVEWAFIKANFSA 65

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
           +N   C               ACWAFI +++   +FG YP  ++WRP++  +    ++  
Sbjct: 66  TNAQECRASG----------GACWAFIIEKHRLILFGTYPFDEQWRPLIATVILVAVIVC 115

Query: 133 MLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISM 192
             I  F   +  +++        +  +  G  GLS VE + WGGL +TL++S FGI  + 
Sbjct: 116 SGIRRFW-NWKLAVIWTVGLTAVALLMWGGVFGLSYVENARWGGLPLTLILSTFGIAFAF 174

Query: 193 PLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRA 252
           P+G+LLALGR S +P ++  C+ +IEL RGVPL+++LFM+S+MLPLFLP+ + +DKLLRA
Sbjct: 175 PIGVLLALGRRSKMPAIKALCVVYIELIRGVPLISLLFMSSVMLPLFLPEGFSIDKLLRA 234

Query: 253 LLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVN 312
            + +  FA+AYIAE +RGGLQ+I KGQ+E A+SLGL+Y Q+MR II+PQ +K VIP +V+
Sbjct: 235 QIAIIMFAAAYIAETVRGGLQAIPKGQYEGADSLGLNYWQQMRKIILPQALKIVIPPLVS 294

Query: 313 TFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLY 372
            FI LFKD+SL+ II +FDL    +   S++ W          +FI  ++++FCFS+S Y
Sbjct: 295 IFIALFKDTSLVVIIGIFDLTLAAKAALSDAAWRGFG--VEAYLFISLIYFVFCFSMSKY 352

Query: 373 SVFIEKTLHKGSKK 386
           S  +EK L  G  +
Sbjct: 353 SQALEKRLATGHAR 366


>gi|324009100|gb|EGB78319.1| ABC transporter, permease protein [Escherichia coli MS 57-2]
          Length = 347

 Score =  250 bits (639), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 162/355 (45%), Positives = 224/355 (63%), Gaps = 14/355 (3%)

Query: 31  WIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDG 90
           W+ KN F +  + LLT   I L+   IP +++W FL A W+GS R  CT           
Sbjct: 3   WVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRADCTKA--------- 53

Query: 91  WNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFG 150
              ACW FI++R+ QFI+G YP  QRWR  L  L G + + PM     P +     +   
Sbjct: 54  --GACWVFIHERFGQFIYGLYPHDQRWRINLALLIGLVSIAPMFWKILPHRGRYIAVWAV 111

Query: 151 LFP-IFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVL 209
           ++P +  + +  G LGL  VET  WGGL +TL+I+  GI  ++P GILLALGR S++P++
Sbjct: 112 IYPLVVWWLMYGGFLGLDRVETRQWGGLTLTLIIASVGIAGALPWGILLALGRRSHMPIV 171

Query: 210 RYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLR 269
           R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV  F SAY+AEV+R
Sbjct: 172 RILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVGVILFQSAYVAEVVR 231

Query: 270 GGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINM 329
           GGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I LFKD+SL+ II +
Sbjct: 232 GGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTIIALFKDTSLVIIIGL 291

Query: 330 FDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
           FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  +EK  + G 
Sbjct: 292 FDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQHLEKRFNTGR 344


>gi|296533469|ref|ZP_06896049.1| amino acid ABC superfamily ATP binding cassette transporter,
           permease protein [Roseomonas cervicalis ATCC 49957]
 gi|296266204|gb|EFH12249.1| amino acid ABC superfamily ATP binding cassette transporter,
           permease protein [Roseomonas cervicalis ATCC 49957]
          Length = 384

 Score =  250 bits (639), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 151/375 (40%), Positives = 216/375 (57%), Gaps = 5/375 (1%)

Query: 12  RKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWI 71
           +   L P  PP+   G +AW   N F       +T  ++ LL     G I W FL+A+W 
Sbjct: 15  QDAALAPRRPPLLAVGPVAWARANLFSGWLSTAVTLALLYLLARWTMGFIDWAFLNAIWS 74

Query: 72  GSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLT 131
                   T      +    + ACWA I +++   +FG YP  + WRP L  L    L  
Sbjct: 75  VPMVNG--TAQTQACRALQGSGACWAVIGEKHRFILFGTYPYEEHWRPALCVLLFIGLYI 132

Query: 132 PMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIIS 191
              +  F R  L  I       +    +  G LGLS V    WGGL++TL++S FGI  +
Sbjct: 133 VSAMRRFWRPALAVI-WVATLVVIGVLMWGGVLGLSYVPQERWGGLVITLILSTFGIAFA 191

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
            PL IL+ALGR S +P ++  CI ++EL RGVPL+++LFMAS+M PLFLP+  ++DKLLR
Sbjct: 192 FPLSILVALGRRSRMPAIKLLCILYVELIRGVPLISLLFMASVMFPLFLPEGINIDKLLR 251

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
           A + +  FA+AY+AEV+RGGLQ++ KGQ+EAA +LGLSY QK   II+PQ ++ VIP +V
Sbjct: 252 AQIAIILFAAAYLAEVVRGGLQALPKGQYEAAEALGLSYWQKTGFIILPQALRLVIPPLV 311

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISL 371
           NTFIG FKD+SL+ II +FDLL   +    E  W          + +G ++++FCF++S 
Sbjct: 312 NTFIGFFKDTSLVLIIGIFDLLTAGKTAIVEPAWQGFG--IEVYVVVGLIYFVFCFAMSR 369

Query: 372 YSVFIEKTLHKGSKK 386
           YS  +E  L++   +
Sbjct: 370 YSQNLEAELNRHRVR 384


>gi|83592338|ref|YP_426090.1| amino acid ABC transporter permease [Rhodospirillum rubrum ATCC
           11170]
 gi|83575252|gb|ABC21803.1| Amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine [Rhodospirillum rubrum ATCC 11170]
          Length = 365

 Score =  250 bits (639), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 172/373 (46%), Positives = 239/373 (64%), Gaps = 14/373 (3%)

Query: 15  LLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSN 74
                 PPV   G IAWI +N   +P +I LTAL + +++     ++ W  LDA +IG  
Sbjct: 6   PKAALPPPVQTTGPIAWIRQNLLSSPFNIALTALALWIVVSGGSSLVTWAILDATFIGEG 65

Query: 75  RTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPML 134
           +  C+              ACWAFI +R + F +G YP A+RWR  L FL  ++ L P  
Sbjct: 66  QDACS-----------NGGACWAFIINRLDFFTYGFYPAAERWRVNLGFLMLAVALVPQF 114

Query: 135 IPSFPRKFLNSILLFGLFPIFS-FFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMP 193
           I  F  +    +      P+ +   ++ G  GL  V+TS WGGL++TLV+++ GI+ ++P
Sbjct: 115 ITGFSGRRALGLFGLTALPVITGVLLVGGVFGLRPVDTSQWGGLMLTLVLAYVGIVAALP 174

Query: 194 LGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRAL 253
           LG++LALGR S++PV+R +C TFIEL+RGVPL++VLFMAS+MLPLFLP     DKLLRAL
Sbjct: 175 LGMVLALGRRSSMPVVRISCTTFIELWRGVPLISVLFMASVMLPLFLPTGVTFDKLLRAL 234

Query: 254 LGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNT 313
           +G++ F SAY+AEV+RGGLQ+I +GQFEAA++LGL + +   LII+PQ +K VIPG+VNT
Sbjct: 235 IGITLFQSAYMAEVIRGGLQAIPRGQFEAASALGLGFWRSTGLIILPQALKLVIPGVVNT 294

Query: 314 FIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYS 373
           FI LFKD++L+ II + D+LG V+    +  W        G IF GF FWIFCF +S YS
Sbjct: 295 FIALFKDTTLVLIIGLLDILGTVQSAIVDPAWSRV--AVEGYIFAGFCFWIFCFGMSRYS 352

Query: 374 VFIEKTLHKGSKK 386
             +E  LH G +K
Sbjct: 353 QALESKLHTGHRK 365


>gi|315289022|gb|EFU48420.1| ABC transporter, permease protein [Escherichia coli MS 110-3]
          Length = 347

 Score =  250 bits (638), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 162/355 (45%), Positives = 226/355 (63%), Gaps = 14/355 (3%)

Query: 31  WIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDG 90
           W+ KN F +  + LLT   I L+   IP +++WVFL A W+GS R  CT           
Sbjct: 3   WVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWVFLQANWVGSTRADCTK---------- 52

Query: 91  WNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFG 150
            + ACW FI++R+ QF++G YP  QRWR  L  L G + + PM     P +     +   
Sbjct: 53  -SGACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPMFWKILPHRSRYIAVWAV 111

Query: 151 LFP-IFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVL 209
           ++P +  + +  G LGL  VET  WGGL +TL+I+  GI  ++P GILLALGR S++P++
Sbjct: 112 IYPLVVWWLMYGGFLGLDRVETRQWGGLTLTLIIASVGIAGALPWGILLALGRRSHMPIV 171

Query: 210 RYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLR 269
           R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV  F SAY+AEV+R
Sbjct: 172 RILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVGVILFQSAYVAEVVR 231

Query: 270 GGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINM 329
           GGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I LFKD+SL+ II +
Sbjct: 232 GGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTIIALFKDTSLVIIIGL 291

Query: 330 FDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
           FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  +EK  + G 
Sbjct: 292 FDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQHLEKRFNTGR 344


>gi|300946950|ref|ZP_07161181.1| ABC transporter, permease protein [Escherichia coli MS 116-1]
 gi|300958248|ref|ZP_07170395.1| ABC transporter, permease protein [Escherichia coli MS 175-1]
 gi|300315066|gb|EFJ64850.1| ABC transporter, permease protein [Escherichia coli MS 175-1]
 gi|300453410|gb|EFK17030.1| ABC transporter, permease protein [Escherichia coli MS 116-1]
          Length = 347

 Score =  250 bits (638), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 159/355 (44%), Positives = 222/355 (62%), Gaps = 14/355 (3%)

Query: 31  WIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDG 90
           W+ KN F +  + LLT   I L+   IP +++W FL A W+GS R  CT           
Sbjct: 3   WVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRADCTKA--------- 53

Query: 91  WNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFG 150
              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM     P +         
Sbjct: 54  --GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPMFWKILPHRGRYIAAWAV 111

Query: 151 LFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVL 209
           ++P+   + +  G   L  VET  WGGL +TL+I+  GI  ++P GILLALGR S++P++
Sbjct: 112 IYPLIVWWLMYGGFFALERVETRQWGGLTLTLIIASVGIAGALPWGILLALGRRSHMPIV 171

Query: 210 RYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLR 269
           R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV  F SAY+AEV+R
Sbjct: 172 RILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVGVILFQSAYVAEVVR 231

Query: 270 GGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINM 329
           GGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I LFKD+SL+ II +
Sbjct: 232 GGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTIIALFKDTSLVIIIGL 291

Query: 330 FDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
           FDL   V+    +  W+     T G +F   ++WIFCFS+S YS ++EK  + G 
Sbjct: 292 FDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQYLEKRFNTGR 344


>gi|300928694|ref|ZP_07144212.1| ABC transporter, permease protein [Escherichia coli MS 187-1]
 gi|300463283|gb|EFK26776.1| ABC transporter, permease protein [Escherichia coli MS 187-1]
          Length = 347

 Score =  250 bits (637), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 159/355 (44%), Positives = 221/355 (62%), Gaps = 14/355 (3%)

Query: 31  WIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDG 90
           W+ KN F +  + LLT   I L+   IP +++W FL A W+GS R  CT           
Sbjct: 3   WVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRADCTKA--------- 53

Query: 91  WNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFG 150
              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM     P +         
Sbjct: 54  --GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPMFWKILPHRGRYIAAWAV 111

Query: 151 LFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVL 209
           ++P+   + +  G   L  VET  WGGL +TL+I+  GI  ++P GILLALGR S++P++
Sbjct: 112 IYPLIVWWLMYGGFFALERVETRQWGGLTLTLIIASVGIAGALPWGILLALGRRSHMPIV 171

Query: 210 RYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLR 269
           R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV  F SAY+AEV+R
Sbjct: 172 RILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVGVILFQSAYVAEVVR 231

Query: 270 GGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINM 329
           GGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I LFKD+SL+ II +
Sbjct: 232 GGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTIIALFKDTSLVIIIGL 291

Query: 330 FDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
           FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  +EK  + G 
Sbjct: 292 FDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQHLEKRFNTGR 344


>gi|149908406|ref|ZP_01897069.1| amino acid ABC transporter, permease protein [Moritella sp. PE36]
 gi|149808569|gb|EDM68504.1| amino acid ABC transporter, permease protein [Moritella sp. PE36]
          Length = 370

 Score =  250 bits (637), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 152/373 (40%), Positives = 228/373 (61%), Gaps = 19/373 (5%)

Query: 14  RLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGS 73
            + +    P   +G++ W+ +N F T  + LLT L    +  +IP ++ W+  DA W G+
Sbjct: 15  TMKEAKSAPSTSKGLVFWLRENLFSTIPNTLLTLLGFYFIYTTIPPLLDWMIFDATWSGT 74

Query: 74  NRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPM 133
              V                A W FI ++++QF++G YP +  WRP    L   I L  +
Sbjct: 75  KEEVVKE------------GARWIFIIEKFDQFMYGFYPESLHWRPN---LVAVISLAFV 119

Query: 134 LIPSFPRKFLNSILLFGLFPIFSF-FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISM 192
            +    +     +++  LFP   F  +  G  GL +V T  WGGL++T++++  GII S 
Sbjct: 120 FLVPRLKNIKVKLVIMLLFPFVCFVLISGGWFGLEVVGTEKWGGLMLTILVAAVGIIASF 179

Query: 193 PLGILLALGRNSNIP-VLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           P+GILLALGR S+   ++++ CI FIE  RGVPL+T+LFMAS++LPLF  D  D DKLLR
Sbjct: 180 PIGILLALGRQSDNMPIVKFLCIGFIEFIRGVPLITILFMASVVLPLFFSDGIDFDKLLR 239

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
           AL+G++ F +AYIAEV+RGGLQ+I KGQ+EA+ SLGL+Y Q M LII+PQ +K  IP +V
Sbjct: 240 ALIGITLFQAAYIAEVIRGGLQAIPKGQYEASESLGLTYWQGMILIILPQALKISIPNLV 299

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISL 371
            +FI LFKD++L+ II +FD+L +V +  S++ W+       G +F+  ++W+FCFS+S 
Sbjct: 300 GSFISLFKDTTLVLIIGLFDILAMVTLTNSDTNWLG--FEIEGYVFVTMIYWVFCFSMSQ 357

Query: 372 YSVFIEKTLHKGS 384
           YS  IE+  +   
Sbjct: 358 YSRVIERRYNTDH 370


>gi|307129009|ref|YP_003881025.1| membrane protein of an ABC superfamily putative amino-acid
           transporter [Dickeya dadantii 3937]
 gi|306526538|gb|ADM96468.1| membrane component of an ABC superfamily predicted amino-acid
           transporter [Dickeya dadantii 3937]
          Length = 364

 Score =  250 bits (637), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 163/370 (44%), Positives = 230/370 (62%), Gaps = 16/370 (4%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
             +  P+ +   I W  +N F +  + +LT   + LL   IP +++W  L A WIGS R 
Sbjct: 8   PSNPTPINR--AIVWARRNLFSSITNSVLTLACLWLLWTLIPPLLNWAILKANWIGSTRA 65

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            CT+           + ACW FI+ R+EQF++G YP  + WR     +   I + PM   
Sbjct: 66  DCTS-----------DGACWVFIHARFEQFMYGLYPREELWRINFALVLALISILPMFWR 114

Query: 137 SFPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
           + P +     +   ++P+   + +  G  GL+ VET  WGGL +T++I+  GI  ++PLG
Sbjct: 115 NLPHRGRYIAVWCVIYPLIAWWLLFGGFGGLTRVETRQWGGLTLTIIIAAIGIAGALPLG 174

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           ILLALGR SN+PVLR  C+ FIE +RGVPL+TVLFM+S+MLPLFL +  ++DKLLRAL+G
Sbjct: 175 ILLALGRRSNMPVLRALCVIFIEFWRGVPLITVLFMSSVMLPLFLTEGTNIDKLLRALVG 234

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           V  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I
Sbjct: 235 VILFQSAYVAEVVRGGLQALPKGQYEAAQSLALGYWRMQGLVILPQALKMVIPGLVNTII 294

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD+SL+ II +FDL   ++    +  W+     T G +F   ++WIFCFS+S YS  
Sbjct: 295 ALFKDTSLVIIIGLFDLFSSIQQATVDPAWLG--MSTEGYVFAAILYWIFCFSMSRYSQH 352

Query: 376 IEKTLHKGSK 385
           +EK    G K
Sbjct: 353 LEKRFDTGRK 362


>gi|209966387|ref|YP_002299302.1| general L-amino acid transport system permease protein AapM
           [Rhodospirillum centenum SW]
 gi|209959853|gb|ACJ00490.1| general L-amino acid transport system permease protein AapM
           [Rhodospirillum centenum SW]
          Length = 365

 Score =  250 bits (637), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 149/361 (41%), Positives = 216/361 (59%), Gaps = 13/361 (3%)

Query: 26  RGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGG 85
            G +AW+  N F T  + LLT L++ +   ++PG+I W   DAVWI  +   C       
Sbjct: 18  SGPLAWMRANLFSTWYNALLTLLVLWVAAQALPGVIAWALRDAVWIADDAAACRQAG--- 74

Query: 86  IQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNS 145
                   ACWAFI ++    +FG YP  Q WRP +  L    +L          + L  
Sbjct: 75  -------GACWAFIAEKARFILFGTYPYQQHWRPAVAMLAVIAMLLASADRRLWGRPLLL 127

Query: 146 ILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSN 205
           +   GL    +  +  G  GL  V T+ WGGL +TL ++  G+ ++ P  ILLALGR  +
Sbjct: 128 VWGLGLGVAGA-LMFGGFAGLDYVPTARWGGLPLTLALAVVGLAVAFPFSILLALGRTGD 186

Query: 206 IPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIA 265
           +PV++  C+ +IE  RGVPL+++LFMAS+M PLFLP    VDKLLRA +G+  FA+AY+A
Sbjct: 187 LPVVKAICVVYIEAVRGVPLISILFMASVMFPLFLPQGVTVDKLLRAQVGLILFAAAYLA 246

Query: 266 EVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLIS 325
           EV+RGGLQ+I KGQ+EAA +LGLSY Q+ RLII+PQ +  VIP +VNTFIG FKD+SL+ 
Sbjct: 247 EVVRGGLQAIPKGQYEAAAALGLSYWQRTRLIILPQALGLVIPPLVNTFIGFFKDTSLVI 306

Query: 326 IINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSK 385
           II + DLL   +   ++  W          +F+  +++ FCF++S YS+ +E+T  +G +
Sbjct: 307 IIGLMDLLSTAKTALTDPAWRGFYK--EAYLFVAAIYFTFCFALSRYSMHLERTFSQGRR 364

Query: 386 K 386
           +
Sbjct: 365 R 365


>gi|323178549|gb|EFZ64125.1| general L-amino acid transport system permease protein aapM
           [Escherichia coli 1180]
          Length = 347

 Score =  250 bits (637), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 160/355 (45%), Positives = 223/355 (62%), Gaps = 14/355 (3%)

Query: 31  WIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDG 90
           W+ KN F +  + LLT   I L+   IP +++W FL A W+GS R  CT           
Sbjct: 3   WVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRADCTKA--------- 53

Query: 91  WNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFG 150
              ACW FI++R+ QF++G YP  QR R  L  L G + + PM     P +     +   
Sbjct: 54  --GACWVFIHERFGQFMYGLYPHDQRRRINLALLIGLVSIAPMFWKILPHRGRYIAVWAV 111

Query: 151 LFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVL 209
           ++P+   + +  G  GL  VET  WGGL +TL+I+  GI  ++P GILLALGR S++P++
Sbjct: 112 IYPLIVWWLMYGGFFGLERVETRQWGGLTLTLIIASVGIAGALPWGILLALGRRSHMPIV 171

Query: 210 RYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLR 269
           R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV  F SAY+AEV+R
Sbjct: 172 RILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVGVILFQSAYVAEVVR 231

Query: 270 GGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINM 329
           GGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I LFKD+SL+ II +
Sbjct: 232 GGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTIIALFKDTSLVIIIGL 291

Query: 330 FDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
           FDL   V+    + TW+     T G +F   ++WIFCFS+S YS  +EK  + G 
Sbjct: 292 FDLFSSVQQATVDPTWLG--MSTEGYVFAALIYWIFCFSMSRYSQHLEKRFNTGR 344


>gi|300916767|ref|ZP_07133477.1| ABC transporter, permease protein [Escherichia coli MS 115-1]
 gi|300415953|gb|EFJ99263.1| ABC transporter, permease protein [Escherichia coli MS 115-1]
          Length = 347

 Score =  249 bits (636), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 159/355 (44%), Positives = 221/355 (62%), Gaps = 14/355 (3%)

Query: 31  WIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDG 90
           W+ KN F +  + LLT   I L+   IP +++W FL A W+GS R  CT           
Sbjct: 3   WVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRADCTKA--------- 53

Query: 91  WNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFG 150
              ACW FI+ R+ QF++G YP  QRWR  L  L G + + PM     P +         
Sbjct: 54  --GACWVFIHKRFGQFMYGLYPHDQRWRINLALLIGLVSIAPMFWKILPHRGRYIAAWAV 111

Query: 151 LFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVL 209
           ++P+   + +  G   L  VET  WGGL +TL+I+  GI  ++P GILLALGR S++P++
Sbjct: 112 IYPLIVWWLMYGGFFALERVETRQWGGLTLTLIIASVGIAGALPWGILLALGRRSHMPIV 171

Query: 210 RYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLR 269
           R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV  F SAY+AEV+R
Sbjct: 172 RILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVGVILFQSAYVAEVVR 231

Query: 270 GGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINM 329
           GGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I LFKD+SL+ II +
Sbjct: 232 GGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTIIALFKDTSLVIIIGL 291

Query: 330 FDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
           FDL   V+    +  W+     T G +F   ++WIFCFS+S YS ++EK  + G 
Sbjct: 292 FDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQYLEKRFNTGR 344


>gi|293605348|ref|ZP_06687733.1| general amino acid ABC superfamily ATP binding cassette
           transporter, permease protein [Achromobacter piechaudii
           ATCC 43553]
 gi|292816287|gb|EFF75383.1| general amino acid ABC superfamily ATP binding cassette
           transporter, permease protein [Achromobacter piechaudii
           ATCC 43553]
          Length = 367

 Score =  249 bits (636), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 148/374 (39%), Positives = 227/374 (60%), Gaps = 12/374 (3%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
              ++   PP  Q G  AW+      +P +IL+T L+   L+ S+P ++ W FL A +  
Sbjct: 6   HSFVEALPPPSTQVGAWAWVRSRLLSSPLNILITVLLAWFLMMSLPALVEWAFLKANFTA 65

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
           +N   C   +           ACWAFI +++   +FG YP  ++WRP++  L    ++  
Sbjct: 66  TNAMECRASAG---------GACWAFIIEKHRLILFGTYPFDEQWRPLIATLILIAVIVC 116

Query: 133 MLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISM 192
             +  F      +++  G     +  +  G  GL+ VE S WGGL +TL+++ FGI  + 
Sbjct: 117 SGMRRFW-NGKLALIWTGGLTAVALLMWGGVFGLTYVENSRWGGLPLTLILATFGIAFAF 175

Query: 193 PLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRA 252
           P+G+LLALGR S +P ++  C+ +IEL RGVPL+++LFM+S+MLPLFLP+ + +DKLLRA
Sbjct: 176 PIGVLLALGRRSKMPAIKALCVVYIELIRGVPLISLLFMSSVMLPLFLPEGFTIDKLLRA 235

Query: 253 LLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVN 312
            + +  FA+AYIAE +RGGLQ+I KGQ+E A+SLGL+Y Q+MR II+PQ +K VIP +V 
Sbjct: 236 QIAIIMFAAAYIAETVRGGLQAIPKGQYEGADSLGLNYWQQMRKIILPQALKIVIPPLVG 295

Query: 313 TFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLY 372
            FI LFKD+SL+ II +FDL    +   S++ W          +FI  ++++FC+S+S Y
Sbjct: 296 IFISLFKDTSLVVIIGIFDLTLAAKAALSDAAWRGFG--VEAYLFISLIYFVFCYSMSKY 353

Query: 373 SVFIEKTLHKGSKK 386
           S  +E+ L  G  +
Sbjct: 354 SQALEQRLATGHAR 367


>gi|301647046|ref|ZP_07246878.1| ABC transporter, permease protein [Escherichia coli MS 146-1]
 gi|301074796|gb|EFK89602.1| ABC transporter, permease protein [Escherichia coli MS 146-1]
          Length = 347

 Score =  247 bits (630), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 158/355 (44%), Positives = 221/355 (62%), Gaps = 14/355 (3%)

Query: 31  WIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDG 90
           W+ KN F +  + LLT   I L+   IP +++W FL A W+GS R  CT           
Sbjct: 3   WVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRADCTKA--------- 53

Query: 91  WNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFG 150
              ACW FI++R+ QF++  YP  QRWR  L  L G + + PM     P +         
Sbjct: 54  --GACWVFIHERFGQFMYRLYPHDQRWRINLALLIGLVSIAPMFWKILPHRGRYIAAWAV 111

Query: 151 LFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVL 209
           ++P+   + +  G   L  VET  WGGL +TL+I+  GI  ++P GILLALGR S++P++
Sbjct: 112 IYPLIVWWLMYGGFFALERVETRQWGGLTLTLIIASVGIAGALPWGILLALGRRSHMPIV 171

Query: 210 RYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLR 269
           R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV  F SAY+AEV+R
Sbjct: 172 RILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVGVILFQSAYVAEVVR 231

Query: 270 GGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINM 329
           GGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I LFKD+SL+ II +
Sbjct: 232 GGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTIIALFKDTSLVIIIGL 291

Query: 330 FDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
           FDL   V+    +  W+     T G +F   ++WIFCFS+S YS ++EK  + G 
Sbjct: 292 FDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQYLEKRFNTGR 344


>gi|218507774|ref|ZP_03505652.1| general L-amino acid ABC transporter, permease protein [Rhizobium
           etli Brasil 5]
          Length = 338

 Score =  247 bits (630), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 221/338 (65%), Positives = 270/338 (79%)

Query: 49  IICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIF 108
            +  + +++   + W+F+ AVW G +RT C T  QGGIQPDGW+ ACWAF+  + +QFI+
Sbjct: 1   AVVFIAWALLHAVDWLFVQAVWRGPDRTFCATAVQGGIQPDGWSGACWAFVKAKIDQFIY 60

Query: 109 GNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSI 168
           G YP+ +RWRP LV +   +LL PMLIPS PRK +N++LLFG  PI SFF+LYGG GL I
Sbjct: 61  GRYPLDERWRPTLVGILFVLLLVPMLIPSAPRKGVNALLLFGALPIVSFFLLYGGYGLEI 120

Query: 169 VETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTV 228
           VET LWGGLLVTLV+SF GI +S PLGI+LALGR S +PV+R  CI FIE+ RGVPL+TV
Sbjct: 121 VETPLWGGLLVTLVLSFVGIAVSFPLGIILALGRRSQMPVIRTVCIVFIEVVRGVPLITV 180

Query: 229 LFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGL 288
           LFMAS+MLPLFLP  W VDKLLRA++GVS FASAY+AEV+RGGLQ+I KGQFE A+SLGL
Sbjct: 181 LFMASVMLPLFLPAGWTVDKLLRAIIGVSIFASAYMAEVIRGGLQAIPKGQFEGADSLGL 240

Query: 289 SYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISS 348
            Y QKMRLIIMPQ IK VIPGIVNTFIG+FKD+SL+SII+MFDLLGIVR+NF +  W ++
Sbjct: 241 GYWQKMRLIIMPQAIKLVIPGIVNTFIGMFKDTSLVSIISMFDLLGIVRLNFVDPNWATA 300

Query: 349 VTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
           VTP TGLIF GF FW+FCF +S YS F+E+ L  G K+
Sbjct: 301 VTPLTGLIFAGFSFWLFCFGMSRYSAFMERHLDTGHKR 338


>gi|119946445|ref|YP_944125.1| ABC polar amino acid transporter inner membrane protein
           [Psychromonas ingrahamii 37]
 gi|119865049|gb|ABM04526.1| ABC polar amino acid transporter inner membrane protein
           [Psychromonas ingrahamii 37]
          Length = 359

 Score =  246 bits (629), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 155/372 (41%), Positives = 229/372 (61%), Gaps = 18/372 (4%)

Query: 14  RLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGS 73
              +    P   RG++ W+ +N F   K+ +LT L I ++   IP ++ W+  DA W G+
Sbjct: 5   TFKEAKAAPSTSRGVLFWLRENLFSDIKNSVLTLLGIYIVYIMIPPLLDWMIFDATWSGT 64

Query: 74  NRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPM 133
            + +              + A W FI ++++QF++G YP+A+ WRP    L G I +  +
Sbjct: 65  QKEI------------VNSGARWIFIIEKFDQFMYGFYPVAEHWRPN---LVGLISIAFL 109

Query: 134 LIPSFPRKFLNSILLFGLFPIFSF-FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISM 192
           L   F       + L  ++P   F  +  G  GL  V T  WGGL++T++++  GII S 
Sbjct: 110 LSLKFIPNIKVKLGLMLIYPFVCFVLISGGWFGLEEVPTEKWGGLMLTILVAAVGIIASF 169

Query: 193 PLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRA 252
           P+GI+LALGR S +P+L+  C+ FIE  RGVPL+T+LFMAS++LPLF  D  D DKLLRA
Sbjct: 170 PIGIVLALGRQSEMPILKTLCVGFIEFIRGVPLITILFMASVVLPLFFSDGIDFDKLLRA 229

Query: 253 LLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVN 312
           L+G++ F SAYIAEV+RGGLQ+I KGQ+EAA SLGL Y Q M LII+PQ +K  IP +V 
Sbjct: 230 LIGITLFQSAYIAEVIRGGLQAIPKGQYEAAESLGLGYWQGMLLIILPQALKISIPNLVG 289

Query: 313 TFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLY 372
           +FI LFKD++L+ II +FD+L +V +  S++ W+       G +F+  ++W+ CFS+S Y
Sbjct: 290 SFISLFKDTTLVLIIGLFDVLAMVTLTTSDALWLG--YEIEGYVFVTMIYWVCCFSMSQY 347

Query: 373 SVFIEKTLHKGS 384
           S  +E+  H   
Sbjct: 348 SKSVERKYHTEH 359


>gi|187479526|ref|YP_787551.1| L-amino acid ABC transporter permease [Bordetella avium 197N]
 gi|115424113|emb|CAJ50666.1| L-amino acid ABC transporter, permease protein [Bordetella avium
           197N]
          Length = 366

 Score =  246 bits (629), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 154/374 (41%), Positives = 229/374 (61%), Gaps = 13/374 (3%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
           +       PP+   G+  W+    F +P  IL T ++  L+L ++P +I W F+ A +  
Sbjct: 6   QTPRADLPPPMGHTGVWPWLKSRLFSSPLSILTTVILAWLILMAVPALIEWAFIRANFSA 65

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
           +    C               ACWAFI +++   +FG YP  ++WRP++       ++  
Sbjct: 66  TTAQECRASG----------GACWAFIVEKHRLILFGTYPYDEQWRPLIATFILIAVIVL 115

Query: 133 MLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISM 192
             +  F R  L  I + GL    +  +  G  GL+ VE S WGGL +TL++S FGI  + 
Sbjct: 116 SGMRRFWRPILALIWVVGLSL-VAILMWGGVFGLTFVENSRWGGLPLTLILSTFGIAFAF 174

Query: 193 PLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRA 252
           P+G+LLALGR SN+P ++  C+ +IEL RGVPL+++LFM+S+MLPLFLP+ + +DKLLRA
Sbjct: 175 PIGVLLALGRRSNMPAIKALCVVYIELIRGVPLISLLFMSSVMLPLFLPEGFSIDKLLRA 234

Query: 253 LLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVN 312
            + +  FA+AYIAE +RGGLQ+ISKGQ+E A+SLGLSY QKMR II+PQ +K VIP +V+
Sbjct: 235 QIAIILFAAAYIAETVRGGLQAISKGQYEGADSLGLSYWQKMRKIILPQALKVVIPPLVS 294

Query: 313 TFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLY 372
            FI LFKD+SL+ II +FDL    +   S++ W          +FI  ++++FCFS+S Y
Sbjct: 295 IFIALFKDTSLVVIIGIFDLTLAAKAALSDAAWRGFG--IEAYLFISLIYFVFCFSMSKY 352

Query: 373 SVFIEKTLHKGSKK 386
           S  +E+ L  G ++
Sbjct: 353 SQHLERRLATGHQR 366


>gi|218671516|ref|ZP_03521186.1| general L-amino acid ABC transporter, permease protein [Rhizobium
           etli GR56]
          Length = 339

 Score =  246 bits (628), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 223/338 (65%), Positives = 273/338 (80%)

Query: 49  IICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIF 108
            + ++ +++   I W+F+ AVW G +RT C T  QGGIQPDGWN ACWAF+  +++QFIF
Sbjct: 2   ALVVVGWALLHAIDWLFVQAVWTGPDRTFCATAVQGGIQPDGWNGACWAFVNAKFDQFIF 61

Query: 109 GNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSI 168
           G YP+ +RWRP LV +   +LL PMLIPS PRK +N++LLFG+ PI SFF+LYGG GL I
Sbjct: 62  GRYPLDERWRPTLVGILFVLLLVPMLIPSAPRKGINALLLFGVLPIVSFFLLYGGFGLEI 121

Query: 169 VETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTV 228
           VET LWGGLLVTLV+SF GI +S PLGI+LALGR S +PV+R  CI FIE+ RGVPL+TV
Sbjct: 122 VETPLWGGLLVTLVLSFVGIAVSFPLGIILALGRRSQMPVIRTVCIVFIEVVRGVPLITV 181

Query: 229 LFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGL 288
           LFMAS+MLPLFLP  W VDKLLRA++GVS FASAY+AEV+RGGLQ+I KGQFE A+SLGL
Sbjct: 182 LFMASVMLPLFLPAGWTVDKLLRAIIGVSIFASAYMAEVIRGGLQAIPKGQFEGADSLGL 241

Query: 289 SYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISS 348
            Y QKMRL+IMPQ IK VIPGIVNTFIG+FKD+SL+SII+MFDLLGIVR+NF +  W ++
Sbjct: 242 GYWQKMRLVIMPQAIKLVIPGIVNTFIGMFKDTSLVSIISMFDLLGIVRLNFVDPNWATA 301

Query: 349 VTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
           VTP TGLIF GF FW+FCF +S YS F+E+ L  G K+
Sbjct: 302 VTPLTGLIFAGFAFWLFCFGMSRYSAFVERHLDTGHKR 339


>gi|119946449|ref|YP_944129.1| ABC polar amino acid transporter inner membrane protein
           [Psychromonas ingrahamii 37]
 gi|119865053|gb|ABM04530.1| ABC polar amino acid transporter inner membrane protein
           [Psychromonas ingrahamii 37]
          Length = 359

 Score =  246 bits (627), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 155/372 (41%), Positives = 229/372 (61%), Gaps = 18/372 (4%)

Query: 14  RLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGS 73
              +    P   RG++ W+ +N F   K+ +LT L I ++   IP ++ W+  DA W G+
Sbjct: 5   TFKEAKAAPSTSRGVLFWLRENLFSDIKNSVLTLLGIYIVYIMIPPLLDWMIFDATWSGT 64

Query: 74  NRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPM 133
            + +              + A W FI ++++QF++G YP+A+ WRP    L G I +  +
Sbjct: 65  QKEI------------VNSGARWIFIIEKFDQFMYGFYPVAEDWRPN---LVGLISIAFL 109

Query: 134 LIPSFPRKFLNSILLFGLFPIFSF-FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISM 192
           L   F       + L  ++P   F  +  G  GL  V T  WGGL++T++++  GII S 
Sbjct: 110 LSLKFIPNIKVKLGLMLIYPFVCFVLISGGWFGLEEVPTEKWGGLMLTILVAAVGIIASF 169

Query: 193 PLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRA 252
           P+GI+LALGR S +P+L+  C+ FIE  RGVPL+T+LFMAS++LPLF  D  D DKLLRA
Sbjct: 170 PIGIVLALGRQSEMPILKTLCVGFIEFIRGVPLITILFMASVVLPLFFSDGIDFDKLLRA 229

Query: 253 LLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVN 312
           L+G++ F SAYIAEV+RGGLQ+I KGQ+EAA SLGL Y Q M LII+PQ +K  IP +V 
Sbjct: 230 LIGITLFQSAYIAEVIRGGLQAIPKGQYEAAESLGLGYWQGMLLIILPQALKISIPNLVG 289

Query: 313 TFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLY 372
           +FI LFKD++L+ II +FD+L +V +  S++ W+       G +F+  ++W+ CFS+S Y
Sbjct: 290 SFISLFKDTTLVLIIGLFDVLAMVTLTTSDALWLG--YEIEGYVFVTMIYWVCCFSMSQY 347

Query: 373 SVFIEKTLHKGS 384
           S  +E+  H   
Sbjct: 348 SKSVERKYHTEH 359


>gi|242241101|ref|YP_002989282.1| polar amino acid ABC transporter inner membrane subunit [Dickeya
           dadantii Ech703]
 gi|242133158|gb|ACS87460.1| polar amino acid ABC transporter, inner membrane subunit [Dickeya
           dadantii Ech703]
          Length = 362

 Score =  244 bits (623), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 159/365 (43%), Positives = 226/365 (61%), Gaps = 14/365 (3%)

Query: 22  PVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTV 81
           P      IAW  +N F +  + +LT + + LL   +P +++W    A WIG +R  CT  
Sbjct: 9   PTPVNNAIAWARRNLFSSVTNSILTLVCLWLLWELLPPLLNWAIFKASWIGDSRGDCT-- 66

Query: 82  SQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRK 141
                     + ACW FI+ R+ QF++G YP  + WR     +   I + PM   + P +
Sbjct: 67  ---------PDGACWVFIHARFSQFMYGLYPREEIWRINFALVLALISILPMFWRALPHR 117

Query: 142 FLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLAL 200
                +   ++P+   + +  G  GL  VET  WGGL +T++I+  GI  ++PLGILLAL
Sbjct: 118 GRYIAVWCVVYPLLAWWLLFGGFGGLPRVETRQWGGLTLTIIIAAIGIAGALPLGILLAL 177

Query: 201 GRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFA 260
           GR SN+P+LR  C+ FIE +RGVPL+TVLFM+S+MLPLFL +  ++DKLLRAL+GV  F 
Sbjct: 178 GRRSNMPILRSLCVIFIEFWRGVPLITVLFMSSVMLPLFLTEGTNIDKLLRALVGVILFQ 237

Query: 261 SAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKD 320
           SAY+AEV+RGGLQ++ KGQ+EAA +L L Y +   L+I+PQ +K VIPG+VNT I LFKD
Sbjct: 238 SAYVAEVVRGGLQALPKGQYEAAQALALGYWRMQGLVILPQALKLVIPGLVNTIIALFKD 297

Query: 321 SSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTL 380
           +SL+ II +FDL   ++    + TW+     T G +F   ++WIFCFS+S YS  +EK  
Sbjct: 298 TSLVIIIGLFDLFSSIQQATVDPTWLG--MSTEGYVFAAILYWIFCFSMSRYSQHLEKRF 355

Query: 381 HKGSK 385
             G K
Sbjct: 356 DTGHK 360


>gi|168752392|ref|ZP_02777414.1| general L-amino acid transport system permease protein AapM
           [Escherichia coli O157:H7 str. EC4113]
 gi|168758502|ref|ZP_02783509.1| general L-amino acid transport system permease protein AapM
           [Escherichia coli O157:H7 str. EC4401]
 gi|168769136|ref|ZP_02794143.1| general L-amino acid transport system permease protein AapM
           [Escherichia coli O157:H7 str. EC4486]
 gi|168783841|ref|ZP_02808848.1| general L-amino acid transport system permease protein AapM
           [Escherichia coli O157:H7 str. EC4076]
 gi|187776437|ref|ZP_02802695.2| general L-amino acid transport system permease protein AapM
           [Escherichia coli O157:H7 str. EC4196]
 gi|195940014|ref|ZP_03085396.1| putative transport system permease protein [Escherichia coli
           O157:H7 str. EC4024]
 gi|208807701|ref|ZP_03250038.1| general L-amino acid transport system permease protein AapM
           [Escherichia coli O157:H7 str. EC4206]
 gi|208814609|ref|ZP_03255938.1| general L-amino acid transport system permease protein AapM
           [Escherichia coli O157:H7 str. EC4045]
 gi|208819421|ref|ZP_03259741.1| general L-amino acid transport system permease protein AapM
           [Escherichia coli O157:H7 str. EC4042]
 gi|209398401|ref|YP_002272732.1| general L-amino acid transport system permease protein AapM
           [Escherichia coli O157:H7 str. EC4115]
 gi|254795212|ref|YP_003080049.1| putative amino-acid ABC transporter membrane protein [Escherichia
           coli O157:H7 str. TW14359]
 gi|187767132|gb|EDU30976.1| general L-amino acid transport system permease protein AapM
           [Escherichia coli O157:H7 str. EC4196]
 gi|188013749|gb|EDU51871.1| general L-amino acid transport system permease protein AapM
           [Escherichia coli O157:H7 str. EC4113]
 gi|188998879|gb|EDU67865.1| general L-amino acid transport system permease protein AapM
           [Escherichia coli O157:H7 str. EC4076]
 gi|189354675|gb|EDU73094.1| general L-amino acid transport system permease protein AapM
           [Escherichia coli O157:H7 str. EC4401]
 gi|189361796|gb|EDU80215.1| general L-amino acid transport system permease protein AapM
           [Escherichia coli O157:H7 str. EC4486]
 gi|208727502|gb|EDZ77103.1| general L-amino acid transport system permease protein AapM
           [Escherichia coli O157:H7 str. EC4206]
 gi|208735886|gb|EDZ84573.1| general L-amino acid transport system permease protein AapM
           [Escherichia coli O157:H7 str. EC4045]
 gi|208739544|gb|EDZ87226.1| general L-amino acid transport system permease protein AapM
           [Escherichia coli O157:H7 str. EC4042]
 gi|209159801|gb|ACI37234.1| general L-amino acid transport system permease protein AapM
           [Escherichia coli O157:H7 str. EC4115]
 gi|254594612|gb|ACT73973.1| predicted amino-acid transporter subunit, membrane component of ABC
           superfamily [Escherichia coli O157:H7 str. TW14359]
          Length = 362

 Score =  244 bits (622), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 157/358 (43%), Positives = 218/358 (60%), Gaps = 14/358 (3%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
                       + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS R 
Sbjct: 9   PSRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRA 68

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM   
Sbjct: 69  DCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPMFWK 117

Query: 137 SFPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
             P +     +   ++P+   + +  G   L  VET  WGGL +TL+I+  GI  ++P G
Sbjct: 118 ILPHRGRYIAVWAVIYPLIVWWLMYGGFFALERVETRQWGGLTLTLIIASVGIAGALPWG 177

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           ILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKLLRAL+G
Sbjct: 178 ILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLLRALVG 237

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           V  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I
Sbjct: 238 VILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTII 297

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYS 373
            LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS
Sbjct: 298 ALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYS 353


>gi|90409068|ref|ZP_01217193.1| amino acid ABC transporter, permease protein [Psychromonas sp.
           CNPT3]
 gi|90309825|gb|EAS37985.1| amino acid ABC transporter, permease protein [Psychromonas sp.
           CNPT3]
          Length = 359

 Score =  243 bits (621), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 160/372 (43%), Positives = 233/372 (62%), Gaps = 16/372 (4%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
            +++     P   RGII W+ +N F   K+ +LT + + LL  ++P +++W+  DA W G
Sbjct: 4   HKIINARHAPSTSRGIIFWLRENLFPNLKNSILTLVGLYLLSITLPPLLNWMIFDATWSG 63

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
           +   +              + A W FI ++++ FI+G YP +  WRP LV L     L  
Sbjct: 64  TQAEI------------SKDGARWIFIIEKFDLFIYGFYPESLHWRPDLVVLITIAFLA- 110

Query: 133 MLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISM 192
             +   P   +   ++     I  F +  G  GL  V T  WGGL++TL+++  GII+S 
Sbjct: 111 -CVKWLPHFKIKVFIILIYPFICFFLISGGVFGLEHVATEKWGGLMLTLIVAAVGIIVSF 169

Query: 193 PLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRA 252
           P+GI+LALGR S++P+L++ CITFIE  RGVPL+T+LFMAS++LPLF  D  D DKLLRA
Sbjct: 170 PIGIVLALGRQSDLPILKFFCITFIEFIRGVPLITILFMASVILPLFFHDGIDFDKLLRA 229

Query: 253 LLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVN 312
           L+G++ F SAYIAEV+RGGLQ+I KGQ+EAA SLGLSY + M LII+PQ +K  IP +V 
Sbjct: 230 LIGITLFQSAYIAEVIRGGLQAIPKGQYEAAKSLGLSYWKGMLLIILPQALKISIPNLVG 289

Query: 313 TFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLY 372
           +FI LFKD++L+ II +FD+L +V +  S+S W+       G +F+  ++WIFCFS+S Y
Sbjct: 290 SFISLFKDTTLVLIIGLFDVLAMVTLTNSDSDWLG--YEIEGYVFVTMIYWIFCFSMSQY 347

Query: 373 SVFIEKTLHKGS 384
           S  IE+  +   
Sbjct: 348 SKHIEQKFNTEH 359


>gi|123444013|ref|YP_001007983.1| ABC transporter permease [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|122090974|emb|CAL13857.1| Putative ABC transporter permease protein [Yersinia enterocolitica
           subsp. enterocolitica 8081]
          Length = 369

 Score =  243 bits (619), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 163/378 (43%), Positives = 230/378 (60%), Gaps = 20/378 (5%)

Query: 14  RLLQPSLPPVYQRG------IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLD 67
            +     PP   R       ++ W  KN F +  + LLT L + L+   IP +++W   +
Sbjct: 2   TMTLTREPPSTVRPGNPLSRVVFWAKKNLFSSWTNSLLTLLCLWLMWQLIPPLLNWAVFN 61

Query: 68  AVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGS 127
           A W+G+ RT CT              ACW FI+ R+ QF++G YP+ QRWR     + G 
Sbjct: 62  ANWLGTTRTDCTQE-----------GACWVFIHARFGQFMYGLYPIEQRWRINTTLIIGL 110

Query: 128 ILLTPMLIPSFPRKFLNSILLFGLFPIFSFFV-LYGGLGLSIVETSLWGGLLVTLVISFF 186
           + L P+   + P +     +   ++P+  + +   G  GL+ VET  WGGL +TL+I+  
Sbjct: 111 VTLIPLFWRAMPGRGRYLAVWAVVYPLLVWVMLYGGFFGLTRVETRQWGGLTLTLIIAAV 170

Query: 187 GIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDV 246
           GI  ++PLGILLAL R S++PV+R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +
Sbjct: 171 GIAGALPLGILLALARRSSMPVVRILSVVFIEFWRGVPLITVLFMSSVMLPLFMTEGTSI 230

Query: 247 DKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRV 306
           DKL+RAL+GV  F SAY+AEV+RGGLQ++ KGQ EAA SLGL Y +   L+I+PQ +K V
Sbjct: 231 DKLIRALVGVVLFQSAYVAEVVRGGLQALPKGQTEAAESLGLGYWKTQGLVILPQALKMV 290

Query: 307 IPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFC 366
           IPG+VNT I LFKD+SL+ II +FDL   V+    +  W+     T G +F   V+WIFC
Sbjct: 291 IPGLVNTIIALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAAAVYWIFC 348

Query: 367 FSISLYSVFIEKTLHKGS 384
           FS+S YS  +EK  H G 
Sbjct: 349 FSMSRYSQHLEKRFHTGR 366


>gi|332163170|ref|YP_004299747.1| ABC transporter permease [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|325667400|gb|ADZ44044.1| ABC transporter permease [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330862827|emb|CBX72968.1| inner membrane amino-acid ABC transporter permease protein yhdY
           [Yersinia enterocolitica W22703]
          Length = 367

 Score =  243 bits (619), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 160/358 (44%), Positives = 226/358 (63%), Gaps = 14/358 (3%)

Query: 28  IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQ 87
           ++ W  KN F +  + LLT L + L+   IP +++W   +A W+G+ RT CT        
Sbjct: 20  VVFWAKKNLFSSWTNSLLTLLCLWLMWQLIPPLLNWAVFNANWLGTTRTDCT-------- 71

Query: 88  PDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSIL 147
                 ACW FI+ R+ QF++G YP+ QRWR     + G + LTP+   + P +     +
Sbjct: 72  ---REGACWVFIHARFGQFMYGLYPIEQRWRINTTLIIGLVTLTPLFWRTMPGRRRYLAV 128

Query: 148 LFGLFPIFSFFV-LYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNI 206
              ++P+  + +   G  GL+ VET  WGGL +TL+I+  GI  ++PLGILLAL R S++
Sbjct: 129 WAVVYPLLVWVMLYGGFFGLNRVETRQWGGLTLTLIIAAVGIAGALPLGILLALARRSSM 188

Query: 207 PVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAE 266
           PV+R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV  F SAY+AE
Sbjct: 189 PVVRILSVVFIEFWRGVPLITVLFMSSVMLPLFMTEGTSIDKLIRALVGVVLFQSAYVAE 248

Query: 267 VLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISI 326
           V+RGGLQ++ KGQ EA  SLGL Y +   L+I+PQ +K VIPG+VNT I LFKD+SL+ I
Sbjct: 249 VVRGGLQALPKGQTEATESLGLGYWKTQGLVILPQALKMVIPGLVNTIIALFKDTSLVII 308

Query: 327 INMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
           I +FDL   V+    +  W+     T G +F   V+WIFCFS+S YS  +EK  H G 
Sbjct: 309 IGLFDLFSSVQQATVDPAWLG--MSTEGYVFAAAVYWIFCFSMSRYSQHLEKRFHTGR 364


>gi|318603944|emb|CBY25442.1| glutamate aspartate transport system permease protein GltK
           [Yersinia enterocolitica subsp. palearctica Y11]
          Length = 369

 Score =  243 bits (619), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 163/378 (43%), Positives = 230/378 (60%), Gaps = 20/378 (5%)

Query: 14  RLLQPSLPPVYQRG------IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLD 67
            +     PP   R       ++ W  KN F +  + LLT L + L+   IP +++W   +
Sbjct: 2   TMTLTREPPSTLRPGNPLSRVVFWAKKNLFSSWTNSLLTLLCLWLMWQLIPPLLNWAVFN 61

Query: 68  AVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGS 127
           A W+G+ RT CT              ACW FI+ R+ QF++G YP+ QRWR     + G 
Sbjct: 62  ANWLGTTRTDCT-----------REGACWVFIHARFGQFMYGLYPIEQRWRINTTLIIGL 110

Query: 128 ILLTPMLIPSFPRKFLNSILLFGLFPIFSFFV-LYGGLGLSIVETSLWGGLLVTLVISFF 186
           + LTP+   + P +     +   ++P+  + +   G  GL+ VET  WGGL +TL+I+  
Sbjct: 111 VTLTPLFWRTMPGRGRYLAVWAVVYPLLVWVMLYGGFFGLNRVETRQWGGLTLTLIIAAV 170

Query: 187 GIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDV 246
           GI  ++PLGILLAL R S++PV+R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +
Sbjct: 171 GIAGALPLGILLALARRSSMPVVRILSVVFIEFWRGVPLITVLFMSSVMLPLFMTEGTSI 230

Query: 247 DKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRV 306
           DKL+RAL+GV  F SAY+AEV+RGGLQ++ KGQ EA  SLGL Y +   L+I+PQ +K V
Sbjct: 231 DKLIRALVGVVLFQSAYVAEVVRGGLQALPKGQTEATESLGLGYWKTQGLVILPQALKMV 290

Query: 307 IPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFC 366
           IPG+VNT I LFKD+SL+ II +FDL   V+    +  W+     T G +F   V+WIFC
Sbjct: 291 IPGLVNTIIALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAAAVYWIFC 348

Query: 367 FSISLYSVFIEKTLHKGS 384
           FS+S YS  +EK  H G 
Sbjct: 349 FSMSRYSQHLEKRFHTGR 366


>gi|254512274|ref|ZP_05124341.1| amino acid ABC transporter, permease protein [Rhodobacteraceae
           bacterium KLH11]
 gi|221535985|gb|EEE38973.1| amino acid ABC transporter, permease protein [Rhodobacteraceae
           bacterium KLH11]
          Length = 432

 Score =  241 bits (614), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 140/438 (31%), Positives = 223/438 (50%), Gaps = 64/438 (14%)

Query: 3   DSCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIH 62
            +     +V +  + P+ PP  + GI+ W+  N F    + +LT   + L+   + G++ 
Sbjct: 4   QTTNPIAFVAEGTIPPAPPPANETGIVKWLRDNLFSGVANTVLTLASLTLIYLLLKGVVP 63

Query: 63  WVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGN-YPMAQRWRPIL 121
           W   + VW  S+   C  +  G       + AC+A + +R+ Q I+G  YP    WRP L
Sbjct: 64  W-VFNGVWDASSLAECREILAG------KSGACFAVLSERWPQLIYGFKYPADAYWRPNL 116

Query: 122 VFLTGSILLTPMLIPSFPRKFL-----NSILLFGLFPIFSFFVL---------------- 160
            F+   + + P+L    PRK L        + F L    +                    
Sbjct: 117 AFVLMLVAVAPVLFFDLPRKMLIFTALYPFIAFWLIWGGTILAPLVALVGFVVAGAVFQK 176

Query: 161 --------------------------------YGGLGLSIVETSLWGGLLVTLVISFFGI 188
                                                L  V +   GG ++ +++    +
Sbjct: 177 LGKNSFAAGFFGAIIVALVVWKIGGALIPEGASENAWLPAVPSRDLGGFMLNMMLGVTCV 236

Query: 189 IISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDK 248
            +S+PLGI LALGR S++P++++ C+ FIE  RGVPL+T+LF+AS+ML  F P    VD 
Sbjct: 237 SLSVPLGIALALGRQSDMPLIKWICVIFIEFIRGVPLITLLFVASVMLSYFFPPGSSVDL 296

Query: 249 LLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIP 308
            LR ++ ++ F++AYIAEV+RGGL ++ +GQ+EAA+SLGL Y Q MRLII+PQ +K  IP
Sbjct: 297 FLRVMIMITMFSAAYIAEVIRGGLAALPRGQYEAADSLGLDYPQAMRLIILPQALKISIP 356

Query: 309 GIVNTFIGLFKDSSLISIINMFDLLGIVRV-NFSESTWISSVTPTTGLIFIGFVFWIFCF 367
           GIVN  +GLFKD++L+S+I+MFDL+G++R    + + W           F   +F++ C+
Sbjct: 357 GIVNVAVGLFKDTTLVSVISMFDLVGMIRGPILASTEWNGVYW--ELFGFAALLFFVVCY 414

Query: 368 SISLYSVFIEKTLHKGSK 385
           SIS YS ++E+ L    +
Sbjct: 415 SISQYSQWLERRLATDHR 432


>gi|163733774|ref|ZP_02141216.1| amino acid ABC transporter, permease protein [Roseobacter litoralis
           Och 149]
 gi|161392885|gb|EDQ17212.1| amino acid ABC transporter, permease protein [Roseobacter litoralis
           Och 149]
          Length = 432

 Score =  241 bits (614), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 138/441 (31%), Positives = 225/441 (51%), Gaps = 65/441 (14%)

Query: 1   MIDSCK-EFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPG 59
           M D+ +    +VR   +    PP+   G + W+ +N F TP + +LT +    +   + G
Sbjct: 1   MTDTSQHSASFVRTETIPERAPPLAASGPVKWMRENLFATPANSVLTIVAAYFIYLILAG 60

Query: 60  IIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGN-YPMAQRWR 118
            + W+ L+ VW   + + C  V  G +       AC++ + +R+ Q +FG  YP    WR
Sbjct: 61  TLPWL-LNGVWSTDSLSECRDVLDGAV------GACFSVLTERWNQLLFGFQYPSELYWR 113

Query: 119 PILVFLTGSILLTPMLIPSFPRKF------------------------------------ 142
           P L  +   I   P+L    PRK                                     
Sbjct: 114 PGLALILLFIAGAPVLFFDLPRKLLIFTALYPFIAYYLIWGGALGVPVLALVGCVAGYLV 173

Query: 143 -----------------LNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISF 185
                            + ++ ++ L  +           ++ V +   GG ++ +++  
Sbjct: 174 YRRFVTGNFAIGFFGGIVAAVFVWILGGLLIPENANETAMMTAVPSRDLGGFMLNMMLGV 233

Query: 186 FGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWD 245
             + +S+PLGI+LALGR S++P++++ C+ FIE  RGVPL+T+LF+AS+ML  F P    
Sbjct: 234 TCVSLSVPLGIVLALGRQSSMPLIKWICVIFIEFIRGVPLITLLFVASVMLAYFFPPEST 293

Query: 246 VDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKR 305
           VD  LR ++ ++ F+SAYIAEV+RGGL ++ KGQ+E A+SLGL Y Q  RLII+PQ +K 
Sbjct: 294 VDLFLRVVIMITMFSSAYIAEVIRGGLAALPKGQYEGADSLGLDYTQATRLIILPQALKI 353

Query: 306 VIPGIVNTFIGLFKDSSLISIINMFDLLGIVRV-NFSESTWISSVTPTTGLIFIGFVFWI 364
            IPGIVN  +GLFKD++L+S+I+MFDL+G++R    + + W           F   +F++
Sbjct: 354 SIPGIVNVAVGLFKDTTLVSVISMFDLVGMIRGPILASTDWGGVYW--ELYGFAALLFFV 411

Query: 365 FCFSISLYSVFIEKTLHKGSK 385
            C+ IS YS ++E+ L    +
Sbjct: 412 VCYGISQYSQWLERRLATDHR 432


>gi|260432482|ref|ZP_05786453.1| glutamate/glutamine/aspartate/asparagine transport system
           permeaseprotein BztC [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260416310|gb|EEX09569.1| glutamate/glutamine/aspartate/asparagine transport system
           permeaseprotein BztC [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 432

 Score =  241 bits (614), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 138/438 (31%), Positives = 222/438 (50%), Gaps = 64/438 (14%)

Query: 3   DSCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIH 62
            +     +V +  + PS PP  + G++ W+ +N F    + +LT   + L+   +   + 
Sbjct: 4   QTTNSIAFVAEGTIPPSPPPANETGVVKWLRENLFSGVGNSILTIASVLLIYVVLKNTLP 63

Query: 63  WVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGN-YPMAQRWRPIL 121
           W   + VW   + + C  +  G         AC+A + +R+ Q I+G  YP+   WRP L
Sbjct: 64  W-IFNGVWNADSLSQCREILGG------KTGACFAVLAERWNQLIYGFKYPVEAYWRPNL 116

Query: 122 VFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFF----------------------- 158
            FL   +   P+L    PRK L    ++     +  +                       
Sbjct: 117 AFLLMLVAAAPVLFFDLPRKMLLFTAVYPFVAFWLIWGGTVLVPLVALFGCVAAAVVFQK 176

Query: 159 ------------------------------VLYGGLGLSIVETSLWGGLLVTLVISFFGI 188
                                                L+ V +   GG ++ L++    +
Sbjct: 177 YGKNSFAAGFFGGIVVALIVWKVGGALISESASENAWLTAVPSRDLGGFMLNLMLGVTCV 236

Query: 189 IISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDK 248
            +S+PLGI LALGR S++P++++ C+ FIE  RGVPL+T+LF+AS+ML  F P    VD 
Sbjct: 237 SLSLPLGIALALGRQSDMPLIKWVCVIFIEFIRGVPLITLLFVASVMLAYFFPPDSTVDL 296

Query: 249 LLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIP 308
            LR ++ ++ F++AYIAEV+RGGL ++ +GQ+EAA+SLGL Y Q MRLII+PQ +K  IP
Sbjct: 297 FLRVVIMITMFSAAYIAEVIRGGLAALPRGQYEAADSLGLDYAQAMRLIILPQALKISIP 356

Query: 309 GIVNTFIGLFKDSSLISIINMFDLLGIVRV-NFSESTWISSVTPTTGLIFIGFVFWIFCF 367
           GIVN  +GLFKD++L+S+I+MFDL+G++R    + + W         L F   +F++ C+
Sbjct: 357 GIVNVAVGLFKDTTLVSVISMFDLVGMIRGPILASTEWNGVYW--ELLGFAALLFFVVCY 414

Query: 368 SISLYSVFIEKTLHKGSK 385
            IS YS ++E+ L    +
Sbjct: 415 GISQYSQWLERRLATDHR 432


>gi|110678763|ref|YP_681770.1| amino acid ABC transporter, permease protein [Roseobacter
           denitrificans OCh 114]
 gi|109454879|gb|ABG31084.1| amino acid ABC transporter, permease protein [Roseobacter
           denitrificans OCh 114]
          Length = 432

 Score =  240 bits (613), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 140/441 (31%), Positives = 227/441 (51%), Gaps = 65/441 (14%)

Query: 1   MIDSCK-EFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPG 59
           M D+ +    +VR   +    PPV   G + W+ +N F TP + +LT + +  +   + G
Sbjct: 1   MTDTNQHSASFVRTETIPERAPPVTASGPVKWVRENLFATPANSVLTIIALYFIYLLLAG 60

Query: 60  IIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGN-YPMAQRWR 118
            + W+ L+ VW  S+ + C  V  G +       AC++ + +R  Q +FG  YP    WR
Sbjct: 61  SLPWL-LNGVWTTSSLSECREVLGGAV------GACFSVLTERLNQLLFGFQYPSELYWR 113

Query: 119 PILVFLTGSILLTPMLIPSFPRKFLN---------------------------------- 144
           P L  +   +   P+L    PRK L                                   
Sbjct: 114 PALALVLLFVAGAPVLFFDLPRKLLIFTALYPFIAYYLIWGGALGVPVLALVGCVAGYLV 173

Query: 145 -------------------SILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISF 185
                              +++++ L  +           ++ V +   GG ++ +++  
Sbjct: 174 YSRFVAGSFAKGFFGGIAAALIVWNLGGLLIPENANDTAMMTAVPSRDLGGFMLNMMLGV 233

Query: 186 FGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWD 245
             + +S+PLGI+LALGR S++P++++ C+ FIE  RGVPL+T+LF+AS+ML  F P    
Sbjct: 234 TCVSLSVPLGIVLALGRQSSMPLIKWICVIFIEFIRGVPLITLLFVASVMLAYFFPPEST 293

Query: 246 VDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKR 305
           VD  LR ++ ++ F+SAYIAEV+RGGL ++ KGQ+E A+SLGL Y Q  RLII+PQ +K 
Sbjct: 294 VDLFLRVVIMITMFSSAYIAEVIRGGLAALPKGQYEGADSLGLDYAQATRLIILPQALKI 353

Query: 306 VIPGIVNTFIGLFKDSSLISIINMFDLLGIVRV-NFSESTWISSVTPTTGLIFIGFVFWI 364
            IPGIVN  +GLFKD++L+S+I+MFDL+G++R    + + W           F   +F++
Sbjct: 354 SIPGIVNVAVGLFKDTTLVSVISMFDLVGMIRGPILASTDWAGVYW--ELYGFAALLFFV 411

Query: 365 FCFSISLYSVFIEKTLHKGSK 385
            C+ IS YS ++E+ L    +
Sbjct: 412 VCYGISQYSQWLERRLATDHR 432


>gi|224367655|ref|YP_002601818.1| AapM [Desulfobacterium autotrophicum HRM2]
 gi|223690371|gb|ACN13654.1| AapM [Desulfobacterium autotrophicum HRM2]
          Length = 364

 Score =  240 bits (611), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 140/363 (38%), Positives = 210/363 (57%), Gaps = 14/363 (3%)

Query: 21  PPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTT 80
           PP+   G+I W+  N F    + +LT +++ LL  ++P  I W F+D++W  S    C  
Sbjct: 15  PPITNIGVIGWVRANLFNGVLNSILTLVVLALLWLTVPPFIKWAFIDSLWT-STGAECQA 73

Query: 81  VSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPR 140
           +          + ACW+ I       IFG YP   +WRP+   +    LL         +
Sbjct: 74  I----------DGACWSIIPANLRFIIFGFYPHDLQWRPLAAMVLLVALLFYSQDRQHWK 123

Query: 141 KFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLAL 200
           K L      GLF      +  G LG   VE++ WGGL +TL++S FG+  + P G+ LAL
Sbjct: 124 KHLIYAWAIGLF-TMGLLLKGGILGFESVESNKWGGLPLTLLLSVFGLTAAYPFGVFLAL 182

Query: 201 GRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFA 260
           GR S +PV++   + +IEL RGVPL+++LFM+S++ PL LP+   ++K+LRA + +  F 
Sbjct: 183 GRQSRMPVIKAFSVVYIELIRGVPLISLLFMSSVVFPLLLPEGVTLNKILRAQVAIIMFT 242

Query: 261 SAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKD 320
           +AYIAEV+RGGLQ +++GQ+EAA SLGL+Y Q MRLII+PQ +K VIP  V+  I  FKD
Sbjct: 243 AAYIAEVVRGGLQGMNRGQYEAAESLGLNYFQTMRLIILPQALKIVIPPSVSILISAFKD 302

Query: 321 SSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTL 380
           +SL+ II ++DLL   +   S   W+         IF+  ++++ CF +S YS  +E+ L
Sbjct: 303 TSLVVIIALYDLLKTTQTTLSHPQWMG--FSAEAYIFVALIYFVCCFFMSNYSRRLEREL 360

Query: 381 HKG 383
             G
Sbjct: 361 DTG 363


>gi|311277768|ref|YP_003939999.1| polar amino acid ABC transporter, inner membrane subunit
           [Enterobacter cloacae SCF1]
 gi|308746963|gb|ADO46715.1| polar amino acid ABC transporter, inner membrane subunit
           [Enterobacter cloacae SCF1]
          Length = 367

 Score =  240 bits (611), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 162/358 (45%), Positives = 223/358 (62%), Gaps = 14/358 (3%)

Query: 28  IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQ 87
            + W  KN F +  + LLT   + LL   +P +I WVFL A W+GS R  CT        
Sbjct: 20  AVVWARKNLFSSWSNTLLTLFCLWLLWKLLPPLIDWVFLQANWVGSTRADCTK------- 72

Query: 88  PDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSIL 147
               + ACW FI +R+ QF++G YP  QRWR  L  + G + + PM +   P++      
Sbjct: 73  ----SGACWVFIRERFGQFMYGLYPHDQRWRIHLALVIGVLTIIPMFLKRLPQRGRYIAC 128

Query: 148 LFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNI 206
              L+P+   + +  G  GL  VET  WGGL +TL+I+  GI  ++P GILLALGR S +
Sbjct: 129 WAVLYPLIVWWLLYGGFFGLDRVETRQWGGLTLTLIIASVGIAGALPWGILLALGRRSTM 188

Query: 207 PVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAE 266
           PV+R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV  F SAY+AE
Sbjct: 189 PVVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMSEGTSIDKLIRALVGVILFQSAYVAE 248

Query: 267 VLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISI 326
           V+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I LFKD+SL+ I
Sbjct: 249 VVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTIIALFKDTSLVII 308

Query: 327 INMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
           I +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  +EK  + G 
Sbjct: 309 IGLFDLFSSVQQATVDPVWLG--MSTEGYVFAALIYWIFCFSMSRYSQHLEKRFNTGR 364


>gi|261819587|ref|YP_003257693.1| polar amino acid ABC transporter inner membrane protein
           [Pectobacterium wasabiae WPP163]
 gi|261603600|gb|ACX86086.1| polar amino acid ABC transporter, inner membrane subunit
           [Pectobacterium wasabiae WPP163]
          Length = 364

 Score =  238 bits (608), Expect = 9e-61,   Method: Composition-based stats.
 Identities = 162/370 (43%), Positives = 227/370 (61%), Gaps = 16/370 (4%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
           Q   PP+ +   I W  +N F    + LLT   + LL  +IP +++W    A WIG+ R 
Sbjct: 8   QDRQPPLLRS--IQWARRNLFSNISNSLLTLFCLWLLWVAIPPLLNWAIFQANWIGTTRN 65

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            CT            + ACW FI+ R+  F++G YP  + WR       G + + PM + 
Sbjct: 66  DCT-----------RDGACWVFIHARFGHFMYGLYPATEVWRINFALAIGLLSILPMFLK 114

Query: 137 SFPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
           + P +     +    +P+   + +  G  GLS VET  WGGL++TL+I+  GI  ++PLG
Sbjct: 115 TIPYRGRYIAVWTVAYPLIAWWLLYGGFGGLSRVETYQWGGLMLTLIIAAVGIAGALPLG 174

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           ILLALGR S +P++R   + FIE +RGVPL+TVLFM+S+MLPLFL +   +DKLLRAL+G
Sbjct: 175 ILLALGRRSTLPIVRMLSVAFIEFWRGVPLITVLFMSSVMLPLFLTEGTTIDKLLRALVG 234

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           V  F SAY+AEV+RGGLQ++ KGQ+EAA SLGL Y +   L+I+PQ +K VIPG+VNT I
Sbjct: 235 VILFQSAYVAEVVRGGLQALPKGQYEAAESLGLGYWRMQGLVILPQALKMVIPGLVNTII 294

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD+SL+ II +FDL   ++    + TW+     T G +F   V+WIFCFS+S YS  
Sbjct: 295 SLFKDTSLVIIIGLFDLFSSIQQATVDPTWLG--MSTEGYVFAAMVYWIFCFSMSRYSQH 352

Query: 376 IEKTLHKGSK 385
           +E   + G K
Sbjct: 353 LENRFNTGHK 362


>gi|254475047|ref|ZP_05088433.1| amino acid ABC transporter, permease protein [Ruegeria sp. R11]
 gi|214029290|gb|EEB70125.1| amino acid ABC transporter, permease protein [Ruegeria sp. R11]
          Length = 440

 Score =  238 bits (607), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 146/444 (32%), Positives = 227/444 (51%), Gaps = 72/444 (16%)

Query: 5   CKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWV 64
            +   +VR+  + P+ PP  + G+  W+ +N F +  + +LT + + L+   + G + W+
Sbjct: 6   AQTVAFVRETEIPPAPPPGRETGVYKWMRENLFSSIPNSILTIVALALIYSLLSGTLPWL 65

Query: 65  FLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGN---------YPMAQ 115
            L+ VW  S+   C  V  G +       AC++ + +R+ Q ++G           P  Q
Sbjct: 66  -LNGVWNTSSLQECREVLDGQV------GACFSVLTERWNQLLYGFKYPIDPAYESPFMQ 118

Query: 116 RWRPILVFLTGSILLTPMLIPSFPRKF-----LNSILLFGLFPIFSFFVLY--------- 161
            WRP L  L   I L P+L    PRK      +   + F L    S  V           
Sbjct: 119 YWRPNLALLLLLIALAPVLFFDLPRKLLAFTAVYPFIAFWLIWGGSILVPIVALLGFVAA 178

Query: 162 ---------------------------------------GGLGLSIVETSLWGGLLVTLV 182
                                                      L  V +   GG ++ ++
Sbjct: 179 GVVFQKYGKGSFAVGFFGGILAAIVVWNVGGFLIPEGASENAMLEAVPSRDLGGFMLNMM 238

Query: 183 ISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPD 242
           +    + +S+PLGI LALGR S +P++++ C+ FIE  RGVPL+T+LF+AS+ML  F P 
Sbjct: 239 LGVTCVSLSVPLGIALALGRQSTMPLIKWICVVFIEFVRGVPLITLLFVASVMLSYFFPP 298

Query: 243 TWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQV 302
              VD  LR ++ ++ F+SAYIAEV+RGGL ++ KGQ+EAA+SLGL Y Q MRLII+PQ 
Sbjct: 299 DATVDLFLRVVIMITLFSSAYIAEVIRGGLAALPKGQYEAADSLGLDYPQAMRLIILPQA 358

Query: 303 IKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRV-NFSESTWISSVTPTTGLIFIGFV 361
           +K  IPGIVN  +GLFKD++L+S+I+MFDL+G++R    + + W         L F  F+
Sbjct: 359 LKISIPGIVNVAVGLFKDTTLVSVISMFDLVGMIRGPILASTEWNGVYW--ELLGFAAFL 416

Query: 362 FWIFCFSISLYSVFIEKTLHKGSK 385
           F++ C+ IS YS ++E+ L    +
Sbjct: 417 FFVVCYGISQYSQWLERRLATDHR 440


>gi|319778957|ref|YP_004129870.1| Glutamate Aspartate transport system permease protein GltK
           [Taylorella equigenitalis MCE9]
 gi|317108981|gb|ADU91727.1| Glutamate Aspartate transport system permease protein GltK
           [Taylorella equigenitalis MCE9]
          Length = 356

 Score =  238 bits (607), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 157/362 (43%), Positives = 223/362 (61%), Gaps = 13/362 (3%)

Query: 24  YQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQ 83
              G   W+ KN F +P  I+ T LI+  L+FSIP ++ W+F+DA +  +    C   + 
Sbjct: 7   SHSGPWYWLRKNLFASPAHIIATVLILWFLIFSIPLLVDWLFIDANFDATKAADCRDSA- 65

Query: 84  GGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFL 143
                     ACW+F+  +Y   +FG YP  ++WRP +V L    +L    +P    + L
Sbjct: 66  ---------GACWSFVRHKYRMILFGLYPYFEQWRPFVVTLLLIAVLIYSALPRAWNRSL 116

Query: 144 NSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRN 203
             + L  L       +  G  GLS VET+ WGGL +TL++S FGI+ + PLGI+LALGR 
Sbjct: 117 IFVWLVVLTICG-ILMYGGVFGLSHVETARWGGLPITLMLSIFGIMFATPLGIILALGRR 175

Query: 204 SNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAY 263
           S++P++R    ++IEL RGVP V++LFMAS+M+PLF P+    +KLLRA L V  + SAY
Sbjct: 176 SHMPLIRALSTSYIELVRGVPFVSLLFMASVMVPLFFPEGVTFNKLLRAQLAVIIYMSAY 235

Query: 264 IAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSL 323
           IAEV+RGGLQSI KGQ+E A SLGLSY Q MRLII+PQ +  VIP +V+ FI +FKD+SL
Sbjct: 236 IAEVVRGGLQSIPKGQYEGAKSLGLSYWQYMRLIILPQALTVVIPPLVSIFISIFKDTSL 295

Query: 324 ISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKG 383
           + II ++DL    +V  S+  W          +F+ F+++IFCF++S YS +IE  L  G
Sbjct: 296 VVIIGIYDLTLSAKVALSDPQWSGLG--LEAYVFLAFIYFIFCFAMSKYSRYIEARLRTG 353

Query: 384 SK 385
            +
Sbjct: 354 HR 355


>gi|227327914|ref|ZP_03831938.1| L-amino acid ABC transporter permease protein [Pectobacterium
           carotovorum subsp. carotovorum WPP14]
          Length = 364

 Score =  237 bits (604), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 160/358 (44%), Positives = 223/358 (62%), Gaps = 14/358 (3%)

Query: 29  IAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQP 88
           I W  +N F +  + LLT   + LL  +IP +++W    A WIG+ R  CT         
Sbjct: 18  IQWARRNLFSSISNSLLTLFCLWLLWVAIPPLLNWAIFQANWIGTTRNDCT--------- 68

Query: 89  DGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILL 148
              + ACW FI+ R+  F++G YP  + WR       G + + PM + S P +     + 
Sbjct: 69  --RDGACWVFIHARFGHFMYGLYPAEEVWRINFALAIGLLSILPMFLKSIPYRGRYIAVW 126

Query: 149 FGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIP 207
             ++P+   + +  G  GLS VET  WGGL +TL+I+  GI  ++PLGILLALGR S +P
Sbjct: 127 TVVYPLVAWWLLYGGFGGLSRVETYQWGGLTLTLIIAAVGIAGALPLGILLALGRRSTLP 186

Query: 208 VLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEV 267
           ++R   + FIE +RGVPL+TVLFM+S+MLPLFL +   +DKLLRAL+GV  F SAY+AEV
Sbjct: 187 IVRMLSVVFIEFWRGVPLITVLFMSSVMLPLFLTEGTTIDKLLRALVGVILFQSAYVAEV 246

Query: 268 LRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISII 327
           +RGGLQ++ KGQ+EAA SLGL Y +   L+I+PQ +K VIPG+VNT I LFKD+SL+ II
Sbjct: 247 VRGGLQALPKGQYEAAESLGLGYWRMQGLVILPQALKMVIPGLVNTIISLFKDTSLVIII 306

Query: 328 NMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSK 385
            +FDL   ++    + TW+     T G +F   V+WIFCFS+S YS  +E   + G K
Sbjct: 307 GLFDLFSSIQQATVDPTWLG--MSTEGYVFAAMVYWIFCFSMSRYSQHLENRFNTGHK 362


>gi|89901104|ref|YP_523575.1| amino acid ABC transporter permease [Rhodoferax ferrireducens T118]
 gi|89345841|gb|ABD70044.1| Amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine [Rhodoferax ferrireducens T118]
          Length = 367

 Score =  237 bits (604), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 138/373 (36%), Positives = 222/373 (59%), Gaps = 12/373 (3%)

Query: 14  RLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGS 73
           + +     PV   G +AW+  N     K  L T ++  +LL+ +P I++W    A W+  
Sbjct: 7   QPIAARPAPVDTEGPVAWVKANLLADWKTTLATLIVGGVLLWLVPQILNWAVFKAAWL-P 65

Query: 74  NRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPM 133
           N   C               ACW  I ++Y   IFG YP  ++WRP++  +  + LL   
Sbjct: 66  NYEACRAPGV---------GACWGVIAEKYRVIIFGRYPFEEQWRPLIATVLLTGLLVAS 116

Query: 134 LIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMP 193
            +  F + +   +L   +   F   +    LGL+ V+T  WGGL +T++++   +++S P
Sbjct: 117 CVRMFWKTW-LPLLWVVVLAAFFTLMYGNSLGLTQVDTDRWGGLPLTILLASLSLVMSFP 175

Query: 194 LGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRAL 253
           + +L+ALGR S++P +R  C  ++EL RGVPL++VLFMAS M PLF+P  + +D L+R L
Sbjct: 176 IALLVALGRRSSLPAIRSFCTIYVELIRGVPLISVLFMASFMFPLFMPQGFKIDVLIRVL 235

Query: 254 LGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNT 313
           +G++ FA+AY AEV+RGGLQ+I KGQ EAA +LGLSY Q  R I++PQ +  V+PGI+N 
Sbjct: 236 VGITLFAAAYSAEVIRGGLQAIPKGQVEAAATLGLSYWQTQRKIVLPQALAMVVPGIMNN 295

Query: 314 FIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYS 373
           FI  FKD+SL++I+++++L G + +  +  +         G IFI  ++++FCFS+S YS
Sbjct: 296 FISTFKDTSLVTIVSLYELTGAMSLALNSDSNWRPF-TIEGYIFIALIYFVFCFSMSRYS 354

Query: 374 VFIEKTLHKGSKK 386
            ++EK ++K   +
Sbjct: 355 HWVEKQVNKSKLR 367


>gi|259416339|ref|ZP_05740259.1| glutamate/glutamine/aspartate/asparagine transport system
           permeaseprotein BztC [Silicibacter sp. TrichCH4B]
 gi|259347778|gb|EEW59555.1| glutamate/glutamine/aspartate/asparagine transport system
           permeaseprotein BztC [Silicibacter sp. TrichCH4B]
          Length = 442

 Score =  237 bits (604), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 141/444 (31%), Positives = 223/444 (50%), Gaps = 67/444 (15%)

Query: 6   KEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVF 65
            +  +VR  +L P  PP  + G++ W   N F    + +LT + +  ++  + G+I W +
Sbjct: 2   SDISFVRTEMLPPKDPPASEVGVVGWARANLFSGWFNSILTVVSLYFVIKILIGLIGWAW 61

Query: 66  LDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYP-------MAQRWR 118
           +   W  ++   C  + +   +      ACW  I +R+ Q +FG YP          RWR
Sbjct: 62  V-PTWSATSLPECRVIFEELGRSGHNAGACWGVIAERWPQLLFGFYPNGYEEGTADLRWR 120

Query: 119 PILVF-------------------LTGSILLTPMLIPSFPRKFLNS-------------- 145
           P+L F                   L     + P L+P                       
Sbjct: 121 PVLAFVLLFVALAPVLFSDKVPAKLIYFTAVYPFLMPWLLWGGTVWMPVSAALGFVLGYV 180

Query: 146 ------------------------ILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTL 181
                                     LF      S       L L  VE+  +GG ++++
Sbjct: 181 VYKALAQSASELIGLIVGVVAAFVWWLFVASLFSSALASVVPLALEPVESRQFGGFMLSI 240

Query: 182 VISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLP 241
            I    I +S+P+GI+LALGR S++ +++  C+ FIE  RGVPL+T+LF+AS +L +F+P
Sbjct: 241 TIGVVAIGLSLPIGIVLALGRQSDLLIVKTLCVGFIEFIRGVPLITLLFVASTLLNIFMP 300

Query: 242 DTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQ 301
              + D ++R  + V+ FASAY+AEV+RGGL ++ KGQ+E A+SLGL+Y Q  RLIIMPQ
Sbjct: 301 PGTNFDIIMRVFIMVTLFASAYMAEVIRGGLAALPKGQYEGADSLGLNYWQAQRLIIMPQ 360

Query: 302 VIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFV 361
            +K  IPGIV+TFIG+FKD++L+S+I +FD L +     +++ W   V       FI  +
Sbjct: 361 ALKISIPGIVSTFIGVFKDTTLVSVIGLFDPLNLTNAIRADADWNGLVW--ELYGFIALL 418

Query: 362 FWIFCFSISLYSVFIEKTLHKGSK 385
           F++FCF +S YS+++E+ L  G +
Sbjct: 419 FFVFCFGMSRYSMYLERKLQTGHR 442


>gi|238782938|ref|ZP_04626966.1| Inner membrane amino-acid ABC transporter permease protein yhdY
           [Yersinia bercovieri ATCC 43970]
 gi|238716141|gb|EEQ08125.1| Inner membrane amino-acid ABC transporter permease protein yhdY
           [Yersinia bercovieri ATCC 43970]
          Length = 369

 Score =  236 bits (602), Expect = 4e-60,   Method: Composition-based stats.
 Identities = 168/378 (44%), Positives = 234/378 (61%), Gaps = 20/378 (5%)

Query: 14  RLLQPSLPPVYQRG------IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLD 67
            +     PP   R       ++ W  KN F +  + LLT L + L+   IP +++W   +
Sbjct: 2   TMTLTREPPSTVRPGNPLSRMVFWARKNLFSSWSNSLLTLLCLWLMWQLIPPLLNWTIFN 61

Query: 68  AVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGS 127
           A W+G++RT CT              ACW FI+ R+ QF++G YP+ QRWR     + G 
Sbjct: 62  ANWLGTSRTDCT-----------REGACWVFIHARFGQFMYGLYPIEQRWRINTTLIIGL 110

Query: 128 ILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFF 186
           + L P+   + PR+     +    +P+  + +LYGG  GLS VET  WGGL +TL+I+  
Sbjct: 111 LTLLPLFWRAMPRRGRYLAVWIVAYPLLVWVMLYGGFLGLSRVETRQWGGLTLTLIIAAV 170

Query: 187 GIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDV 246
           GI  ++PLGILLAL R S++PV+R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +
Sbjct: 171 GIAGALPLGILLALARRSSMPVVRILSVVFIEFWRGVPLITVLFMSSVMLPLFMTEGTSI 230

Query: 247 DKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRV 306
           DKL+RAL+GV  F SAY+AEV+RGGLQ++ KGQ EAA SLGL Y +   L+I+PQ +K V
Sbjct: 231 DKLIRALVGVVLFQSAYVAEVVRGGLQALPKGQTEAAESLGLGYWKTQGLVILPQALKMV 290

Query: 307 IPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFC 366
           IPG+VNT I LFKD+SL+ II +FDL   V+    +  W+     T G +F   V+WIFC
Sbjct: 291 IPGLVNTIIALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAATVYWIFC 348

Query: 367 FSISLYSVFIEKTLHKGS 384
           FS+S YS  +EK  H G 
Sbjct: 349 FSMSRYSQHLEKRFHTGR 366


>gi|238752138|ref|ZP_04613620.1| Inner membrane amino-acid ABC transporter permease protein yhdY
           [Yersinia rohdei ATCC 43380]
 gi|238709611|gb|EEQ01847.1| Inner membrane amino-acid ABC transporter permease protein yhdY
           [Yersinia rohdei ATCC 43380]
          Length = 346

 Score =  236 bits (601), Expect = 5e-60,   Method: Composition-based stats.
 Identities = 160/355 (45%), Positives = 225/355 (63%), Gaps = 14/355 (3%)

Query: 31  WIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDG 90
           W  KN F +  + LLT L + L+   IP +++W   DA W+G++R+ CT           
Sbjct: 2   WARKNLFSSWTNSLLTLLCLWLMWQFIPPLLNWTIFDANWLGTSRSDCT----------- 50

Query: 91  WNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFG 150
              ACW FI+ R+ QF++G YP+ QRWR     + G + + P+   + P +    ++   
Sbjct: 51  REGACWVFIHARFGQFMYGLYPIEQRWRINTSLIIGLLTMIPLFWRAMPHRGRYLVVWML 110

Query: 151 LFPIFSFFV-LYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVL 209
            +P+  + +   G  GLS VET  WGGL +TL+I+  GI  ++PLGILLAL R S++PV+
Sbjct: 111 AYPLLVWVMLYGGFFGLSRVETHQWGGLTLTLIIAAVGIAGALPLGILLALARRSSMPVV 170

Query: 210 RYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLR 269
           R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV  F SAY+AEV+R
Sbjct: 171 RILSVIFIEFWRGVPLITVLFMSSVMLPLFMTEGTSIDKLIRALVGVVLFQSAYVAEVVR 230

Query: 270 GGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINM 329
           GGLQ++ KGQ EAA SLGL Y +   L+I+PQ +K VIPG+VNT I LFKD+SL+ II +
Sbjct: 231 GGLQALPKGQTEAAESLGLGYWKTQGLVILPQALKMVIPGLVNTIIALFKDTSLVIIIGL 290

Query: 330 FDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
           FDL   V+    +  W+     T G +F   V+WIFCFS+S YS  +EK  H G 
Sbjct: 291 FDLFSSVQQATVDPAWLG--MSTEGYVFAAAVYWIFCFSMSRYSQHLEKRFHTGR 343


>gi|331684911|ref|ZP_08385503.1| inner membrane amino-acid ABC transporter permease protein YhdY
           [Escherichia coli H299]
 gi|331078526|gb|EGI49732.1| inner membrane amino-acid ABC transporter permease protein YhdY
           [Escherichia coli H299]
          Length = 367

 Score =  236 bits (601), Expect = 5e-60,   Method: Composition-based stats.
 Identities = 161/369 (43%), Positives = 225/369 (60%), Gaps = 14/369 (3%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
            P          + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS R 
Sbjct: 9   PPRPASHNSSRAMVWVRKNLFSSLSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRA 68

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM   
Sbjct: 69  DCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPMFWK 117

Query: 137 SFPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
             P +     +   ++P+   + +  G  GL  VET  WGGL +TL+I+  GI  ++P G
Sbjct: 118 ILPHRGRYIAVWAVIYPLIVWWLMYGGFFGLERVETRQWGGLTLTLIIASVGIAGALPWG 177

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           ILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+G
Sbjct: 178 ILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVG 237

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           V  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I
Sbjct: 238 VILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTII 297

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  
Sbjct: 298 ALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQH 355

Query: 376 IEKTLHKGS 384
           +EK  + G 
Sbjct: 356 LEKRFNTGR 364


>gi|89053120|ref|YP_508571.1| amino acid ABC transporter permease [Jannaschia sp. CCS1]
 gi|88862669|gb|ABD53546.1| L-aspartate ABC transporter membrane protein / L-glutamate ABC
           transporter membrane protein / L-glutamine ABC
           transporter membrane protein / L-asparagine ABC
           transporter membrane protein [Jannaschia sp. CCS1]
          Length = 445

 Score =  235 bits (600), Expect = 7e-60,   Method: Composition-based stats.
 Identities = 136/443 (30%), Positives = 222/443 (50%), Gaps = 62/443 (13%)

Query: 2   IDSCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGII 61
            ++     YVR  +L    PPV   G + W+ +N F +  + L+T + I ++   + GI+
Sbjct: 6   SETSVHTAYVRTEMLPEQTPPVAVAGPVKWVRENLFSSVPNALMTLVSIYVVYVVLAGIL 65

Query: 62  HWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNA---ACWAFIYDRYEQFIFGNYPMAQR-- 116
            W+  + +W   + + C  +      P   +    ACWA + DR++Q +FG YP      
Sbjct: 66  PWMI-NGIWDADSLSECREIRDARFGPSDGHGGGVACWAVLVDRWDQLMFGFYPPELYWR 124

Query: 117 --------------------------------------------WRPILVFLTGSILLTP 132
                                                       W P+LV     +    
Sbjct: 125 AILAFALFLGAIAPVLYDTLPRKLLLLTAAMPFLCAWLLWGGSIWTPLLVAAGFGLGYAV 184

Query: 133 MLIPSFPRKFLNSILLFGLFPIFSFFV----------LYGGLGLSIVETSLWGGLLVTLV 182
           +   S     + S +L  + P+  +                +G+  V++  +GG L+  V
Sbjct: 185 IKFGSVALGAMTSTILAIVVPLLYWLFLLGPLVSVMDSILPIGIQAVQSREFGGFLLAFV 244

Query: 183 ISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPD 242
           I   GII+SMPLG++LALGR S++ ++    + FIE+ RGVPL+  LF A ++L  FLP 
Sbjct: 245 IGASGIILSMPLGVMLALGRQSDLFIINKFSVIFIEVIRGVPLIVWLFTAQLLLGYFLPP 304

Query: 243 TWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQV 302
             + D ++R ++ V+ F++AYIAEV+RGGL ++ +GQ+E A+SLGL+Y Q M+LI++PQ 
Sbjct: 305 GTNFDLMVRVIIMVTLFSAAYIAEVIRGGLAALPRGQYEGADSLGLNYWQSMQLIVLPQA 364

Query: 303 IKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVF 362
           +K  IPGIV++FIGLFKD++L+  I +FD +G      +++ W          IFIG  F
Sbjct: 365 LKISIPGIVSSFIGLFKDTTLVVFIGLFDPIGFSNAIRADTDWNGIYW--ELFIFIGLCF 422

Query: 363 WIFCFSISLYSVFIEKTLHKGSK 385
           +I CF +S YS ++E+ L    +
Sbjct: 423 FICCFGMSRYSQWLERKLATDHR 445


>gi|238794644|ref|ZP_04638250.1| Inner membrane amino-acid ABC transporter permease protein yhdY
           [Yersinia intermedia ATCC 29909]
 gi|238726033|gb|EEQ17581.1| Inner membrane amino-acid ABC transporter permease protein yhdY
           [Yersinia intermedia ATCC 29909]
          Length = 369

 Score =  235 bits (599), Expect = 9e-60,   Method: Composition-based stats.
 Identities = 166/378 (43%), Positives = 234/378 (61%), Gaps = 20/378 (5%)

Query: 14  RLLQPSLPPVYQRG------IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLD 67
            +     PP   +       ++ W  KN F +  + LLT L + L+   IP +++W   +
Sbjct: 2   TMTLTREPPSTVQPGNPLSRMVFWAKKNLFSSWTNSLLTLLCLWLMWQLIPPLLNWTIFN 61

Query: 68  AVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGS 127
           A W+G++RT CT              ACW FI+ R+ QF++G YP+ QRWR     L G 
Sbjct: 62  ANWLGTSRTDCT-----------REGACWVFIHARFGQFMYGLYPIEQRWRINTTLLIGL 110

Query: 128 ILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGL-GLSIVETSLWGGLLVTLVISFF 186
           + L P+   + PR+     +    +P+  + +LYGG  GL+ VET  WGGL +TL+I+  
Sbjct: 111 LTLIPLFWRAMPRRGRYLAVWMVAYPLLVWLMLYGGFLGLTRVETRQWGGLTLTLIIAAV 170

Query: 187 GIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDV 246
           GI  ++PLGILLAL R S++PV+R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +
Sbjct: 171 GIAGALPLGILLALARRSSMPVVRILSVVFIEFWRGVPLITVLFMSSVMLPLFMTEGTSI 230

Query: 247 DKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRV 306
           DKL+RAL+GV  F SAY+AEV+RGGLQ++ +GQ EAA SLGL Y +   L+I+PQ +K V
Sbjct: 231 DKLIRALVGVVLFQSAYVAEVVRGGLQALPRGQTEAAESLGLGYWKTQGLVILPQALKMV 290

Query: 307 IPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFC 366
           IPG+VNT I LFKD+SL+ II +FDL   V+    +  W+     T G +F   V+WIFC
Sbjct: 291 IPGLVNTIIALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAAAVYWIFC 348

Query: 367 FSISLYSVFIEKTLHKGS 384
           FS+S YS  +EK  H G 
Sbjct: 349 FSMSRYSQHLEKRFHTGR 366


>gi|170684312|ref|YP_001745540.1| His/Glu/Gln/Arg/opine ABC transporter permease [Escherichia coli
           SMS-3-5]
 gi|170522030|gb|ACB20208.1| amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine
           family [Escherichia coli SMS-3-5]
          Length = 367

 Score =  235 bits (599), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 162/369 (43%), Positives = 226/369 (61%), Gaps = 14/369 (3%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
            P          + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS R 
Sbjct: 9   PPRPASHNSSRAMVWVRKNLFSSLSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRA 68

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM   
Sbjct: 69  DCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPMFWK 117

Query: 137 SFPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
             P +     +   ++P+   + +  G LGL  VET  WGGL +TL+I+  GI  ++P G
Sbjct: 118 ILPYRGRYIAVWAVIYPLIVWWLMYGGFLGLERVETRQWGGLTLTLIIASVGIAGALPWG 177

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           ILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+G
Sbjct: 178 ILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVG 237

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           V  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I
Sbjct: 238 VILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTII 297

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  
Sbjct: 298 ALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQH 355

Query: 376 IEKTLHKGS 384
           +EK  + G 
Sbjct: 356 LEKRFNTGR 364


>gi|56695435|ref|YP_165783.1| glutamate/glutamine/aspartate/asparagine ABC transporter, permease
           protein [Ruegeria pomeroyi DSS-3]
 gi|56677172|gb|AAV93838.1| glutamate/glutamine/aspartate/asparagine ABC transporter, permease
           protein [Ruegeria pomeroyi DSS-3]
          Length = 437

 Score =  235 bits (599), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 143/439 (32%), Positives = 219/439 (49%), Gaps = 62/439 (14%)

Query: 6   KEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVF 65
            +  +VR  +L    PP    G + W   N F    + +LT   +  +   +  ++ W  
Sbjct: 2   SDIGFVRTEMLPEREPPASTVGALGWARANLFSNWFNSVLTLASLYAVFAILAAVLPW-I 60

Query: 66  LDAVWIGSNRTVCTTV--SQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVF 123
               W G++ + C  +  + G +   G + ACW  I +R+ Q +FG YP    WRPIL F
Sbjct: 61  FSPTWNGTSLSNCREILTAAGSVGDHGTSGACWGVIRERWIQLLFGFYPSELYWRPILAF 120

Query: 124 LTG-------------------SILLTPMLIPSFPRKFLNS------------------- 145
           +                        L P + P                            
Sbjct: 121 ILLGVALAPVLFSDKMPSKMLIFSGLYPFIFPWLLWGGTIWGPIAALLGFVLGWVIYSAV 180

Query: 146 -------------------ILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFF 186
                                L         F     +G+  VE+  +GG ++++ I   
Sbjct: 181 SKTMSSLIGILLGAAAALVWWLVLAGFFVGVFDSVLAIGIEAVESRKFGGFMLSITIGVV 240

Query: 187 GIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDV 246
            I  S+PLGI+LALGR S++ +++Y C+ FIE  RGVPL+T+LF+AS +L +F+P   + 
Sbjct: 241 AIACSLPLGIVLALGRQSDLLIVKYICVGFIEFIRGVPLITLLFVASTLLNIFMPPGTNF 300

Query: 247 DKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRV 306
           D +LR L+ V+ FA+AY+AEV+RGGL ++ KGQ+E A+SLGL+Y Q  RLIIMPQ +K  
Sbjct: 301 DIILRVLIMVTLFAAAYMAEVIRGGLAALPKGQYEGADSLGLNYWQAQRLIIMPQALKIS 360

Query: 307 IPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFC 366
           IPGIV+TFIG+FKD+ L+SII + D LG+     +++ W   V       FI  +F++FC
Sbjct: 361 IPGIVSTFIGVFKDTVLVSIIGLLDPLGLSNAIRADANWNGIVW--EIYGFIALIFFVFC 418

Query: 367 FSISLYSVFIEKTLHKGSK 385
           F +S YS+++E+ LH G +
Sbjct: 419 FGMSRYSMYLERKLHTGHR 437


>gi|215488577|ref|YP_002331008.1| predicted amino-acid transporter subunit [Escherichia coli O127:H6
           str. E2348/69]
 gi|215266649|emb|CAS11088.1| predicted amino-acid transporter subunit [Escherichia coli O127:H6
           str. E2348/69]
 gi|320194756|gb|EFW69386.1| Glutamate Aspartate transport system permease protein GltK
           [Escherichia coli WV_060327]
          Length = 367

 Score =  235 bits (599), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 161/369 (43%), Positives = 226/369 (61%), Gaps = 14/369 (3%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
            P          + W+ KN F +  + LLT   I L+   +P +++W FL A W+GS R 
Sbjct: 9   PPRPASHNSSRAMVWVRKNLFSSLSNSLLTIGCIWLMWELLPPLLNWAFLQANWVGSTRA 68

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM   
Sbjct: 69  DCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPMFWK 117

Query: 137 SFPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
             P +     +   ++P+   + +  G LGL  VET  WGGL +TL+I+  GI  ++P G
Sbjct: 118 ILPYRGRYIAVWAVIYPLIVWWLMYGGFLGLERVETRQWGGLTLTLIIASVGIAGALPWG 177

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           ILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+G
Sbjct: 178 ILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVG 237

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           V  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I
Sbjct: 238 VILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTII 297

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  
Sbjct: 298 ALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQH 355

Query: 376 IEKTLHKGS 384
           +EK  + G 
Sbjct: 356 LEKRFNTGR 364


>gi|170743938|ref|YP_001772593.1| polar amino acid ABC transporter inner membrane subunit
           [Methylobacterium sp. 4-46]
 gi|168198212|gb|ACA20159.1| polar amino acid ABC transporter, inner membrane subunit
           [Methylobacterium sp. 4-46]
          Length = 385

 Score =  235 bits (598), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 166/381 (43%), Positives = 246/381 (64%), Gaps = 7/381 (1%)

Query: 8   FPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLD 67
             Y+R+  + P+  P    G +AW   N F +P +  LT L + +++  +P ++ ++ LD
Sbjct: 10  LSYIRREPIPPAPAPALVSGPLAWARANLFSSPVNTALTLLALVIVVLVVPPLLRFLVLD 69

Query: 68  AVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGS 127
           AV+ G NR  C     G         ACWAF+  +   F++G+YP+  RWR  + F   +
Sbjct: 70  AVFTGENRDACRPEVLGRPV-----GACWAFVAQKINYFVYGSYPIEARWRVNVFFAMAA 124

Query: 128 ILLTPMLIPSFPRKFLNSILLFGLFP--IFSFFVLYGGLGLSIVETSLWGGLLVTLVISF 185
           + +  +L    PR+ L +   F +FP   ++    +  +G+  V TSLWGG+LVT+V+S 
Sbjct: 125 LGVGWLLWLDAPRRDLGAAYFFVVFPLAAYALLSGFPLVGIETVPTSLWGGMLVTIVVSL 184

Query: 186 FGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWD 245
            GI+ S+PLGILLALGR S +P++R AC+ FIE +RGVPL+TVLFMA++MLPLFLP    
Sbjct: 185 VGIVASLPLGILLALGRRSRLPIVRLACVIFIEFWRGVPLITVLFMANVMLPLFLPGDIT 244

Query: 246 VDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKR 305
           VD+LLR L+GV+ F++AY+AEV+RGGLQ+I KGQ E ANSLGLSY Q MRL+I+PQ ++ 
Sbjct: 245 VDRLLRPLIGVALFSAAYMAEVVRGGLQAIPKGQTEGANSLGLSYWQGMRLVILPQALRI 304

Query: 306 VIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIF 365
           VIPGIVN+FI LFKD++L+SI+ +FD +  +     +  W +    TTG  F    +++F
Sbjct: 305 VIPGIVNSFIALFKDTTLVSIVGIFDFIRTIESARIDPNWAAPTVVTTGYAFAALFYFVF 364

Query: 366 CFSISLYSVFIEKTLHKGSKK 386
           CF +S Y++F+E+ L  G  +
Sbjct: 365 CFGMSRYALFVERRLAAGQTR 385


>gi|149913101|ref|ZP_01901635.1| hypothetical protein RAZWK3B_03895 [Roseobacter sp. AzwK-3b]
 gi|149813507|gb|EDM73333.1| hypothetical protein RAZWK3B_03895 [Roseobacter sp. AzwK-3b]
          Length = 428

 Score =  235 bits (598), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 145/436 (33%), Positives = 230/436 (52%), Gaps = 63/436 (14%)

Query: 4   SCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHW 63
           S  +  +VR+ +L    PP    G I W+  N F  P + ++T L I  +   + G + W
Sbjct: 2   SKSDIAFVRREMLPEKAPPATAAGPIKWVRDNLFPGPINTIMTLLAIYFIYQIVSGAMPW 61

Query: 64  VFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGN-YPMAQRWRPILV 122
            FL+ VW  S+   C  V QG          C++ + +R+ Q +FG  YP  Q WRP L 
Sbjct: 62  -FLNGVWTTSSLAECREVLQGA------TGGCFSVLTERWNQLLFGFQYPSEQYWRPTLA 114

Query: 123 FLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFF------------------------ 158
           F+   + + P+L  + PRK L    L+     +  +                        
Sbjct: 115 FVLLFVAVAPVLFVALPRKLLIFTGLYPFIAFWLIWGGTLLVPLVALIGLVAGYVVFLRV 174

Query: 159 ----------------------------VLYGGLGLSIVETSLWGGLLVTLVISFFGIII 190
                                            L L  V++   GG ++ +++    + +
Sbjct: 175 ETKGFATAALTGLVAVVLVWWLGGYVSTAASETLALEPVQSRNMGGFMLNMILGTVCVSL 234

Query: 191 SMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLL 250
           S+P GILLALGR S++P++++ C+ FIE  RGVPL+T+LF+A+++L  FLP   + D +L
Sbjct: 235 SLPFGILLALGRQSDMPIIKWICVIFIEFIRGVPLITLLFVANVVLAYFLPPGSNFDLIL 294

Query: 251 RALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGI 310
           R ++ ++ FASAYIAEV+RGGL ++ +GQ+EAA+SLGL Y Q MRLII+PQ +K  IPGI
Sbjct: 295 RVIIMITMFASAYIAEVIRGGLAALPRGQYEAADSLGLDYAQSMRLIILPQALKISIPGI 354

Query: 311 VNTFIGLFKDSSLISIINMFDLLGIVRV-NFSESTWISSVTPTTGLIFIGFVFWIFCFSI 369
           VN  +GLFKD++L+S+I+MFDL+G++R    + + W        G   +  +F++ C+ I
Sbjct: 355 VNVSVGLFKDTTLVSVISMFDLVGMIRGPILAATEWNGVYWELWGFAVV--LFFVVCYGI 412

Query: 370 SLYSVFIEKTLHKGSK 385
           S YS ++E+ L +  +
Sbjct: 413 SQYSQWLERQLQRDHR 428


>gi|312968399|ref|ZP_07782608.1| general L-amino acid transport system permease protein aapM
           [Escherichia coli 2362-75]
 gi|312286617|gb|EFR14528.1| general L-amino acid transport system permease protein aapM
           [Escherichia coli 2362-75]
 gi|323189118|gb|EFZ74402.1| general L-amino acid transport system permease protein aapM
           [Escherichia coli RN587/1]
          Length = 368

 Score =  235 bits (598), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 161/369 (43%), Positives = 226/369 (61%), Gaps = 14/369 (3%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
            P          + W+ KN F +  + LLT   I L+   +P +++W FL A W+GS R 
Sbjct: 10  PPRPASHNSSRAMVWVRKNLFSSLSNSLLTIGCIWLMWELLPPLLNWAFLQANWVGSTRA 69

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM   
Sbjct: 70  DCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPMFWK 118

Query: 137 SFPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
             P +     +   ++P+   + +  G LGL  VET  WGGL +TL+I+  GI  ++P G
Sbjct: 119 ILPYRGRYIAVWAVIYPLIVWWLMYGGFLGLERVETRQWGGLTLTLIIASVGIAGALPWG 178

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           ILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+G
Sbjct: 179 ILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVG 238

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           V  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+I+PQ +K VIPG+VNT I
Sbjct: 239 VILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTII 298

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  
Sbjct: 299 ALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQH 356

Query: 376 IEKTLHKGS 384
           +EK  + G 
Sbjct: 357 LEKRFNTGR 365


>gi|227113999|ref|ZP_03827655.1| L-amino acid ABC transporter permease protein [Pectobacterium
           carotovorum subsp. brasiliensis PBR1692]
          Length = 362

 Score =  235 bits (598), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 157/359 (43%), Positives = 220/359 (61%), Gaps = 14/359 (3%)

Query: 28  IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQ 87
            + W  +N F +  + LLT   + LL  +IP +++W    A WIG+ R  CT        
Sbjct: 15  AMQWARRNLFSSISNSLLTLFCLWLLWVAIPPLLNWAIFQANWIGTTRNDCT-------- 66

Query: 88  PDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSIL 147
                 ACW FI+ R+  F++G YP  + WR         + + PM + + P +     +
Sbjct: 67  ---REGACWVFIHARFGHFMYGLYPAEEVWRINFALAIALLSILPMFLKTIPYRGRYIAV 123

Query: 148 LFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNI 206
               +P+   + +  G  GLS VET  WGGL +TL+I+  GI  ++PLGILLALGR S +
Sbjct: 124 WTVAYPLIAWWLLYSGFGGLSRVETYQWGGLTLTLIIAAVGIAGALPLGILLALGRRSTL 183

Query: 207 PVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAE 266
           P++R   + FIE +RGVPL+TVLFM+S+MLPLFL +   +DKLLRAL+GV  F SAY+AE
Sbjct: 184 PIVRMLSVIFIEFWRGVPLITVLFMSSVMLPLFLTEGTTIDKLLRALVGVILFQSAYVAE 243

Query: 267 VLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISI 326
           V+RGGLQ++ KGQ+EAA SLGL Y +   L+I+PQ +K VIPG+VNT I LFKD+SL+ I
Sbjct: 244 VVRGGLQALPKGQYEAAESLGLGYWRMQGLVILPQALKMVIPGLVNTIISLFKDTSLVII 303

Query: 327 INMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSK 385
           I +FDL   ++    + TW+     T G +F   V+WIFCFS+S YS  +E   + G K
Sbjct: 304 IGLFDLFSSIQQATVDPTWLG--MSTEGYVFAAMVYWIFCFSMSRYSQHLENRFNTGHK 360


>gi|260426627|ref|ZP_05780606.1| glutamate/glutamine/aspartate/asparagine transport system
           permeaseprotein BztC [Citreicella sp. SE45]
 gi|260421119|gb|EEX14370.1| glutamate/glutamine/aspartate/asparagine transport system
           permeaseprotein BztC [Citreicella sp. SE45]
          Length = 438

 Score =  235 bits (598), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 142/437 (32%), Positives = 223/437 (51%), Gaps = 60/437 (13%)

Query: 5   CKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWV 64
            +   +VR  + +   PP+ Q G   W+ +N   TP +++LT + + L+   +  ++ W 
Sbjct: 6   AQTVAFVRDTMTEQQEPPLSQSGAYKWMRENLLSTPLNVILTLVSVWLIYSVLSHVMPWA 65

Query: 65  FLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFL 124
               +W  S+ + C T+       D    ACWA I +R++Q +FG YP    WRP+L F+
Sbjct: 66  VF-GIWDASSLSECRTIRDELYGADANV-ACWAVISERWKQLLFGFYPPEHYWRPVLAFV 123

Query: 125 TGSI-------------LLTPMLIPSFPRKFLNS-------------------------- 145
              +             LL   ++  F   +L                            
Sbjct: 124 LFLVAISPVLFSSLPRKLLAFSVVAPFILFWLIWGGTVWGPICVALGFVIGWAIIRYASP 183

Query: 146 -----------------ILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGI 188
                                   P+         +GL  V++   GG ++ ++I   GI
Sbjct: 184 YIGALGSVILAIVVPLLYWFVLAGPLDDLLASILPIGLEQVQSKQMGGFMLAMIIGISGI 243

Query: 189 IISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDK 248
            +S+PLGI+LALGR S++ ++    + FIE+ RGVPL+  LF AS++L  FLP   + D 
Sbjct: 244 ALSLPLGIVLALGRQSDLFLINKCSVIFIEVIRGVPLIVWLFTASLLLNYFLPPGTNFDL 303

Query: 249 LLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIP 308
           +LR ++ V+ F+SAYIAEV+RGGL ++ KGQ+EAA++LGL Y + MRL+I+PQ +K  IP
Sbjct: 304 MLRVIIMVTLFSSAYIAEVVRGGLAALPKGQYEAADALGLDYWKSMRLVILPQALKISIP 363

Query: 309 GIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFS 368
           GIVNTFIGLFKD++L+  I + D +G+     + + W          +FIG  F+IFCFS
Sbjct: 364 GIVNTFIGLFKDTTLVVFIGLLDPIGLSNAIRASTEWNGIYW--ELFVFIGLCFFIFCFS 421

Query: 369 ISLYSVFIEKTLHKGSK 385
           +  YS+F+EK L +  +
Sbjct: 422 MGRYSLFLEKKLRREHR 438


>gi|331659559|ref|ZP_08360501.1| inner membrane amino-acid ABC transporter permease protein YhdY
           [Escherichia coli TA206]
 gi|331054141|gb|EGI26170.1| inner membrane amino-acid ABC transporter permease protein YhdY
           [Escherichia coli TA206]
          Length = 367

 Score =  234 bits (597), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 163/369 (44%), Positives = 226/369 (61%), Gaps = 14/369 (3%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
            P          + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS R 
Sbjct: 9   PPRPASHNSSRAMVWVRKNLFSSLSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRA 68

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM   
Sbjct: 69  DCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPMFWK 117

Query: 137 SFPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
             P +     +   ++P+   + +  G LGL  VET  WGGL +TL+I+  GI  ++P G
Sbjct: 118 ILPYRGRYIAVWAVIYPLIVWWLMYGGFLGLERVETRQWGGLTLTLIIASVGIAGALPWG 177

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           ILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+G
Sbjct: 178 ILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVG 237

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           V  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+IMPQ +K VIPG+VNT I
Sbjct: 238 VILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVIMPQALKLVIPGLVNTII 297

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  
Sbjct: 298 ALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQH 355

Query: 376 IEKTLHKGS 384
           +EK  + G 
Sbjct: 356 LEKRFNTGR 364


>gi|260223280|emb|CBA33684.1| General L-amino acid transport system permease protein aapM
           [Curvibacter putative symbiont of Hydra magnipapillata]
          Length = 367

 Score =  234 bits (596), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 138/372 (37%), Positives = 218/372 (58%), Gaps = 12/372 (3%)

Query: 15  LLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSN 74
            ++    PV   G++AWI  N FG  K  L T +I   LL  +P  ++W  + AVW+  N
Sbjct: 8   PIEARPAPVKTDGLVAWIRFNLFGDWKTTLGTLVIGAFLLAIVPRFLNWALVQAVWV-PN 66

Query: 75  RTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPML 134
              C               ACW  I +++   IFG +P  ++WRP++  L    LL    
Sbjct: 67  FEACHVEGA---------GACWGVIVEKFRIIIFGRFPFEEQWRPLIATLLLCSLLVASC 117

Query: 135 IPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPL 194
           +  F + +   +    +   F   +     G+S V+T  WGGL +TL++S   + ++ PL
Sbjct: 118 MRMFWKAW-LGLAWVVVLGSFFMLMSGDVFGMSKVDTDRWGGLPLTLLLSSLSMAMAFPL 176

Query: 195 GILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALL 254
            +L+ALGR SN+P ++  C  ++EL RGVPL++VLFMAS M PL +P  +++D L+R   
Sbjct: 177 ALLIALGRRSNLPAIKSLCTIYVELIRGVPLISVLFMASFMFPLLMPQGFNIDVLVRVPA 236

Query: 255 GVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTF 314
           G++ FA+AY+AEV+RGGLQ++ KGQ EAA +LGLSY Q  R I++PQ +  V+PGI+N F
Sbjct: 237 GITLFAAAYMAEVIRGGLQAVPKGQIEAAATLGLSYWQTQRKIVLPQALSMVVPGIMNNF 296

Query: 315 IGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSV 374
           I  FKD+SL++I+++++L G + +  +            G +FI  +++ FCFS+S YS+
Sbjct: 297 ISTFKDTSLVTIVSLYELTGSMSLALNSDADWRPYK-IEGYLFIALIYFGFCFSMSRYSL 355

Query: 375 FIEKTLHKGSKK 386
           +IEK ++K   +
Sbjct: 356 WIEKQVNKSKLR 367


>gi|50119203|ref|YP_048370.1| L-amino acid ABC transporter permease [Pectobacterium atrosepticum
           SCRI1043]
 gi|49609729|emb|CAG73163.1| L-amino acid ABC transporter permease protein [Pectobacterium
           atrosepticum SCRI1043]
          Length = 364

 Score =  233 bits (595), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 160/369 (43%), Positives = 226/369 (61%), Gaps = 16/369 (4%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
           Q   PP+ +   + W  +N F +  + LLT   + LL  +IP +++W    A WIG+ R 
Sbjct: 8   QNRQPPLLR--AMQWARRNLFSSIANSLLTLFCLWLLWIAIPPLLNWAIFQANWIGTTRN 65

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            CT            + ACW FI+ R+  F++G YP  + WR       G + + PM + 
Sbjct: 66  DCT-----------RDGACWVFIHARFGHFMYGLYPATEVWRINFALAIGLLSILPMFLK 114

Query: 137 SFPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
           + P +     +    +P+   + +  G  GLS VET  WGGL +TL+I+  GI  ++PLG
Sbjct: 115 TIPYRGRYIAVWTVAYPLIAWWLLYGGFGGLSRVETYQWGGLTLTLIIAAVGIAGALPLG 174

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           ILLALGR S +P++R   + FIE +RGVPL+TVLFM+S+MLPLFL +   +DKLLRAL+G
Sbjct: 175 ILLALGRRSTLPIVRMLSVVFIEFWRGVPLITVLFMSSVMLPLFLTEGTTIDKLLRALVG 234

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           V  F SAY+AEV+RGGLQ++ KGQ+EAA SLGL Y +   L+I+PQ +K VIPG+VNT I
Sbjct: 235 VILFQSAYVAEVVRGGLQALPKGQYEAAESLGLGYWRMQGLVILPQALKMVIPGLVNTII 294

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD+SL+ II +FDL   ++    + TW+     T G +F   V+WIFCFS+S YS  
Sbjct: 295 SLFKDTSLVIIIGLFDLFSSIQQATVDPTWLG--MSTEGYVFAAMVYWIFCFSMSRYSQH 352

Query: 376 IEKTLHKGS 384
           +E   + G 
Sbjct: 353 LENRFNTGH 361


>gi|307555365|gb|ADN48140.1| hypothetical amino-acid ABC transporter permease protein YhdY
           [Escherichia coli ABU 83972]
          Length = 367

 Score =  233 bits (595), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 163/369 (44%), Positives = 226/369 (61%), Gaps = 14/369 (3%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
            P          + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS R 
Sbjct: 9   PPRPASHNSSRAMVWVRKNLFSSLSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRA 68

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM   
Sbjct: 69  DCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPMFWK 117

Query: 137 SFPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
             P +     +   ++P+   + +  G LGL  VET  WGGL +TL+I+  GI  ++P G
Sbjct: 118 ILPYRGRYIAVWAVIYPLIVWWLMYGGFLGLERVETRQWGGLTLTLIIASVGIAGALPWG 177

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           ILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+G
Sbjct: 178 ILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEDTSIDKLIRALVG 237

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           V  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+IMPQ +K VIPG+VNT I
Sbjct: 238 VILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVIMPQALKLVIPGLVNTII 297

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  
Sbjct: 298 ALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQH 355

Query: 376 IEKTLHKGS 384
           +EK  + G 
Sbjct: 356 LEKRFNTGR 364


>gi|253686633|ref|YP_003015823.1| polar amino acid ABC transporter, inner membrane subunit
           [Pectobacterium carotovorum subsp. carotovorum PC1]
 gi|251753211|gb|ACT11287.1| polar amino acid ABC transporter, inner membrane subunit
           [Pectobacterium carotovorum subsp. carotovorum PC1]
          Length = 362

 Score =  233 bits (594), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 160/359 (44%), Positives = 223/359 (62%), Gaps = 14/359 (3%)

Query: 28  IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQ 87
            + W  +N F +  + LLT   + LL  +IP +++W    A WIG+ R  CT        
Sbjct: 15  AMQWARRNLFSSISNSLLTLFCLWLLWVAIPPLLNWAIFQANWIGTTRNDCT-------- 66

Query: 88  PDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSIL 147
               + ACW FI+ R+  F++G YP A+ WR       G + + PM + S P +     +
Sbjct: 67  ---RDGACWVFIHARFGHFMYGLYPAAEIWRINFALTIGLLSILPMFLKSIPYRGRYIAV 123

Query: 148 LFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNI 206
               +P+   + +  G  GLS VET  WGGL +TL+I+  GI  ++PLGILLALGR S +
Sbjct: 124 WAVAYPLIAWWLLYGGFGGLSRVETYQWGGLTLTLIIAAVGIAGALPLGILLALGRRSTL 183

Query: 207 PVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAE 266
           P++R   + FIE +RGVPL+TVLFM+S+MLPLFL +   +DKLLRAL+GV  F SAY+AE
Sbjct: 184 PIVRMLSVVFIEFWRGVPLITVLFMSSVMLPLFLTEGTTIDKLLRALVGVILFQSAYVAE 243

Query: 267 VLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISI 326
           V+RGGLQ++ KGQ+EAA SLGL Y +   L+I+PQ +K VIPG+VNT I LFKD+SL+ I
Sbjct: 244 VVRGGLQALPKGQYEAAESLGLGYWRMQGLVILPQALKMVIPGLVNTIISLFKDTSLVII 303

Query: 327 INMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSK 385
           I +FDL   ++    + TW+     T G +F   V+WIFCFS+S YS  +E   + G K
Sbjct: 304 IGLFDLFSSIQQATVDPTWLG--MSTEGYVFAAMVYWIFCFSMSRYSQHLESRFNTGHK 360


>gi|26249862|ref|NP_755902.1| amino-acid ABC transporter permease YhdY [Escherichia coli CFT073]
 gi|26110290|gb|AAN82476.1|AE016767_236 Hypothetical amino-acid ABC transporter permease protein yhdY
           [Escherichia coli CFT073]
          Length = 368

 Score =  233 bits (594), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 163/369 (44%), Positives = 226/369 (61%), Gaps = 14/369 (3%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
            P          + W+ KN F +  + LLT   I L+   IP +++W FL A W+GS R 
Sbjct: 10  PPRPASHNSSRAMVWVRKNLFSSLSNSLLTIGCIWLMWELIPPLLNWAFLQANWVGSTRA 69

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            CT              ACW FI++R+ QF++G YP  QRWR  L  L G + + PM   
Sbjct: 70  DCTKA-----------GACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPMFWK 118

Query: 137 SFPRKFLNSILLFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
             P +     +   ++P+   + +  G LGL  VET  WGGL +TL+I+  GI  ++P G
Sbjct: 119 ILPYRGRYIAVWAVIYPLIVWWLMYGGFLGLERVETRQWGGLTLTLIIASVGIAGALPWG 178

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           ILLALGR S++P++R   + FIE +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+G
Sbjct: 179 ILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEDTSIDKLIRALVG 238

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           V  F SAY+AEV+RGGLQ++ KGQ+EAA SL L Y +   L+IMPQ +K VIPG+VNT I
Sbjct: 239 VILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVIMPQALKLVIPGLVNTII 298

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFKD+SL+ II +FDL   V+    +  W+     T G +F   ++WIFCFS+S YS  
Sbjct: 299 ALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQH 356

Query: 376 IEKTLHKGS 384
           +EK  + G 
Sbjct: 357 LEKRFNTGR 365


>gi|163745577|ref|ZP_02152937.1| amino acid ABC transporter, permease protein [Oceanibulbus
           indolifex HEL-45]
 gi|161382395|gb|EDQ06804.1| amino acid ABC transporter, permease protein [Oceanibulbus
           indolifex HEL-45]
          Length = 432

 Score =  233 bits (593), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 140/436 (32%), Positives = 224/436 (51%), Gaps = 64/436 (14%)

Query: 5   CKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWV 64
            +   +VR+  L PS PP    G + W+  N F T  + LLT + +  L   + G + W+
Sbjct: 6   AESIAFVRESSLPPSAPPDKVGGPLKWVKDNLFPTWANALLTVVALYFLYLLLSGSLPWL 65

Query: 65  FLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGN-YPMAQRWRPILVF 123
            L+ VW  S+ + C  +  G       + AC++ I +R+ Q +FG  YP  Q WRP L  
Sbjct: 66  -LNGVWSASSLSECREILDGA------SGACFSVISERWHQLLFGFKYPSDQYWRPTLAL 118

Query: 124 LTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGG-------------------- 163
           +   I + P+L    PRK L    L+     +  +                         
Sbjct: 119 VLLFIAIAPVLFIDLPRKLLFFTGLYPFLAFWLIWGGPIWGPIFALLGVIAGYVAYSRLV 178

Query: 164 ---------------------------------LGLSIVETSLWGGLLVTLVISFFGIII 190
                                              L  + +   GG ++ +++    + +
Sbjct: 179 HKSFAMALAGGIVAAVIVWYIGGFIGEALRPASPLLEAIPSRDLGGFMLNMMLGITCVSL 238

Query: 191 SMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLL 250
           S+P+G+ LALGR S++P+++  C+ FIE  RGVPL+T+LF+A++ML  F P    VD  +
Sbjct: 239 SLPIGVALALGRQSHLPIVKGICVVFIEFVRGVPLITLLFVANVMLAYFFPPGSGVDLFI 298

Query: 251 RALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGI 310
           R ++ ++ F+SAYIAEV+RGGL ++ KGQ+EAA+SLGL Y Q MRLII+PQ +K  IPGI
Sbjct: 299 RVVIMITMFSSAYIAEVIRGGLAALPKGQYEAADSLGLDYAQAMRLIILPQAMKISIPGI 358

Query: 311 VNTFIGLFKDSSLISIINMFDLLGIVRV-NFSESTWISSVTPTTGLIFIGFVFWIFCFSI 369
           VN  +GLFKD++L+S+I++FD++G++R    + + W          +F   +F+I C+ I
Sbjct: 359 VNIAVGLFKDTTLVSVISLFDIIGMIRGPILASTDWNGVYW--ELFMFASLLFFIVCYGI 416

Query: 370 SLYSVFIEKTLHKGSK 385
           S YS ++E+ L    +
Sbjct: 417 SQYSQWLERRLATDHR 432


>gi|126737044|ref|ZP_01752779.1| ABC glutamate/glutamine/aspartate/asparagine transporter, inner
           membrane subunit BztC [Roseobacter sp. SK209-2-6]
 gi|126721629|gb|EBA18332.1| ABC glutamate/glutamine/aspartate/asparagine transporter, inner
           membrane subunit BztC [Roseobacter sp. SK209-2-6]
          Length = 432

 Score =  232 bits (591), Expect = 7e-59,   Method: Composition-based stats.
 Identities = 142/437 (32%), Positives = 224/437 (51%), Gaps = 64/437 (14%)

Query: 4   SCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHW 63
           +     +V +  +  S PP  + G+  W  +N F    + +LT + + L+   +   + W
Sbjct: 5   TTNSIAFVAEGTIPESPPPARETGVYKWARENLFSNIPNSILTLVALALIYSVLSNTLPW 64

Query: 64  VFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGN-YPMAQRWRPILV 122
           + L+ +W  S+   C  V  G +       AC++ + +R+ Q ++G  YP    WRP L 
Sbjct: 65  L-LNGIWTTSSLAECREVLDGKV------GACFSVLSERWNQLLYGFKYPTEAYWRPNLA 117

Query: 123 FLTGSILLTPMLIPSFPRK------------FLNSILLFGLFPIFSFFVL---------- 160
            +   I L P+L    PR+            F        L P+ +F             
Sbjct: 118 LVLLLIALAPVLFFDLPRQLLGFTVVYPFIAFWLIWGGSILVPVIAFLGFVAAAVVFQRF 177

Query: 161 -------------------------------YGGLGLSIVETSLWGGLLVTLVISFFGII 189
                                               LS V +   GG ++ +++    + 
Sbjct: 178 GKGSFAAGFFGALVAALVVWKVGGFLIPEGASENAMLSSVPSRDLGGFMLNMMLGVTCVS 237

Query: 190 ISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKL 249
           +S+PLGI LALGR S++P++++ C+ FIE  RGVPL+T+LF+AS+ML  F P    VD  
Sbjct: 238 LSVPLGIALALGRQSSMPLIKWICVIFIEFVRGVPLITLLFVASVMLSYFFPPDATVDLF 297

Query: 250 LRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPG 309
           LR ++ ++ F++AYIAEV+RGGL ++  GQ+EAA+SLGL Y Q MRLII+PQ +K  IPG
Sbjct: 298 LRVVIMITLFSAAYIAEVIRGGLAALPTGQYEAADSLGLDYPQAMRLIILPQALKISIPG 357

Query: 310 IVNTFIGLFKDSSLISIINMFDLLGIVRV-NFSESTWISSVTPTTGLIFIGFVFWIFCFS 368
           IVN  +GLFKD++L+S+I+MFDL+G++R    + + W         L F  F+F+I C+ 
Sbjct: 358 IVNVAVGLFKDTTLVSVISMFDLVGMIRGPILASTEWNGVYW--ELLGFAAFLFFIVCYG 415

Query: 369 ISLYSVFIEKTLHKGSK 385
           IS YS ++E+ L  G +
Sbjct: 416 ISQYSQWLERRLATGHR 432


>gi|242280378|ref|YP_002992507.1| polar amino acid ABC transporter inner membrane subunit
           [Desulfovibrio salexigens DSM 2638]
 gi|242123272|gb|ACS80968.1| polar amino acid ABC transporter, inner membrane subunit
           [Desulfovibrio salexigens DSM 2638]
          Length = 367

 Score =  232 bits (591), Expect = 8e-59,   Method: Composition-based stats.
 Identities = 138/366 (37%), Positives = 219/366 (59%), Gaps = 14/366 (3%)

Query: 16  LQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNR 75
           +    PP  Q G+I W+ KN      + +LT +    +  ++     W   +A       
Sbjct: 10  IPDRQPPATQVGVIGWVCKNLLCPWYNAVLTIVSCWAIWSAVAPFWEWAVTNA------- 62

Query: 76  TVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLI 135
               +++        ++ A W FI D +  F+ G YP  +RWRP++      IL++  L+
Sbjct: 63  ----SITLDPEVAKEYSGAAWGFIRDMWPVFMTGVYPAEERWRPLIALCIVVILVSLSLV 118

Query: 136 PSFPRKFLNSILLFGLFPIFSFFVLY-GGLGLSIVETSLWGGLLVTLVISFFGIIISMPL 194
            S+ R  L  IL F    +    V     +GL +V T  WGGL++T+++S   ++ + P+
Sbjct: 119 ASYRRSRLLKILWFVSPIVVFALVYGGEIVGLPVVGTHYWGGLMLTIMLSIVAMLAAFPI 178

Query: 195 GILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALL 254
            +LLALGR S++P+ +  C+ +IEL RGVPL+T+LFMAS++LPLFLP   ++DK+LRAL+
Sbjct: 179 SVLLALGRTSDMPIAKPFCVAYIELIRGVPLITILFMASVVLPLFLPAGMELDKVLRALV 238

Query: 255 GVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTF 314
           G++ F SAY+AE +RGGLQ ISKGQ+EAA++LG+SY +K  ++I+PQ ++ VIP +VN F
Sbjct: 239 GITMFFSAYLAENIRGGLQGISKGQYEAADALGMSYWKKTIVVILPQALRIVIPPMVNNF 298

Query: 315 IGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSV 374
           IG+ KD+SL+ I+ + DLL I     S   W   +      +FI F +WI C+++S YS 
Sbjct: 299 IGILKDTSLVGIVGLVDLLQIAFATTSNPKWFGRLE--EAYVFIAFWYWILCYALSSYSQ 356

Query: 375 FIEKTL 380
           ++E+ +
Sbjct: 357 YLERKM 362


>gi|331007195|ref|ZP_08330406.1| general amino acid ABC transporter, permease protein [gamma
           proteobacterium IMCC1989]
 gi|330418990|gb|EGG93445.1| general amino acid ABC transporter, permease protein [gamma
           proteobacterium IMCC1989]
          Length = 368

 Score =  231 bits (590), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 130/370 (35%), Positives = 202/370 (54%), Gaps = 13/370 (3%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
                P    G +AW+ +N F +  +   T + +  L+  IP +  W F  A + G+ + 
Sbjct: 10  PAKPAPSSAVGPVAWMRENLFSSILNTACTVVFVAFLVSIIPALFDWFFWSANFAGATQA 69

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
            C             + ACW F    ++Q ++G+Y   + WR  +  ++   ++      
Sbjct: 70  ACVG-----------DGACWVFTKAWFQQLMYGSYTDGELWRVNICVISLFAVIYAATKL 118

Query: 137 SFPRKFLNSILLFGLFPIFSFFVLYG-GLGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
               +   +I LF + P     +L G  LGL  V T  WGG  + ++++   II++ PL 
Sbjct: 119 PKDYRNKIAIPLFLVLPFIWIIILNGKLLGLEHVSTDYWGGFALNVLMAAASIIVAFPLS 178

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
            L ALGR S +P  R  C+  IE FRGVP++ + FM S+MLPLF P+  +VDKL+R  + 
Sbjct: 179 FLWALGRRSEMPFARTVCVILIEFFRGVPVLALFFMGSVMLPLFFPEGTNVDKLIRVWIV 238

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           +  F S Y+AEV RGG Q+I +GQ+EAA+S+GLSY QK  LII+PQ IK  +P I+ TFI
Sbjct: 239 LILFMSGYMAEVFRGGFQAIPQGQYEAADSIGLSYWQKNLLIILPQNIKISMPNILATFI 298

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
            LFK+++ + II +F++L   +   + S W+     T G +F+  +FWI CFS+S+ S  
Sbjct: 299 MLFKNTTFLLIIGIFEILSTTQAALTNSNWLG-GHSTEGYVFVALLFWICCFSMSMISNS 357

Query: 376 IEKTLHKGSK 385
           IE+ L    +
Sbjct: 358 IERKLETSHR 367


>gi|288962138|ref|YP_003452433.1| general L-amino acid transport system permease protein
           [Azospirillum sp. B510]
 gi|288914404|dbj|BAI75889.1| general L-amino acid transport system permease protein
           [Azospirillum sp. B510]
          Length = 405

 Score =  231 bits (590), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 148/359 (41%), Positives = 212/359 (59%), Gaps = 14/359 (3%)

Query: 28  IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQ 87
            I+W   N F TP +  L+   + LL   +P + +W+ L+A W G +   C   +     
Sbjct: 61  PISWTRNNLFNTPLNTALSLACLALLWLVVPPMANWLLLNASWSGGS-EACREAA----- 114

Query: 88  PDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSIL 147
                 ACW+ I  ++    FG YP  ++WRP L       +L    + +F R +L    
Sbjct: 115 -----GACWSVIVVKHRLIFFGTYPYDEQWRPFLACALFVAMLGASGVRAFWRPWLAGA- 168

Query: 148 LFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIP 207
                      +  G  GL  V    WGGL +TL++S F I ++ PL ILLALGR S +P
Sbjct: 169 WALTLVGMGVLMWGGVAGLGYVPNDRWGGLPITLMLSVFSIALAFPLSILLALGRQSALP 228

Query: 208 VLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEV 267
            +R  C+ FIE  RGVPLV+VLFMAS+M PLFLP+   VDKLLRAL G++ F +AY+AE 
Sbjct: 229 AIRTFCVGFIETMRGVPLVSVLFMASVMFPLFLPEGVTVDKLLRALAGMTLFTAAYLAEA 288

Query: 268 LRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISII 327
           +RGGLQ+I KGQ+EAA++LGLSY QK  LI++PQ ++ VIP IVN FI  FKD+SL++I+
Sbjct: 289 VRGGLQAIPKGQYEAADALGLSYWQKTMLIVLPQALRIVIPPIVNQFISAFKDTSLVTIV 348

Query: 328 NMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
            ++DLL    V  ++  W          +F G +FWIFCFS+S YS ++E+  ++ +++
Sbjct: 349 GLYDLLTAATVATTDPEWRPYFA--EVYVFAGLMFWIFCFSMSRYSQWLERLANRYTRR 405


>gi|126724901|ref|ZP_01740744.1| Amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine [Rhodobacterales bacterium
           HTCC2150]
 gi|126706065|gb|EBA05155.1| Amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine [Rhodobacterales bacterium
           HTCC2150]
          Length = 431

 Score =  231 bits (590), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 142/440 (32%), Positives = 217/440 (49%), Gaps = 64/440 (14%)

Query: 1   MIDSCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGI 60
           M+DS K   +VR        PP    G + W+ +N F TP + +LT L +  +   +   
Sbjct: 1   MVDSTKSVAFVRTEDAPSLPPPSSAAGPVKWLRENLFATPANAILTVLSLIAIYLLLRDF 60

Query: 61  IHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGN-YPMAQRWRP 119
           + W+ L+ VW   +   C  V QG          C+A + +R+ Q +FG  YP    WRP
Sbjct: 61  LPWL-LNGVWNSDSLAGCREVLQGA------TGGCFAVLTERWNQLLFGFTYPTDLYWRP 113

Query: 120 ILVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGL--------------- 164
            + F    +   P+L    PRK L    LF     +  +                     
Sbjct: 114 TVAFALFFLAAAPVLFFDLPRKLLIFTALFPFIAYYLIWGGSIWTPILSLVGIIVGYIVY 173

Query: 165 --------------------------------------GLSIVETSLWGGLLVTLVISFF 186
                                                  +  V +   GG ++ +++   
Sbjct: 174 SRLVVSSFAAGFFGAILAAVIVWIVGGSFVPDGFAVEGSMRSVPSRDLGGFMLNMMLGVT 233

Query: 187 GIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDV 246
            + +S+P+GI LALGR S++P++++ C+ FIE  RGVPL+T+LF+AS+ML  F P    V
Sbjct: 234 CVSLSVPIGIALALGRQSSMPLIKFVCVIFIEFIRGVPLITLLFVASVMLAYFFPPEATV 293

Query: 247 DKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRV 306
           D  LR ++ ++ F++AYIAEV+RGGL ++ KGQ+EA +SLGL Y Q MRLII+PQ +K  
Sbjct: 294 DLFLRVVIMITLFSAAYIAEVVRGGLAALPKGQYEAGDSLGLDYPQAMRLIILPQALKIS 353

Query: 307 IPGIVNTFIGLFKDSSLISIINMFDLLGIVRV-NFSESTWISSVTPTTGLIFIGFVFWIF 365
           IPGIVN  +GLFKD+ L+S+I+MFDL+G++R    +   W           F   +F+I 
Sbjct: 354 IPGIVNIAVGLFKDTVLVSVISMFDLIGMIRGPIPASPDWNGVYW--ELFGFASVLFFIC 411

Query: 366 CFSISLYSVFIEKTLHKGSK 385
           C+ IS YS ++E+ L    +
Sbjct: 412 CYGISQYSQWLERRLATDHR 431


>gi|84499806|ref|ZP_00998094.1| ABC glutamate/glutamine/aspartate/asparagine transporter, inner
           membrane subunit BztC [Oceanicola batsensis HTCC2597]
 gi|84392950|gb|EAQ05161.1| ABC glutamate/glutamine/aspartate/asparagine transporter, inner
           membrane subunit BztC [Oceanicola batsensis HTCC2597]
          Length = 434

 Score =  230 bits (587), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 140/438 (31%), Positives = 224/438 (51%), Gaps = 65/438 (14%)

Query: 5   CKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWV 64
            +   YV++  + PS PP  + G + W+ +N F +  + ++T L +  +       + W 
Sbjct: 6   AQSVGYVQRSQIPPSPPPATEAGAVRWVRENLFSSTANAIMTLLGLLAIYHLAVWALPW- 64

Query: 65  FLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGN-YPMAQRWRPILVF 123
            L+ VW   + + C  +  G         AC+A I +R+ Q +FG  YP  + WRP L F
Sbjct: 65  ILNGVWNADSLSECREILDGA------RGACFAVIAERWNQLLFGFKYPSTEYWRPTLAF 118

Query: 124 LTGSI----------------LLTPMLIPSFPRKFLNSIL-------------------- 147
           +   +                L        F   +  SI                     
Sbjct: 119 VLLLVSASPVLFSKLPRQLLVLTALYPFVGFWLIWGGSIWVPVFALLGIVAGYYAFKQLE 178

Query: 148 ------------------LFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGII 189
                              +    +         + L  V +   GG ++ L++    I 
Sbjct: 179 RQSFAMGLIGAVVAAALFWWVTGFVIPDLSRIIPISLPEVPSRDMGGFMLNLILGTVCIS 238

Query: 190 ISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKL 249
           +S+P+GI+LALGR S +P++++ C+ FIE  RGVPL+T+LF+A+++L  FLP   + D +
Sbjct: 239 LSLPIGIVLALGRRSQMPLIKWICVIFIEFIRGVPLITLLFVANVVLAYFLPPGSNFDLI 298

Query: 250 LRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPG 309
           LR ++ ++ FASAYIAEV+RGGL ++ KGQ+EAA+SLGL Y Q MRLII+PQ +K  IPG
Sbjct: 299 LRVIIMITMFASAYIAEVIRGGLAALPKGQYEAADSLGLDYPQAMRLIILPQALKISIPG 358

Query: 310 IVNTFIGLFKDSSLISIINMFDLLGIVRV-NFSESTWISSVTPTTGLIFIGFVFWIFCFS 368
           IVN  +GLFKD++L+S+I+MFD++G++R    + + W          IF   +F+I C++
Sbjct: 359 IVNVAVGLFKDTTLVSVISMFDMVGMIRGPILASTDWNGVYW--ELFIFAALLFFIVCYN 416

Query: 369 ISLYSVFIEKTLHKGSKK 386
           IS YS ++E+ L  G K+
Sbjct: 417 ISQYSQWLERQLDTGHKR 434


>gi|330814054|ref|YP_004358293.1| glutamate Aspartate transport system permease protein GltK
           [Candidatus Pelagibacter sp. IMCC9063]
 gi|327487149|gb|AEA81554.1| glutamate Aspartate transport system permease protein GltK
           [Candidatus Pelagibacter sp. IMCC9063]
          Length = 347

 Score =  230 bits (587), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 162/356 (45%), Positives = 222/356 (62%), Gaps = 14/356 (3%)

Query: 28  IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQ 87
            I W  +N F   KD LLT  I+ L   SIP +++WVFLDA + G ++  CT        
Sbjct: 3   FINWSKQNLFANWKDSLLTITILYLFYVSIPPLLNWVFLDATFFGDSKKDCTG------- 55

Query: 88  PDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSIL 147
                 ACW FI    ++F +G YP  Q WR  L F+   I +      S   K    I 
Sbjct: 56  ----GGACWVFINVWIKRFTYGMYPNDQIWRINLAFVIFFISIGSYFFVSSKIKKYIFIF 111

Query: 148 LFGLFPIF-SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNI 206
           L  +FP    F    G LGL  VET +WGGL +TL IS F II   P+G+LLA+GR SN+
Sbjct: 112 LTLVFPFLAIFLFHGGSLGLEEVETRVWGGLFLTLFISVFSIIFCFPIGVLLAMGRRSNL 171

Query: 207 PVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAE 266
           PV++Y  I FIEL+RGVPL+TVLFMA++M P+FLP   ++DKL+R ++ ++ F SAYIAE
Sbjct: 172 PVIKYFSIGFIELWRGVPLITVLFMAAVMFPVFLPSGTNLDKLIRVIIAITLFESAYIAE 231

Query: 267 VLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISI 326
           V+RGGLQ+I +GQ++AANS+G+ Y +   LII+PQ +K VIPG+ NTFI LFKD+ LI +
Sbjct: 232 VVRGGLQAIPRGQYDAANSIGMGYWKSHLLIILPQALKIVIPGVANTFIALFKDTPLILV 291

Query: 327 INMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHK 382
           + + +LLG+V +  +   W+     T G +F  FV++IFCFS+S YS+ +E  L  
Sbjct: 292 VGLMELLGMVNMAKTNPAWLGL--ATEGYVFAAFVYFIFCFSMSRYSLSLENKLKT 345


>gi|149203335|ref|ZP_01880305.1| glutamate/glutamine/aspartate/asparagine ABC transporter, permease
           protein [Roseovarius sp. TM1035]
 gi|149143168|gb|EDM31207.1| glutamate/glutamine/aspartate/asparagine ABC transporter, permease
           protein [Roseovarius sp. TM1035]
          Length = 429

 Score =  230 bits (586), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 141/435 (32%), Positives = 227/435 (52%), Gaps = 64/435 (14%)

Query: 6   KEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVF 65
            +F +VRK +L  + PP  Q G I W+ +N F +P + LLT +   ++   +     W F
Sbjct: 4   DQFAFVRKHMLPEAPPPATQTGAIKWLRENLFSSPGNALLTVVSAYVVFQIVISATPW-F 62

Query: 66  LDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGN-YPMAQRWRPILVFL 124
           L+ VW   + + C  +       DG   AC+A + +R+ Q +FG  YP    WRP L F+
Sbjct: 63  LNGVWDSPSLSACREIL------DGKTGACFAVLSERWNQLLFGFKYPSELYWRPGLAFV 116

Query: 125 TGSILLTPMLIPSFPRKFLNSIL------------------------------------- 147
              I   P+L      + +                                         
Sbjct: 117 LLFIAAAPVLFGKVFPRKMLIFTGLYPFIAYWLIWGGSLMVPVFALIGVLVGAVVYSRVV 176

Query: 148 ----------------LFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIIS 191
                           +F +   +    +   L +  V +   GG ++ L++    + +S
Sbjct: 177 TVNAGVAVIAAFVAALIFWILSGYVTGPMENVLAIEAVASRDMGGFMINLMLGVVCVSLS 236

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +PLGILLALGR S++P++++ C+ FIE  RGVPL+T+LF+A+++L  FLP   + D +LR
Sbjct: 237 LPLGILLALGRQSSMPIIKWICVVFIEFIRGVPLITLLFVANVVLAYFLPPGTNFDLILR 296

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
            ++ ++ F+SAYIAEV+RGGL ++ +GQ+EAA+SLGL Y Q M+LII+PQ +K  IPGIV
Sbjct: 297 VIIMITMFSSAYIAEVIRGGLAALPRGQYEAADSLGLDYAQAMQLIILPQALKISIPGIV 356

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRV-NFSESTWISSVTPTTGLIFIGFVFWIFCFSIS 370
           N  +GLFKD++L+S+I+MFD++G++R    + + W           F   +F+I C+ IS
Sbjct: 357 NVAVGLFKDTTLVSVISMFDIVGMIRGPILASAEWNGVYW--ELFGFACVLFFITCYGIS 414

Query: 371 LYSVFIEKTLHKGSK 385
            YS ++E+ L    +
Sbjct: 415 QYSQWLERQLRTDHR 429


>gi|308094386|ref|ZP_05888982.2| general L-amino acid transport system permease protein AapM [Vibrio
           parahaemolyticus AN-5034]
 gi|308094323|gb|EFO44018.1| general L-amino acid transport system permease protein AapM [Vibrio
           parahaemolyticus AN-5034]
          Length = 349

 Score =  230 bits (585), Expect = 5e-58,   Method: Composition-based stats.
 Identities = 159/344 (46%), Positives = 232/344 (67%), Gaps = 14/344 (4%)

Query: 44  LLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRY 103
           ++T ++  ++  ++  I+ W F++A WIGS R  C+              ACW FI  R+
Sbjct: 19  IVTLILAYIVFNALWHIVDWAFINADWIGSTRDDCS-----------REGACWVFISVRW 67

Query: 104 EQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSF-FVLYG 162
           EQF++G YP A+ WRP L ++T +I    +     P++    +    ++P      +  G
Sbjct: 68  EQFMYGFYPEAELWRPRLFYITLAIFTVLLAYEKTPKRLWIWLFFVNIYPFIVAALLYGG 127

Query: 163 GLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRG 222
             GL +VET  WGGLLVTL+I+  GI++S+P+G+ LALGR S++P++R  C  +IE++RG
Sbjct: 128 VFGLEVVETHKWGGLLVTLIIALVGIVVSLPIGVALALGRRSDMPIIRSICTIYIEVWRG 187

Query: 223 VPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEA 282
           VPL+TVLFMAS+MLPLFL +  + DKL+RAL+GV  F++AY+AEV+RGGLQ+I KGQ+EA
Sbjct: 188 VPLITVLFMASVMLPLFLAEGSETDKLIRALIGVVMFSAAYMAEVVRGGLQAIPKGQYEA 247

Query: 283 ANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSE 342
           A++LGLSY +K  LII+PQ +K  IP IVNTFIGLFKD+SL+ II MFD+LGI +   ++
Sbjct: 248 ADALGLSYWKKTGLIILPQALKITIPSIVNTFIGLFKDTSLVLIIGMFDVLGIGQAANTD 307

Query: 343 STWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
             W+     T   +F+  VFW+FCF +S YS+++E  LH G K+
Sbjct: 308 PEWLG--FATESYVFVALVFWVFCFGMSRYSIWLENKLHTGHKR 349


>gi|89093224|ref|ZP_01166174.1| general amino acid ABC transporter, permease protein
           [Oceanospirillum sp. MED92]
 gi|89082520|gb|EAR61742.1| general amino acid ABC transporter, permease protein
           [Oceanospirillum sp. MED92]
          Length = 366

 Score =  229 bits (584), Expect = 5e-58,   Method: Composition-based stats.
 Identities = 136/372 (36%), Positives = 206/372 (55%), Gaps = 13/372 (3%)

Query: 15  LLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSN 74
            L     P    G I W+  NFF +  + + T LI+ LL   IP ++ W+ + A W G+ 
Sbjct: 6   PLPDQPAPNDTVGPIHWVKDNFFSSAANTIATLLILALLATVIPPLVDWLLISANWSGTT 65

Query: 75  RTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPML 134
           +  CT            + ACW F+    +QF +G+YP  + WR  L  L    ++    
Sbjct: 66  QDACTK-----------DGACWVFVIAWSKQFFYGSYPTEELWRINLCVLMLIGVIASSQ 114

Query: 135 IPSFPRKFLNSILLFGLFPIFSFFV-LYGGLGLSIVETSLWGGLLVTLVISFFGIIISMP 193
           + +   +   SI  F L P     +     +GL  V T  WGG  + ++++   II++ P
Sbjct: 115 LLNKDWRNKFSIPAFLLLPFVCILILDGSWIGLEYVSTDYWGGFALNVLLAAASIIVAFP 174

Query: 194 LGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRAL 253
           L  + ALGR S +P ++   I  IE FRGVP++ + FM S+MLPLF P+  +VDKL+R  
Sbjct: 175 LSFVWALGRRSEMPFIKSVSILLIEFFRGVPVLALFFMGSVMLPLFFPEGTNVDKLVRVW 234

Query: 254 LGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNT 313
           + ++ F + Y+AEV RGG Q++  GQ+EAA+SLGLSY QK  LII+PQVIK  +P I+ T
Sbjct: 235 IVLTLFMAGYMAEVFRGGFQAVPTGQYEAADSLGLSYWQKTLLIILPQVIKVSMPNILAT 294

Query: 314 FIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYS 373
           F+ LFK+++ + II +F++L   +   + S W+     T G +F+  VFWI C+S+S  S
Sbjct: 295 FVMLFKNTTFLLIIGIFEVLSTTQTALTNSNWLG-GHSTEGYLFVAIVFWICCYSMSRIS 353

Query: 374 VFIEKTLHKGSK 385
             IE+ L    K
Sbjct: 354 ASIERKLDTSHK 365


>gi|89092422|ref|ZP_01165376.1| general amino acid ABC transporter, permease protein
           [Oceanospirillum sp. MED92]
 gi|89083510|gb|EAR62728.1| general amino acid ABC transporter, permease protein
           [Oceanospirillum sp. MED92]
          Length = 366

 Score =  229 bits (583), Expect = 7e-58,   Method: Composition-based stats.
 Identities = 135/372 (36%), Positives = 206/372 (55%), Gaps = 13/372 (3%)

Query: 15  LLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSN 74
            L     P    G I W+  NFF +  + + T LI+ LL   +P ++ W+ + A W G+ 
Sbjct: 6   PLPDQPAPNDTVGPIHWVKDNFFSSAMNTIATLLILALLATVVPPLVDWLLISANWSGTT 65

Query: 75  RTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPML 134
           +  CT            + ACW F+    +QF +G+YP  + WR  L  L    ++    
Sbjct: 66  QDACTK-----------DGACWVFVIAWSKQFFYGSYPTEELWRINLCVLMLIGVIASSQ 114

Query: 135 IPSFPRKFLNSILLFGLFPIFSFFV-LYGGLGLSIVETSLWGGLLVTLVISFFGIIISMP 193
           + +   +   SI  F L P     +     +GL  V T  WGG  + ++++   II++ P
Sbjct: 115 LLNKDWRNKFSIPAFLLLPFVCILILDGSWIGLEYVSTDYWGGFALNVLLAAASIIVAFP 174

Query: 194 LGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRAL 253
           L  + ALGR S +P ++   I  IE FRGVP++ + FM S+MLPLF P+  +VDKL+R  
Sbjct: 175 LSFVWALGRRSEMPFIKSVSILLIEFFRGVPVLALFFMGSVMLPLFFPEGTNVDKLVRVW 234

Query: 254 LGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNT 313
           + ++ F + Y+AEV RGG Q++  GQ+EAA+SLGLSY QK  LII+PQVIK  +P I+ T
Sbjct: 235 IVLTLFMAGYMAEVFRGGFQAVPTGQYEAADSLGLSYWQKTLLIILPQVIKVSMPNILAT 294

Query: 314 FIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYS 373
           F+ LFK+++ + II +F++L   +   + S W+     T G +F+  VFWI C+S+S  S
Sbjct: 295 FVMLFKNTTFLLIIGIFEVLSTTQTALTNSNWLG-GHSTEGYLFVAIVFWICCYSMSRIS 353

Query: 374 VFIEKTLHKGSK 385
             IE+ L    K
Sbjct: 354 ASIERKLDTSHK 365


>gi|83950491|ref|ZP_00959224.1| glutamate/glutamine/aspartate/asparagine ABC transporter, permease
           protein [Roseovarius nubinhibens ISM]
 gi|83838390|gb|EAP77686.1| glutamate/glutamine/aspartate/asparagine ABC transporter, permease
           protein [Roseovarius nubinhibens ISM]
          Length = 442

 Score =  228 bits (581), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 136/440 (30%), Positives = 225/440 (51%), Gaps = 61/440 (13%)

Query: 2   IDSCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGII 61
            ++ +   +VR  +L    PP    G + W+ KN F +  + +LT + +  + + + G++
Sbjct: 6   SEAARAIAFVRTDMLPEQEPPATTIGFVGWLRKNLFSSVANSILTVIALLFIAYVMSGLL 65

Query: 62  HWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPIL 121
            W+F  +VW   +   C  +       D    ACW  + +R+ Q ++G YP    WR  L
Sbjct: 66  PWLF-QSVWNAGSLNECREI-MNATWGDTHGHACWGVVKERWLQLLYGFYPDHLYWRVNL 123

Query: 122 VFLTGSIL--------------LTPMLIPSFPRKFLNS---------------------- 145
            F+   +               L    +  F   +L                        
Sbjct: 124 AFVLTLVAMAPVLFSEQLPRKMLIVTALYPFVMPWLLWGGSIWGPIAAALGFVIGYYAYK 183

Query: 146 -----------ILLFGLFPIFSF----------FVLYGGLGLSIVETSLWGGLLVTLVIS 184
                      I+   L P+  +                +G+  V++  +GG ++ +++ 
Sbjct: 184 ILEPIAGSLVAIIAAVLLPVIWWFGLSGLITGALTDLMPIGIEAVQSRKFGGFMLAILLG 243

Query: 185 FFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTW 244
              I  S+P+GI+LALGR S++ +++  C+ FIE  RGVPL+T+LF+AS++L LFLP   
Sbjct: 244 IVAIGCSLPIGIVLALGRQSDLLLVKAICVGFIEFIRGVPLITLLFVASLLLNLFLPPGT 303

Query: 245 DVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIK 304
           + D +LR ++ ++ FA+AY+AEV+RGGL ++ KGQ+E A+SLGL+Y Q  RLIIMPQ +K
Sbjct: 304 NFDIILRVMIMMTLFAAAYMAEVIRGGLAALPKGQYEGADSLGLNYWQAQRLIIMPQALK 363

Query: 305 RVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWI 364
             IPGIV+TFIG+FKD++L+SII +FD++G+     +++ W          I   F   I
Sbjct: 364 ISIPGIVSTFIGIFKDTTLVSIIGLFDVIGLSNAIRADTAWNGIYWELFAFIAFLFF--I 421

Query: 365 FCFSISLYSVFIEKTLHKGS 384
            CFS+S YS+++E+ L  G 
Sbjct: 422 VCFSMSRYSMYLERKLQTGH 441


>gi|85703853|ref|ZP_01034956.1| glutamate/glutamine/aspartate/asparagine ABC transporter, permease
           protein [Roseovarius sp. 217]
 gi|85671173|gb|EAQ26031.1| glutamate/glutamine/aspartate/asparagine ABC transporter, permease
           protein [Roseovarius sp. 217]
          Length = 429

 Score =  228 bits (580), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 135/435 (31%), Positives = 223/435 (51%), Gaps = 64/435 (14%)

Query: 6   KEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVF 65
            +  +VR  +L  + PP  Q G + W+ +N F +P + LLT +   ++   +     W F
Sbjct: 4   DQLAFVRTHMLPEAPPPTAQTGAVKWLRENLFSSPGNALLTLVSAYVVFQIVISTAPW-F 62

Query: 66  LDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGN-YPMAQRWRPILVFL 124
           ++ VW   + T C  +  G +        C+A + +R+ Q +FG  YP    WRP L F+
Sbjct: 63  INGVWESPSLTACREILDGKM------GGCFAVLTERWNQLLFGFKYPSELYWRPGLAFV 116

Query: 125 TGSILLTPMLIPSFPRKFLNSIL------------------------------------- 147
              I   P+L      + +                                         
Sbjct: 117 LLFIAAAPVLFGKIFPRKMLIFTGLYPFIAYWLIWGGSVLVPVFALLGVLVGAFTYSRVV 176

Query: 148 ----------------LFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIIS 191
                           +F +   +    +   + +  V +   GG ++ L++    + +S
Sbjct: 177 TISAGVAVIAAFVAALIFWILSGYVTGPMENVMAIQAVASRDMGGFMINLMLGVVCVSLS 236

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +PLGILLALGR S++P++++ C+ FIE  RGVPL+T+LF+A+++L  FLP   + D +LR
Sbjct: 237 LPLGILLALGRQSSMPIIKWICVVFIEFIRGVPLITLLFVANVVLAYFLPPGTNFDLILR 296

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
            ++ ++ F+SAYIAEV+RGGL ++ +GQ+EA +SLGL Y Q M+LII+PQ +K  IPGIV
Sbjct: 297 VIIMITMFSSAYIAEVIRGGLAALPRGQYEAGDSLGLDYAQSMQLIILPQALKISIPGIV 356

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRV-NFSESTWISSVTPTTGLIFIGFVFWIFCFSIS 370
           N  +GLFKD++L+S+I+MFD++G++R    + S W           F   +F+I C+ IS
Sbjct: 357 NVAVGLFKDTTLVSVISMFDIVGMIRGPILASSEWNGVYW--ELFGFACVLFFITCYGIS 414

Query: 371 LYSVFIEKTLHKGSK 385
            YS ++E+ L    +
Sbjct: 415 QYSQWLERQLRTDHR 429


>gi|27378024|ref|NP_769553.1| ABC transporter permease [Bradyrhizobium japonicum USDA 110]
 gi|27351170|dbj|BAC48178.1| blr2913 [Bradyrhizobium japonicum USDA 110]
          Length = 368

 Score =  227 bits (579), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 140/352 (39%), Positives = 213/352 (60%), Gaps = 13/352 (3%)

Query: 28  IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWI--GSNRTVCTTVSQGG 85
           ++ W+  N F +  + +L+ +++ +L   I   + W   +AVW+   ++ + C  V    
Sbjct: 23  VLRWLRTNLFSSIPNGILSVVLLAILAKGIFSFVQWGIANAVWLTPANDSSACRAVRGF- 81

Query: 86  IQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNS 145
                   ACWA I ++Y   +FG YP  ++WRP L  +    L       +F R+ L  
Sbjct: 82  -------GACWAIIPEKYRFILFGTYPFDEQWRPALSVVLFIALFYLSSRRAFWRRELVY 134

Query: 146 ILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSN 205
           +   G+  + S  +  G  GLS V    WGGL VTL+++ FG+    PLGIL+ALGR S 
Sbjct: 135 L-WIGVLALISVLMWGGVFGLSFVSQDRWGGLPVTLILATFGLAFGFPLGILVALGRRSK 193

Query: 206 IPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIA 265
           +P +R   + ++EL RGVPLV++LFMAS+M PLF+P  +++DKLLRA + +  FA AY+A
Sbjct: 194 LPAIRSLSVLYVELIRGVPLVSLLFMASVMFPLFMPSGFNIDKLLRAQIAIILFAGAYLA 253

Query: 266 EVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLIS 325
           EV+RGGLQ++ +GQ+EAA +LGLSY +K RLI++PQ I+ VIP +VNTFI  FKD+SL+ 
Sbjct: 254 EVIRGGLQAVPRGQYEAAEALGLSYWRKHRLIVLPQAIRHVIPPLVNTFIAFFKDTSLVL 313

Query: 326 IINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIE 377
           II +FDLL   +    +  W          IF+  ++++FCF++S YS  +E
Sbjct: 314 IIGIFDLLTTAKTAIIDPAWQQ--FSVEVYIFVAAIYFVFCFAMSRYSRGLE 363


>gi|126461169|ref|YP_001042283.1| polar amino acid ABC transporter, inner membrane subunit
           [Rhodobacter sphaeroides ATCC 17029]
 gi|221638147|ref|YP_002524409.1| Polar amino acid ABC transporter inner membrane subunit
           [Rhodobacter sphaeroides KD131]
 gi|126102833|gb|ABN75511.1| polar amino acid ABC transporter, inner membrane subunit
           [Rhodobacter sphaeroides ATCC 17029]
 gi|221158928|gb|ACL99907.1| Polar amino acid ABC transporter, inner membrane subunit
           [Rhodobacter sphaeroides KD131]
          Length = 442

 Score =  227 bits (579), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 146/441 (33%), Positives = 225/441 (51%), Gaps = 64/441 (14%)

Query: 5   CKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWV 64
            +  P+VR+ +L P  PP  + G+++W+ +N F  P +I LT L +  + + + GI+ W+
Sbjct: 6   AQTVPFVRETMLPPVAPPANEAGVVSWMRQNLFSGPLNIALTLLGLVAIYYVLEGIVPWL 65

Query: 65  FLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFL 124
            + +VW       C  +       +G   ACWA I +R+ QF++G YP    WRP L FL
Sbjct: 66  -MRSVWTADTLAQCRQIITER-WGEGATGACWAVIRERWPQFLYGFYPNHLYWRPTLTFL 123

Query: 125 TGSILLTP---------MLIPSFPRKFLNSILLFGLFPIFSFFV---------------- 159
              + L P         ML  S    FL   LL+G                         
Sbjct: 124 LLFVALAPILFAQVPRQMLWFSLAYPFLAFWLLWGGSIFLPLVAAAGFLFGWLAYRLAAR 183

Query: 160 ----------------------------------LYGGLGLSIVETSLWGGLLVTLVISF 185
                                                 L L  V +  +GG ++ + I  
Sbjct: 184 FGTIAAVAAAALVPVLWWLFLAGDVSDDLARLTGRTFPLWLEEVRSDKFGGFVLAVTIGV 243

Query: 186 FGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWD 245
            GI +S+PLGI+LALGR S++ +++   ++FIE  RGVPL+ +LF AS++L  FLP    
Sbjct: 244 SGIALSLPLGIILALGRRSDMFLIKALSVSFIEFIRGVPLIALLFTASLLLNYFLPPGTT 303

Query: 246 VDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKR 305
            D +LR ++ V+ FA+AYIAEV+RGGL ++ +GQ+EAA++LGL Y +  RLII+PQ +K 
Sbjct: 304 FDIILRVIIMVTLFAAAYIAEVIRGGLAALPRGQYEAADALGLDYWKAQRLIILPQALKI 363

Query: 306 VIPGIVNTFIGLFKDSSLISIINMFD-LLGIVRVNFSESTWISSVTPTTGLIFIGFVFWI 364
            IPGIV+TFIG+FKD++L+  + + D L GI     + + W          IF+G +F+ 
Sbjct: 364 SIPGIVSTFIGMFKDTTLVVFVGLLDPLKGITDAVRASTDWKGIYW--EPYIFVGLIFFA 421

Query: 365 FCFSISLYSVFIEKTLHKGSK 385
           F F++S YS+ +E+ L    +
Sbjct: 422 FNFAMSRYSMHLERRLKTDHR 442


>gi|77462293|ref|YP_351797.1| ABC glutamate/glutamine/aspartate/asparagine transporter, inner
           membrane subunit BztC [Rhodobacter sphaeroides 2.4.1]
 gi|77386711|gb|ABA77896.1| ABC glutamate/glutamine/aspartate/asparagine transporter, inner
           membrane subunit BztC [Rhodobacter sphaeroides 2.4.1]
          Length = 442

 Score =  227 bits (579), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 146/441 (33%), Positives = 225/441 (51%), Gaps = 64/441 (14%)

Query: 5   CKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWV 64
            +  P+VR+ +L P  PP  + G+++W+ +N F  P +I LT L +  + + + GI+ W+
Sbjct: 6   AQTVPFVRETMLPPVAPPANEAGVVSWMRQNLFSGPLNIALTVLGLVAIYYVLEGIVPWL 65

Query: 65  FLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFL 124
            + +VW       C  +       +G   ACWA I +R+ QF++G YP    WRP L FL
Sbjct: 66  -MRSVWTADTLAQCRQIITER-WGEGATGACWAVIRERWPQFLYGFYPNHLYWRPTLTFL 123

Query: 125 TGSILLTP---------MLIPSFPRKFLNSILLFGLFPIFSFFV---------------- 159
              + L P         ML  S    FL   LL+G                         
Sbjct: 124 LLFVALAPILFAQVPRQMLWFSLAYPFLAFWLLWGGSIFLPLVAAAGFLFGWLAYRLAAR 183

Query: 160 ----------------------------------LYGGLGLSIVETSLWGGLLVTLVISF 185
                                                 L L  V +  +GG ++ + I  
Sbjct: 184 FGTIAAVAAAALVPVLWWLFLAGDVSDDLARLTGRSFPLWLEEVRSDKFGGFVLAVTIGV 243

Query: 186 FGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWD 245
            GI +S+PLGI+LALGR S++ +++   ++FIE  RGVPL+ +LF AS++L  FLP    
Sbjct: 244 SGIALSLPLGIILALGRRSDMFLIKALSVSFIEFIRGVPLIALLFTASLLLNYFLPPGTT 303

Query: 246 VDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKR 305
            D +LR ++ V+ FA+AYIAEV+RGGL ++ +GQ+EAA++LGL Y +  RLII+PQ +K 
Sbjct: 304 FDIILRVIIMVTLFAAAYIAEVIRGGLAALPRGQYEAADALGLDYWKAQRLIILPQALKI 363

Query: 306 VIPGIVNTFIGLFKDSSLISIINMFD-LLGIVRVNFSESTWISSVTPTTGLIFIGFVFWI 364
            IPGIV+TFIG+FKD++L+  + + D L GI     + + W          IF+G +F+ 
Sbjct: 364 SIPGIVSTFIGMFKDTTLVVFVGLLDPLKGITDAVRASTDWKGIYW--EPYIFVGLIFFA 421

Query: 365 FCFSISLYSVFIEKTLHKGSK 385
           F F++S YS+ +E+ L    +
Sbjct: 422 FNFAMSRYSMHLERRLKTDHR 442


>gi|56697223|ref|YP_167588.1| amino acid ABC transporter, permease protein [Ruegeria pomeroyi
           DSS-3]
 gi|56678960|gb|AAV95626.1| amino acid ABC transporter, permease protein [Ruegeria pomeroyi
           DSS-3]
          Length = 375

 Score =  226 bits (577), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 136/373 (36%), Positives = 223/373 (59%), Gaps = 15/373 (4%)

Query: 14  RLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGS 73
           + +     P  Q G IAW+  N FG  KD  +T  ++ +LL  +P +I W+ ++A ++G 
Sbjct: 18  QPMAARPAPASQIGPIAWLRANLFGGWKDTAITLSLLAVLLAVVPNLIEWLLINATFLGD 77

Query: 74  NRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPM 133
           +   C               ACW F+  +++  + G YP    WRP +  L   +L    
Sbjct: 78  D-ETCRQ----------NAGACWPFLQAKFQVLMVGVYPQDLSWRPAIAALALLVLAGFT 126

Query: 134 LIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMP 193
                  + +  I+ + + PIF+  ++ G  G+  V+ SLWGGL+++++++  G+I+S+P
Sbjct: 127 YADRI--RGIALIVAWAVLPIFALIMIGGAFGMQEVDQSLWGGLMLSVLLALVGVIVSIP 184

Query: 194 LGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRAL 253
           LG+LLALGR+   P ++  C+ FIEL RGVPL+T+LFMAS+M+PLFLP    ++ LLR  
Sbjct: 185 LGVLLALGRHYGSPAVKAICVAFIELVRGVPLITILFMASVMMPLFLPPDLVINNLLRIQ 244

Query: 254 LGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNT 313
           +G+  F+SAY+AEV+RGGLQ+I KGQ EA+ +LG+S  + +  +++PQ ++ V+P ++  
Sbjct: 245 IGMILFSSAYMAEVVRGGLQAIPKGQTEASLALGVSPARTIIFVVVPQALRHVLPPLIGR 304

Query: 314 FIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYS 373
            I LFKD+SL+ I+ + D LG+VR    +  W+         +F  FV+W+ C+S+SLY 
Sbjct: 305 CIALFKDTSLVIIVGLLDFLGMVRGAALDPEWLGFQA--EAYVFAAFVYWLICYSLSLYG 362

Query: 374 VFIEKTLHKGSKK 386
             +E+    GSK+
Sbjct: 363 RALERRGPAGSKR 375


>gi|262277478|ref|ZP_06055271.1| general L-amino acid transport system permease protein AapM [alpha
           proteobacterium HIMB114]
 gi|262224581|gb|EEY75040.1| general L-amino acid transport system permease protein AapM [alpha
           proteobacterium HIMB114]
          Length = 348

 Score =  226 bits (576), Expect = 4e-57,   Method: Composition-based stats.
 Identities = 144/352 (40%), Positives = 215/352 (61%), Gaps = 14/352 (3%)

Query: 32  IHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGW 91
           I + FF +P D  LT  I  L+  +IP ++ W+F+ A + G ++  C +           
Sbjct: 8   IREKFFSSPIDAFLTISISYLIYLTIPPLLDWMFISATFSGESKKECVS----------- 56

Query: 92  NAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFGL 151
             ACW F+   + +F++G YP  + WR  L F    + +      +   K    + L   
Sbjct: 57  GGACWVFVKIWFNRFLYGMYPNDEVWRVNLPFGILVVSIIVYRFLNEKYKKYLFLFLIIP 116

Query: 152 FPIFSF-FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLR 210
           FPI S      G LGL  VET  WGGL +TLVIS F II   PLG+LLA+GR SN+PV+R
Sbjct: 117 FPILSLMLFSGGFLGLMPVETREWGGLFLTLVISIFAIIFCFPLGVLLAMGRRSNLPVVR 176

Query: 211 YACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRG 270
           Y  + FIE +RGVPL+TVLFMA +M PL LP   ++DKL+R ++ ++ F +AY+AEV+RG
Sbjct: 177 YFSVGFIEFWRGVPLITVLFMAGVMFPLLLPAGTNMDKLVRVIIAITLFEAAYMAEVVRG 236

Query: 271 GLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMF 330
           GLQ++ +GQ++A+ ++G+ Y +    II+PQ +K VIPGI NTFI LFKD+ L+ ++ + 
Sbjct: 237 GLQAVGRGQYDASKAIGMGYWKSHIFIILPQALKLVIPGIANTFIALFKDTPLVFVVGLL 296

Query: 331 DLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHK 382
           ++LG+V +  +   W+     T G +F+  V+WIFCF++S YS+ IE+ L  
Sbjct: 297 EILGMVNLAKTNPAWLG--MATEGYVFVALVYWIFCFAMSRYSLSIEEKLKT 346


>gi|84685380|ref|ZP_01013278.1| glutamate/glutamine/aspartate/asparagine ABC transporter, permease
           protein [Maritimibacter alkaliphilus HTCC2654]
 gi|84666537|gb|EAQ13009.1| glutamate/glutamine/aspartate/asparagine ABC transporter, permease
           protein [Rhodobacterales bacterium HTCC2654]
          Length = 433

 Score =  226 bits (576), Expect = 4e-57,   Method: Composition-based stats.
 Identities = 143/437 (32%), Positives = 224/437 (51%), Gaps = 62/437 (14%)

Query: 6   KEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVF 65
           ++  YVR  +L    PP  + G+I W+  N F    + +LT + +  +   +  II W++
Sbjct: 2   EDLSYVRTDMLPERDPPASEVGVIGWLRMNLFSGWFNSILTVIALAFIYLVLAAIIPWLW 61

Query: 66  LDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPIL---- 121
               W   + + C  +            AC+  I +R++Q +FG YP   RWRPIL    
Sbjct: 62  -SPTWGAGSLSACREIIAE--LGKEHGGACYGVITERWQQLLFGFYPEELRWRPILTFIG 118

Query: 122 -------------------VFLTGSILLTPMLIPSFPRK--------------------- 141
                               F    + L P L+   P                       
Sbjct: 119 LFVALAPVLFNETFPGKMLWFTGAFLFLAPWLMWGGPIWTPLLVAAGPALGFVAYRYLVS 178

Query: 142 -------------FLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGI 188
                              LF + P+         LG+ +VE+ L+GG ++++ I    I
Sbjct: 179 VIGNLASVIVAVLIPVLFWLFLVGPLSQAIDGVVPLGIEVVESRLFGGFMLSVWIGVVAI 238

Query: 189 IISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDK 248
            IS+ LG++LALGR S++ +++Y  + FIE  RGVPL+T+LF+AS +L +F+P   + D 
Sbjct: 239 AISLVLGVILALGRQSDLLIVKYLSVGFIEFIRGVPLITLLFVASTLLNIFMPPGTNFDI 298

Query: 249 LLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIP 308
           +LR ++  + FASAYIAEV+RGGL ++ +GQ+EAA++LGL Y +  RLII+PQ +K  IP
Sbjct: 299 ILRVMIMATLFASAYIAEVIRGGLAALPRGQYEAADALGLDYWKAQRLIILPQALKISIP 358

Query: 309 GIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFS 368
           GIV+TFIGLFKD++L+SII + D +G+     +++ W   V       FI  +F+I CFS
Sbjct: 359 GIVSTFIGLFKDTTLVSIIGLLDPIGLTGSIRADANWNGIVW--ELYGFIALLFFISCFS 416

Query: 369 ISLYSVFIEKTLHKGSK 385
           +S YS+++EK L    +
Sbjct: 417 MSRYSMWLEKKLRTDHR 433


>gi|217977865|ref|YP_002362012.1| polar amino acid ABC transporter, inner membrane subunit
           [Methylocella silvestris BL2]
 gi|217503241|gb|ACK50650.1| polar amino acid ABC transporter, inner membrane subunit
           [Methylocella silvestris BL2]
          Length = 384

 Score =  226 bits (576), Expect = 5e-57,   Method: Composition-based stats.
 Identities = 147/353 (41%), Positives = 221/353 (62%), Gaps = 11/353 (3%)

Query: 35  NFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAA 94
           N F   +  LLT     L+    P ++ ++  DAVW   +   C               A
Sbjct: 40  NLFDGWRASLLTVATFVLIALITPPLLRFLVFDAVWSAPDGAACRAPGA---------GA 90

Query: 95  CWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPI 154
           CWAFI+ +   F +G+YP+ QRWR  +    G++L+  +L     R+ L +IL FG++P+
Sbjct: 91  CWAFIWRKLPYFTYGSYPLDQRWRVDVTLAIGAVLIFWLLWLDAARRNLAAILFFGVYPV 150

Query: 155 FSFFVLY--GGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYA 212
            +F +L+    +GL  V + LWGG+ V+L+++  G+++S+P G+LLALGR S++P L  A
Sbjct: 151 VAFLLLHGAPSIGLPRVASDLWGGIFVSLLVAIVGMVVSLPFGVLLALGRRSSLPALSIA 210

Query: 213 CITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGL 272
           C +FIEL RGVP++TVLFMA+ MLPLF+P+    D+LLR L+GV+ FASAY+AEV+RGGL
Sbjct: 211 CASFIELVRGVPIITVLFMANTMLPLFVPENLAPDRLLRPLIGVALFASAYMAEVVRGGL 270

Query: 273 QSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDL 332
           Q+I  GQFE A +LGL   Q  RL+I+PQ ++ VIPG+VN FI LFKD++L++++ +FD 
Sbjct: 271 QAIPSGQFEGAEALGLGRWQTQRLVILPQALRAVIPGVVNNFIALFKDTTLVAVVGIFDF 330

Query: 333 LGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSK 385
           L  V     +  W      TTG  F    +++FCF++S YS+F+E+      +
Sbjct: 331 LRTVDSARLDPVWAGPTIATTGYAFAAMFYFVFCFAMSRYSLFVERRFSHERR 383


>gi|114766876|ref|ZP_01445798.1| ABC glutamate/glutamine/aspartate/asparagine transporter, inner
           membrane subunit BztC [Pelagibaca bermudensis HTCC2601]
 gi|114540922|gb|EAU43982.1| ABC glutamate/glutamine/aspartate/asparagine transporter, inner
           membrane subunit BztC [Roseovarius sp. HTCC2601]
          Length = 438

 Score =  226 bits (575), Expect = 6e-57,   Method: Composition-based stats.
 Identities = 142/437 (32%), Positives = 221/437 (50%), Gaps = 60/437 (13%)

Query: 5   CKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWV 64
            +   +VR  +++   PP+ Q G   WIH+N F TP +++LT + + ++   +  ++ W 
Sbjct: 6   AQTVAFVRDTMVEEQEPPLSQSGAYKWIHENMFSTPLNVILTVVSLFVIWTVLSHLLPWA 65

Query: 65  FLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILV-- 122
            +  +W   +   C  +       D  + ACWA I +R+ Q +FG YP    WRP+L   
Sbjct: 66  VM-GIWDADSLAQCREIRDEIYGADA-SVACWAVISERWNQLLFGFYPPELYWRPVLAFV 123

Query: 123 -FLTGSILLTPMLIPSFPRKFLNSILLFGLF----------------------------- 152
            FL     +    +P     F  +      +                             
Sbjct: 124 LFLAAIAPVLFASVPRKALWFSAAAPFVLYWLLWGGSLWGPIAVAAGFALGAVVMRFAAP 183

Query: 153 ------------------------PIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGI 188
                                   P+         L L  V ++  GG ++ ++I   GI
Sbjct: 184 ALGALAAVLLAIFVPLLYWFTLSGPLAGALNAVIPLELVNVRSNDMGGFMLAMIIGVSGI 243

Query: 189 IISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDK 248
            +S+PLGI+LALGR S++ ++    + FIE+ RGVPL+  LF AS++L  FLP   + D 
Sbjct: 244 ALSLPLGIVLALGRQSDLFIINKCSVIFIEVIRGVPLIVWLFTASLLLNYFLPPGTNFDL 303

Query: 249 LLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIP 308
           +LR ++ V+ F+SAYIAEV+RGGL ++ KGQ+EAA++LGL Y + MRLII+PQ +K  IP
Sbjct: 304 MLRVIIMVTLFSSAYIAEVVRGGLAALPKGQYEAADALGLDYWKSMRLIILPQALKISIP 363

Query: 309 GIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFS 368
           GIVNTFIGLFKD++L+  I + D +G+     + + W          +FIG  F+IFCFS
Sbjct: 364 GIVNTFIGLFKDTTLVVFIGLLDPIGLSNAIRASTDWNGIYW--ELFVFIGLCFFIFCFS 421

Query: 369 ISLYSVFIEKTLHKGSK 385
           +  YS+F+EK L +  +
Sbjct: 422 MGRYSLFLEKKLRREHR 438


>gi|323698174|ref|ZP_08110086.1| polar amino acid ABC transporter, inner membrane subunit
           [Desulfovibrio sp. ND132]
 gi|323458106|gb|EGB13971.1| polar amino acid ABC transporter, inner membrane subunit
           [Desulfovibrio desulfuricans ND132]
          Length = 364

 Score =  226 bits (575), Expect = 6e-57,   Method: Composition-based stats.
 Identities = 131/354 (37%), Positives = 200/354 (56%), Gaps = 16/354 (4%)

Query: 26  RGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGG 85
            G+I W+  N F    + +LT L + LL+ ++P +I W F+ AVW G            G
Sbjct: 21  TGVILWLRTNLFSGWFNSVLTILAVLLLVKTVPPLIDWAFIRAVWTG------------G 68

Query: 86  IQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNS 145
            Q    + ACWAFI D+    + G YP    WRP++  +  + ++   +     ++ L  
Sbjct: 69  PQVCDGSGACWAFIADKARVMLIGTYPQDLEWRPLVAGILFAGVVAATVSGRCKKRVLTV 128

Query: 146 ILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSN 205
                           GG GL+ V+ S+WGGL+++L ++  GII+S+P GILLALGR S 
Sbjct: 129 AWPVLFVAALWLI--GGGAGLTEVDQSMWGGLMLSLGLAAVGIILSVPFGILLALGRQSR 186

Query: 206 IPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIA 265
           +  +   C+  IEL RGVPL+T+LFMAS+M+PLFLP    ++ LLR  +G+  F+SAYIA
Sbjct: 187 MVGVSSVCVGLIELIRGVPLITILFMASVMMPLFLPVNLQINNLLRVQVGIILFSSAYIA 246

Query: 266 EVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLIS 325
           EV+RGGLQ++  GQ +AA +LGLS       +++PQ ++ V+P ++   I LFKD+SL+ 
Sbjct: 247 EVVRGGLQAVPGGQLDAAKALGLSPWMITLFVVLPQALRYVLPALIGRCIALFKDTSLVI 306

Query: 326 IINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKT 379
           I+ + D LG+ +    +  W+       G +F   V+W  CF +S Y   +EK 
Sbjct: 307 IVGLLDFLGMAKAASQDQHWLGH--EVEGYVFCAVVYWCICFGMSRYGRSLEKR 358


>gi|315300935|gb|EFU60155.1| ABC transporter, permease protein [Escherichia coli MS 16-3]
          Length = 347

 Score =  225 bits (573), Expect = 9e-57,   Method: Composition-based stats.
 Identities = 156/340 (45%), Positives = 215/340 (63%), Gaps = 14/340 (4%)

Query: 46  TALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQ 105
           T   I L+   IP +++W FL A W+GS R  CT              ACW FI++R+ Q
Sbjct: 18  TIGCIWLMWELIPPLLNWAFLQANWVGSTRADCTKA-----------GACWVFIHERFGQ 66

Query: 106 FIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIF-SFFVLYGGL 164
           F++G YP  QRWR  L  L G + + PM     P +     +   ++P+   + +  G L
Sbjct: 67  FMYGLYPHDQRWRINLALLIGLVSIAPMFWKILPYRGRYIAVWAVIYPLIVWWLMYGGFL 126

Query: 165 GLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVP 224
           GL  VET  WGGL +TL+I+  GI  ++P GILLALGR S++P++R   + FIE +RGVP
Sbjct: 127 GLERVETRQWGGLTLTLIIASVGIAGALPWGILLALGRRSHMPIVRILSVIFIEFWRGVP 186

Query: 225 LVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAAN 284
           L+TVLFM+S+MLPLF+ +   +DKL+RAL+GV  F SAY+AEV+RGGLQ++ KGQ+EAA 
Sbjct: 187 LITVLFMSSVMLPLFMAEGTSIDKLIRALVGVILFQSAYVAEVVRGGLQALPKGQYEAAE 246

Query: 285 SLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSEST 344
           SL L Y +   L+IMPQ +K VIPG+VNT I LFKD+SL+ II +FDL   V+    +  
Sbjct: 247 SLALGYWKTQGLVIMPQALKLVIPGLVNTIIALFKDTSLVIIIGLFDLFSSVQQATVDPA 306

Query: 345 WISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
           W+     T G +F   ++WIFCFS+S YS  +EK  + G 
Sbjct: 307 WLG--MSTEGYVFAALIYWIFCFSMSRYSQHLEKRFNTGR 344


>gi|220914744|ref|YP_002490052.1| polar amino acid ABC transporter, inner membrane subunit
           [Methylobacterium nodulans ORS 2060]
 gi|219952495|gb|ACL62885.1| polar amino acid ABC transporter, inner membrane subunit
           [Methylobacterium nodulans ORS 2060]
          Length = 394

 Score =  225 bits (572), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 140/385 (36%), Positives = 212/385 (55%), Gaps = 6/385 (1%)

Query: 3   DSCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIH 62
           D       +    +  + P     G + W   N F +    ++T +++ LL       ++
Sbjct: 15  DPVPSIAGIPAAPITRAPPLAAGAGPLGWARTNLFSSIPSTIVTLVLLILLARWATEFVN 74

Query: 63  WVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILV 122
           W  L AVW   N    T       +      ACWA I ++Y   +FG Y   ++WRP +V
Sbjct: 75  WAILHAVWSVPNTA--TGPDTAACRDAKGIGACWAVISEKYRFILFGRYLYEEQWRPAIV 132

Query: 123 FLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLV 182
            +    L     +  F RK L  I +  L  +    +  G  GL+ V    WGGL +TL+
Sbjct: 133 IVLFIGLYVVSAMRQFWRKELILIWITTLT-VVGVLMWGGVFGLTYVPQDSWGGLPITLI 191

Query: 183 ISFFGIIISMPLGILLALGRNSNIPV-LRYACITFIELFRGVPLVTVLFMASIMLPLFLP 241
           ++ FG+  + PL IL+ALGR +     +R  C  ++EL RGVPL+TVLFMAS+M PLF+P
Sbjct: 192 LATFGLACAFPLSILVALGRRATNLPAIRVLCTVYVELIRGVPLITVLFMASVMFPLFMP 251

Query: 242 DTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQ 301
              + DKLLRA + V  FA+AY+AEV+RGGLQ++ KGQ+EAA++LGL Y  K   II+PQ
Sbjct: 252 AGLNPDKLLRAQVAVILFAAAYLAEVVRGGLQTLPKGQYEAADALGLGYWHKTAFIILPQ 311

Query: 302 VIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFV 361
            ++ VIP +VNTFIG FKD+SL+ II +FDLL   +V  ++  W      T   + +  +
Sbjct: 312 ALRLVIPPLVNTFIGFFKDTSLVLIIGLFDLLTAGKVAMADLVWQP--YSTEVYLVLAAI 369

Query: 362 FWIFCFSISLYSVFIEKTLHKGSKK 386
           ++ FC+ ++ YS  +E+   + +K+
Sbjct: 370 YFAFCYVMARYSRGLEQGFSRSTKR 394


>gi|227887998|ref|ZP_04005803.1| amino-acid ABC superfamily ATP binding cassette transporter
           permease protein YhdY [Escherichia coli 83972]
 gi|300991069|ref|ZP_07179490.1| ABC transporter, permease protein [Escherichia coli MS 45-1]
 gi|301047873|ref|ZP_07194920.1| ABC transporter, permease protein [Escherichia coli MS 185-1]
 gi|227835394|gb|EEJ45860.1| amino-acid ABC superfamily ATP binding cassette transporter
           permease protein YhdY [Escherichia coli 83972]
 gi|300300216|gb|EFJ56601.1| ABC transporter, permease protein [Escherichia coli MS 185-1]
 gi|300406990|gb|EFJ90528.1| ABC transporter, permease protein [Escherichia coli MS 45-1]
 gi|315294823|gb|EFU54166.1| ABC transporter, permease protein [Escherichia coli MS 153-1]
          Length = 347

 Score =  225 bits (572), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 156/340 (45%), Positives = 215/340 (63%), Gaps = 14/340 (4%)

Query: 46  TALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQ 105
           T   I L+   IP +++W FL A W+GS R  CT              ACW FI++R+ Q
Sbjct: 18  TIGCIWLMWELIPPLLNWAFLQANWVGSTRADCTKA-----------GACWVFIHERFGQ 66

Query: 106 FIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIF-SFFVLYGGL 164
           F++G YP  QRWR  L  L G + + PM     P +     +   ++P+   + +  G L
Sbjct: 67  FMYGLYPHDQRWRINLALLIGLVSIAPMFWKILPYRGRYIAVWAVIYPLIVWWLMYGGFL 126

Query: 165 GLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVP 224
           GL  VET  WGGL +TL+I+  GI  ++P GILLALGR S++P++R   + FIE +RGVP
Sbjct: 127 GLERVETRQWGGLTLTLIIASVGIAGALPWGILLALGRRSHMPIVRILSVIFIEFWRGVP 186

Query: 225 LVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAAN 284
           L+TVLFM+S+MLPLF+ +   +DKL+RAL+GV  F SAY+AEV+RGGLQ++ KGQ+EAA 
Sbjct: 187 LITVLFMSSVMLPLFMAEDTSIDKLIRALVGVILFQSAYVAEVVRGGLQALPKGQYEAAE 246

Query: 285 SLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSEST 344
           SL L Y +   L+IMPQ +K VIPG+VNT I LFKD+SL+ II +FDL   V+    +  
Sbjct: 247 SLALGYWKTQGLVIMPQALKLVIPGLVNTIIALFKDTSLVIIIGLFDLFSSVQQATVDPA 306

Query: 345 WISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
           W+     T G +F   ++WIFCFS+S YS  +EK  + G 
Sbjct: 307 WLG--MSTEGYVFAALIYWIFCFSMSRYSQHLEKRFNTGR 344


>gi|144899136|emb|CAM76000.1| binding-protein-dependent transport system inner membrane component
           [Magnetospirillum gryphiswaldense MSR-1]
          Length = 380

 Score =  224 bits (571), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 143/359 (39%), Positives = 216/359 (60%), Gaps = 11/359 (3%)

Query: 28  IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQ 87
            ++W   N F +  + +LT L + LL  ++P ++ W   +A W  ++ T           
Sbjct: 33  PLSWAKSNLFDSVPNTVLTLLALLLLWETVPPLLSWGLFNATWSVADGTA--------AA 84

Query: 88  PDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSIL 147
                 ACWA + ++    +FG YP  Q WRP+L       +L    +  F R       
Sbjct: 85  CRDSTGACWALMGEKNRLMLFGVYPYDQHWRPLLATAIVIAMLATSALRRFWRPA-LGYA 143

Query: 148 LFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIP 207
             G   + ++ +  G  GL+ VET+ WGGL +TL ++  GI+++ PL I+LALGR SN+P
Sbjct: 144 WLGTVVVVAWLMWGGFFGLTYVETAQWGGLPLTLGLALLGIVLAFPLSIVLALGRRSNLP 203

Query: 208 VLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEV 267
            ++  C  +IEL RGVPLV+VLFMAS+M PLFLP+   +DKLLRAL G++ F +AY+AE 
Sbjct: 204 AIKAICTGYIELVRGVPLVSVLFMASVMFPLFLPEGVTIDKLLRALAGMTLFTAAYLAEA 263

Query: 268 LRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISII 327
           +RGGLQ+I +GQ EAA++LGLSY +KMRLI++PQ ++ VIP IVN FI  FKD+SL++I+
Sbjct: 264 VRGGLQAIPRGQEEAADALGLSYWRKMRLIVLPQALRLVIPPIVNQFISCFKDTSLVTIV 323

Query: 328 NMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
            ++DLL   +   ++  W        G +    V+W FCF +S YS ++E+ L  G+++
Sbjct: 324 GLYDLLAATKAALADPEWRPFF--VEGYVAAALVYWCFCFFMSRYSQWLERELATGTRR 380


>gi|254464809|ref|ZP_05078220.1| amino acid ABC transporter, permease protein [Rhodobacterales
           bacterium Y4I]
 gi|206685717|gb|EDZ46199.1| amino acid ABC transporter, permease protein [Rhodobacterales
           bacterium Y4I]
          Length = 366

 Score =  224 bits (571), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 136/373 (36%), Positives = 222/373 (59%), Gaps = 15/373 (4%)

Query: 14  RLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGS 73
           + +     P  Q G IAW+  N FG  KD  +T  ++ +LL  +P +I W+ ++A + G 
Sbjct: 9   QPMAARPAPASQFGPIAWLRANLFGGWKDTAITLSLLAVLLAVVPNLIEWLLINATFGGD 68

Query: 74  NRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPM 133
           +   C               ACW F+  +++  + G YP    WRP +  L   +L    
Sbjct: 69  D-ETCRQ----------NAGACWPFLQAKFQVLMVGVYPQDLSWRPAIAALALLVLAGFT 117

Query: 134 LIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMP 193
                  + +  I+ + L P+F+  ++ G  G+  V+ SLWGGL+++++++  G+I+S+P
Sbjct: 118 YADRI--RGIALIVAWALLPVFALIMIGGAFGMQEVDQSLWGGLMLSVLLALVGVIVSIP 175

Query: 194 LGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRAL 253
           LG+LLALGR+   P ++  C+ FIEL RGVPL+T+LFMAS+M+PLFLP    ++ LLR  
Sbjct: 176 LGVLLALGRHYGSPAVKAICVAFIELVRGVPLITILFMASVMMPLFLPPDLVINNLLRIQ 235

Query: 254 LGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNT 313
           +G+  F+SAY+AEV+RGGLQ+I KGQ EA+ +LG+S  + +  +++PQ ++ V+P ++  
Sbjct: 236 IGMILFSSAYMAEVVRGGLQAIPKGQTEASLALGVSPARTIIFVVVPQALRHVLPPLIGR 295

Query: 314 FIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYS 373
            I LFKD+SL+ I+ + D LG+VR    +  W+         +F  FV+W+ C+S+SLY 
Sbjct: 296 CIALFKDTSLVIIVGLLDFLGMVRGAALDPEWLGFQA--EAYVFAAFVYWLICYSLSLYG 353

Query: 374 VFIEKTLHKGSKK 386
             +E+    GSK+
Sbjct: 354 RALERRGPAGSKR 366


>gi|254460499|ref|ZP_05073915.1| amino acid ABC transporter, permease protein [Rhodobacterales
           bacterium HTCC2083]
 gi|206677088|gb|EDZ41575.1| amino acid ABC transporter, permease protein [Rhodobacteraceae
           bacterium HTCC2083]
          Length = 431

 Score =  223 bits (568), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 139/435 (31%), Positives = 215/435 (49%), Gaps = 63/435 (14%)

Query: 5   CKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWV 64
                +VR  +LQ   PPV   G +AWI KN F    + +LT L I  +   + G   W 
Sbjct: 6   TTPVAFVRDAMLQEQTPPVTAAGPLAWIKKNLFDGWFNTILTLLAIYFIYMIVSGAFPW- 64

Query: 65  FLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGN-YPMAQRWRPILVF 123
           F + VW   +   C  + QG          C++ + +R+ Q +FG  YP  + WRP + F
Sbjct: 65  FYNGVWTTDSLAECREILQG------KTGGCFSVLTERWPQLLFGFKYPSEEYWRPTVAF 118

Query: 124 LTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGL------------------- 164
                   P+L    PRK L    +F     +  +     +                   
Sbjct: 119 FMLFFAAAPVLFNKLPRKLLIITAIFPFLAFWLIWGGSLMVPIMVAVGLIVGYFVFTKLE 178

Query: 165 ---------------------------------GLSIVETSLWGGLLVTLVISFFGIIIS 191
                                             L  + +   GG ++  ++    + +S
Sbjct: 179 YQSFAMGLIGGILATVLIWSFMGIITDPLSGFLALESIPSRDMGGFMLNFILGVVCVSLS 238

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +P+GILLALGR S++ ++++ C+ FIE  RGVPL+T+LF+A+++L  FLP   + D +LR
Sbjct: 239 LPIGILLALGRQSDMIIIKWICVVFIEFIRGVPLITLLFVANVVLGYFLPPGSNFDLILR 298

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
            ++ ++ F++AYIAEV+RGGL ++ KGQ EAA SLGL Y Q MRLII+PQ +K  IPGIV
Sbjct: 299 VIIMITMFSAAYIAEVVRGGLAALPKGQAEAAGSLGLDYAQSMRLIILPQALKISIPGIV 358

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRV-NFSESTWISSVTPTTGLIFIGFVFWIFCFSIS 370
           N  +GLFKD+ L+S+I+MFDL+G++R    + + W          +     F+  C+ IS
Sbjct: 359 NVAVGLFKDTVLVSVISMFDLVGMIRGPILASTEWNGVYW--ELWLAAVLFFFPICYGIS 416

Query: 371 LYSVFIEKTLHKGSK 385
            YS ++E+ L  G +
Sbjct: 417 QYSQWLERQLATGHR 431


>gi|304391887|ref|ZP_07373829.1| glutamate/glutamine/aspartate/asparagine transport system permease
           protein BztC [Ahrensia sp. R2A130]
 gi|303296116|gb|EFL90474.1| glutamate/glutamine/aspartate/asparagine transport system permease
           protein BztC [Ahrensia sp. R2A130]
          Length = 432

 Score =  223 bits (568), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 158/437 (36%), Positives = 228/437 (52%), Gaps = 67/437 (15%)

Query: 5   CKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWV 64
            +   YV    L     PV  RG  AW   NFF TP+D +L+ ++  L+   +  ++ W+
Sbjct: 6   AETVRYVATHELPALPAPVNTRGPAAWARANFFSTPRDTILSIIVGGLIAIGLWKLLPWL 65

Query: 65  FLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFL 124
             D+V++  +   C  +          + AC+A +  R+ Q IFG YP    WRPIL F+
Sbjct: 66  VFDSVFVAGSLNECREID---------SGACFAVVTSRFNQLIFGFYPPELFWRPILAFV 116

Query: 125 -----------------------------------------TGSILLTPMLIPSFPRKFL 143
                                                       I +  +   +F     
Sbjct: 117 LMLVAFAPVLHDNLPRKMLWFSAVFPLLAYWLIWGGTIWGPLMIIAMIALAFVAFKAVAK 176

Query: 144 ---------------NSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGI 188
                             +LF   PI S       +GL  VE+S  GG  +T +I   GI
Sbjct: 177 SVNPVVGLLAAVAVGILWMLFLHDPIVSALSSAVNVGLEPVESSKLGGFQITFIIGVTGI 236

Query: 189 IISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDK 248
           + S+P+GILLALGR S++P L+  C+ FIE  RGVPL+T+LF+AS +L  FLP   + D 
Sbjct: 237 VASLPIGILLALGRGSDMPTLKMICVGFIEFIRGVPLITLLFVASTLLNYFLPPGTNFDI 296

Query: 249 LLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIP 308
           +LR ++ V+ FASAY+AEV+RGGL ++ KGQ+EAA++LGL+Y Q  RLII+PQ +K  IP
Sbjct: 297 VLRVIIMVTLFASAYMAEVIRGGLAALPKGQYEAADALGLNYWQATRLIILPQALKISIP 356

Query: 309 GIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFS 368
           GIVNTFIGLFKD+ L+SII + D +GI++   S + W   +      IF+G VF+IFCF 
Sbjct: 357 GIVNTFIGLFKDTVLVSIIGILDPIGIMQPIRSSAEWNGIIWELP--IFVGLVFFIFCFL 414

Query: 369 ISLYSVFIEKTLHKGSK 385
           +S YS++ E+ L  G +
Sbjct: 415 MSRYSMYFERKLDTGHR 431


>gi|288550479|ref|ZP_05970605.2| general amino acid ABC transporter, permease protein [Enterobacter
           cancerogenus ATCC 35316]
 gi|288315400|gb|EFC54338.1| general amino acid ABC transporter, permease protein [Enterobacter
           cancerogenus ATCC 35316]
          Length = 323

 Score =  223 bits (567), Expect = 5e-56,   Method: Composition-based stats.
 Identities = 147/333 (44%), Positives = 201/333 (60%), Gaps = 14/333 (4%)

Query: 53  LLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYP 112
           +   +P +++W  L A W G+ R  CT              ACW FI+ R+ QF++G YP
Sbjct: 1   MWELLPPLLNWALLQANWTGTTREDCTKA-----------GACWVFIHQRFGQFMYGLYP 49

Query: 113 MAQRWRPILVFLTGSILLTPMLIPSF-PRKFLNSILLFGLFPIFSFFVLYGGLGLSIVET 171
             QRWR  L    G   +  M       R    +  +     +    +    LGL  VET
Sbjct: 50  HEQRWRINLALAIGLFSIAVMFWKKVPHRGRYIACWVVVYPVVVWVLLYGDFLGLERVET 109

Query: 172 SLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFM 231
             WGGL +TL+I+  GI  ++P GILLALGR S +PV+R   + FIE +RGVPL+TVLFM
Sbjct: 110 RQWGGLTLTLIIASVGIAGALPWGILLALGRRSTMPVVRVLSVIFIEFWRGVPLITVLFM 169

Query: 232 ASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYL 291
           +S+MLPLF+ +   +DKL+RAL+GV  F SAY+AEV+RGGLQ++ KGQ+EAA SL LSY 
Sbjct: 170 SSVMLPLFMAEGTTIDKLIRALVGVILFQSAYVAEVVRGGLQALPKGQYEAAESLALSYW 229

Query: 292 QKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTP 351
           +   L+I+PQ +K VIPG+VNT I LFKD+SL+ II +FDL   V+    +  W+     
Sbjct: 230 KTQGLVILPQALKLVIPGLVNTIIALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MS 287

Query: 352 TTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
           T G +F   ++WIFCFS+S YS  +EK  + G 
Sbjct: 288 TEGYVFAALIYWIFCFSMSRYSQHLEKRFNTGR 320


>gi|87120915|ref|ZP_01076807.1| ABC-type amino acid transport system, permease component
           [Marinomonas sp. MED121]
 gi|86163753|gb|EAQ65026.1| ABC-type amino acid transport system, permease component
           [Marinomonas sp. MED121]
          Length = 371

 Score =  221 bits (564), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 126/383 (32%), Positives = 209/383 (54%), Gaps = 12/383 (3%)

Query: 2   IDSCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGII 61
           + + K    V     +    P  +  ++    + +F    +  LT  +I   +  +P ++
Sbjct: 1   MATHKTLSKVNLTPPESRARPQNKMTLLQKARQRYFSNLLNSFLTLSVIIAFILILPPLL 60

Query: 62  HWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPIL 121
            W   DAV+IGS +  C   +           ACW  I  R++ F++G YP  + WR  L
Sbjct: 61  QWAIFDAVFIGSTQEACEVAA----------GACWLPIAARFDLFVYGFYPETETWRVNL 110

Query: 122 VFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTL 181
           VF      L  ++      K     ++  L  +    +  G  GL  V ++ +GGL++T+
Sbjct: 111 VFAASFFTLVVLVWRRISMKLKLVYIVAFLPALIFVLLYGGVFGLDSVSSNKFGGLIITI 170

Query: 182 VISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLP 241
            +   G I+S+PLGI LALGR S  PV+R  C++ IELFR +P++T LFM +++L LFLP
Sbjct: 171 FLGLIGSILSLPLGIFLALGRRSTRPVIRIFCVSVIELFRAMPMITWLFMGALVLQLFLP 230

Query: 242 DTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQ 301
           +  +VDK++R +  +   ++A  AE++R GLQ+I  GQFEA+ +LG+ Y + M ++IMPQ
Sbjct: 231 NGMEVDKMIRVVFILVLVSAASKAEIIRAGLQAIPVGQFEASAALGVGYWRTMSMVIMPQ 290

Query: 302 VIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFV 361
           V+K  IP ++N+FIG+FKD+SL++II + D L +     +   W          IF+  +
Sbjct: 291 VLKVSIPAMLNSFIGMFKDTSLVAIIGLLDFLSVGMATMNSDEWGK--YGIEVYIFVAMI 348

Query: 362 FWIFCFSISLYSVFIEKTLHKGS 384
           +++  F+IS +S+ +EK L  G 
Sbjct: 349 YFVILFTISRFSLTLEKQLETGH 371


>gi|163740276|ref|ZP_02147670.1| ABC glutamate/glutamine/aspartate/asparagine transporter, inner
           membrane subunit BztC [Phaeobacter gallaeciensis 2.10]
 gi|161386134|gb|EDQ10509.1| ABC glutamate/glutamine/aspartate/asparagine transporter, inner
           membrane subunit BztC [Phaeobacter gallaeciensis 2.10]
          Length = 432

 Score =  221 bits (564), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 145/435 (33%), Positives = 227/435 (52%), Gaps = 64/435 (14%)

Query: 5   CKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWV 64
            +   +VR+  + P+ PP  + G+  W+ +N F +  + +LT   + L+   +   + W+
Sbjct: 6   AQTVAFVRETQIPPAPPPGRETGVYKWVRENLFSSVPNSILTLAALALIYALLSSTLPWL 65

Query: 65  FLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGN-YPMAQRWRPILVF 123
            L+ VW  ++   C  V       DG   AC++ + +R+ Q ++G  YP  + WRP L  
Sbjct: 66  -LNGVWTTNSLAECREVL------DGKLGACFSVLTERWNQLLYGFKYPGTEYWRPNLAL 118

Query: 124 LTGSILLTPMLIPSFPRKF-----LNSILLFGLFPIFSFFVLY----------------- 161
           +   + L P+L    PRK      +   + F L    S  V                   
Sbjct: 119 VLLLVALAPVLFFDLPRKLLAFTAVYPFIAFWLIWGGSILVPIVALLGFVAAGFVFQKFG 178

Query: 162 -------------------------------GGLGLSIVETSLWGGLLVTLVISFFGIII 190
                                              LS V +   GG ++ +++    + +
Sbjct: 179 KGSFALGFFGAIVAAVVVWNIGGFLIPEGASDNAMLSAVPSRDLGGFMLNMMLGVTCVSL 238

Query: 191 SMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLL 250
           S+PLGI LALGR SN+P++++ C+ FIE  RGVPL+T+LF+AS+ML  F P    VD  L
Sbjct: 239 SVPLGIALALGRQSNMPLIKWICVVFIEFVRGVPLITLLFVASVMLSYFFPPDATVDLFL 298

Query: 251 RALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGI 310
           R ++ ++ F++AYIAEV+RGGL ++ KGQ+EAA+SLGL Y Q MRLII+PQ +K  IPGI
Sbjct: 299 RVVIMITLFSAAYIAEVIRGGLAALPKGQYEAADSLGLDYPQAMRLIILPQALKISIPGI 358

Query: 311 VNTFIGLFKDSSLISIINMFDLLGIVRV-NFSESTWISSVTPTTGLIFIGFVFWIFCFSI 369
           VN  +GLFKD++L+S+I+MFDL+G++R    + + W         L F  F+F+I C+ I
Sbjct: 359 VNVAVGLFKDTTLVSVISMFDLVGMIRGPILASTEWNGVYW--ELLGFAAFLFFIVCYGI 416

Query: 370 SLYSVFIEKTLHKGS 384
           S YS ++E+ L    
Sbjct: 417 SQYSQWLERRLATDH 431


>gi|163739483|ref|ZP_02146893.1| amino acid ABC transporter, permease protein [Phaeobacter
           gallaeciensis BS107]
 gi|161387236|gb|EDQ11595.1| amino acid ABC transporter, permease protein [Phaeobacter
           gallaeciensis BS107]
          Length = 432

 Score =  221 bits (563), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 136/435 (31%), Positives = 219/435 (50%), Gaps = 64/435 (14%)

Query: 5   CKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWV 64
            +   +VR+  + P+ PP  + G+  WI +N F +  + +LT   + L+   +   + W+
Sbjct: 6   AQTVAFVRETQIPPAPPPGRETGVYKWIRENLFSSVPNSILTLAALALIYALLSSTLPWL 65

Query: 65  FLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGN-YPMAQRWRPI--- 120
            L+ VW  ++   C  V       DG   AC++ + +R+ Q ++G  YP  + WRP    
Sbjct: 66  -LNGVWTTNSLAECREVL------DGKLGACFSVLTERWNQLLYGFKYPGTEYWRPNLAL 118

Query: 121 -----------------------------------------LVFLTGSILLTPMLIPSFP 139
                                                     +      +    +   F 
Sbjct: 119 VLLLVALAPVLFFDLPRKLLAFTAIYPFLAFWLIWGGSILVPIVALLGFVAAGFVFQKFG 178

Query: 140 RKFLNSILLFGLFPIFSFFVL---------YGGLGLSIVETSLWGGLLVTLVISFFGIII 190
           +          +      + +              LS V +   GG ++ +++    + +
Sbjct: 179 KGSFALGFFGAIVAAVVVWNIGGFLIPEGASDNAMLSAVPSRDLGGFMLNMMLGVTCVSL 238

Query: 191 SMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLL 250
           S+PLGI LALGR SN+P++++ C+ FIE  RGVPL+T+LF+AS+ML  F P    VD  L
Sbjct: 239 SVPLGIALALGRQSNMPLIKWICVVFIEFVRGVPLITLLFVASVMLSYFFPPDATVDLFL 298

Query: 251 RALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGI 310
           R ++ ++ F++AYIAEV+RGGL ++ KGQ+EAA+SLGL Y Q MRLII+PQ +K  IPGI
Sbjct: 299 RVVIMITLFSAAYIAEVIRGGLAALPKGQYEAADSLGLDYPQAMRLIILPQALKISIPGI 358

Query: 311 VNTFIGLFKDSSLISIINMFDLLGIVRV-NFSESTWISSVTPTTGLIFIGFVFWIFCFSI 369
           VN  +GLFKD++L+S+I+MFDL+G++R    + + W         L F  F+F+I C+ I
Sbjct: 359 VNVAVGLFKDTTLVSVISMFDLVGMIRGPILASTEWNGVYW--ELLGFAAFLFFIVCYGI 416

Query: 370 SLYSVFIEKTLHKGS 384
           S YS ++E+ L    
Sbjct: 417 SQYSQWLERRLATDH 431


>gi|83941462|ref|ZP_00953924.1| ABC glutamate/glutamine/aspartate/asparagine transporter, inner
           membrane subunit BztC [Sulfitobacter sp. EE-36]
 gi|83847282|gb|EAP85157.1| ABC glutamate/glutamine/aspartate/asparagine transporter, inner
           membrane subunit BztC [Sulfitobacter sp. EE-36]
          Length = 431

 Score =  221 bits (562), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 141/434 (32%), Positives = 226/434 (52%), Gaps = 63/434 (14%)

Query: 5   CKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWV 64
               PYVR  +L    PP   +G + W+ ++ F +    +LT   + ++   + G + W+
Sbjct: 6   AASVPYVRDTMLPQHAPPPTAQGPVKWVRESLFSSIPYTILTLAALYVIYLILSGFLPWL 65

Query: 65  FLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGN-YPMAQRWRPILVF 123
            L  VW  SN   C  V  G        A C++ + +R+ Q +FG  YP    WRP L F
Sbjct: 66  -LGGVWTTSNIRECREVLDGVQ------AGCFSVLTERWNQLLFGIAYPQDGYWRPTLAF 118

Query: 124 LTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFF------------------------- 158
           +   + ++P+L  + PR  +   +++     +  +                         
Sbjct: 119 VLLFVAVSPVLFSNLPRGLILFTVIYPFIAFWLIWGGSLLVPLSALLAVVVGYVVYSRIV 178

Query: 159 ---------------------------VLYGGLGLSIVETSLWGGLLVTLVISFFGIIIS 191
                                       L G L L  V +   GG ++ +++    + +S
Sbjct: 179 KTSFAGGLFAGLIAGIVTWFICGFITPSLSGVLALEPVASRNMGGFMLNMILGVICVSLS 238

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +P+GILLALGR S++P+++  C+ FIE  RGVPL+T+LF+A+++L  FLP   + D +LR
Sbjct: 239 LPMGILLALGRQSSLPIIKLICVVFIEFIRGVPLITLLFVANVVLAYFLPPGTNFDLILR 298

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
            ++ ++ FASAYIAEV+RGGL ++ +GQ+EAA+SLGL Y Q MRLII+PQ +K  IPGIV
Sbjct: 299 VIIMITMFASAYIAEVIRGGLAALPRGQYEAADSLGLDYAQAMRLIILPQALKISIPGIV 358

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRV-NFSESTWISSVTPTTGLIFIGFVFWIFCFSIS 370
           N  +GLFKD++L+SII+MFDL+G++R    + + W           F   +F++ C+ IS
Sbjct: 359 NVAVGLFKDTTLVSIISMFDLVGMIRGPILASTDWNGVYW--ELWGFAALLFFVVCYGIS 416

Query: 371 LYSVFIEKTLHKGS 384
            YS ++E+ L    
Sbjct: 417 QYSQWLERQLQTDH 430


>gi|182678575|ref|YP_001832721.1| polar amino acid ABC transporter, inner membrane subunit
           [Beijerinckia indica subsp. indica ATCC 9039]
 gi|182634458|gb|ACB95232.1| polar amino acid ABC transporter, inner membrane subunit
           [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 385

 Score =  221 bits (562), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 154/384 (40%), Positives = 233/384 (60%), Gaps = 15/384 (3%)

Query: 9   PYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDA 68
            Y+R+       PP  +  ++  I + FF +    LLT     L+L+ +P ++ +  +DA
Sbjct: 11  SYLRQESAPLLPPPKDRTSLLERIRRGFFSSLSSSLLTLAAGALILWLLPDLLRFTLIDA 70

Query: 69  VWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSI 128
           VW   +   C               ACWAF+  +   F FG+YP+A+RWR + V L G +
Sbjct: 71  VWSAPDGAACRAPDA---------GACWAFVAQKLPYFTFGSYPVAERWRVVTVLLLGFV 121

Query: 129 LLTPMLIPSFPR----KFLNSILLFGLFPIF--SFFVLYGGLGLSIVETSLWGGLLVTLV 182
           L+  +L P        K + ++L F L+P+           LGL +V+T LWGG+ ++LV
Sbjct: 122 LIAWLLWPIRKGAHTDKRVAALLFFLLYPLIALILLRGTPWLGLPLVDTDLWGGIFLSLV 181

Query: 183 ISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPD 242
           ++  GI++S+PLGI LALGR S +PV+  A   FIE  RGVP++TVLFMA+ MLPLFLP 
Sbjct: 182 VAGVGIVVSLPLGIFLALGRRSTLPVVSLASTLFIEFVRGVPMITVLFMANFMLPLFLPA 241

Query: 243 TWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQV 302
           +  VD+L+R L+GV+ FASAY+AEV+RGGLQ++ KGQFE A +LGL   + ++L+++PQ 
Sbjct: 242 SMSVDRLIRPLIGVALFASAYMAEVVRGGLQAVPKGQFEGAAALGLPPWKTLQLVVLPQA 301

Query: 303 IKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVF 362
           +  VIPGIVNTFIGLFKD++L++ + +FD L  V     +  W       +G +F    +
Sbjct: 302 LAHVIPGIVNTFIGLFKDTTLVAAVGIFDFLRTVDSARLDPAWAGPTISASGYLFAALFY 361

Query: 363 WIFCFSISLYSVFIEKTLHKGSKK 386
           ++FCF +S YS+ +E+ L +G  +
Sbjct: 362 FVFCFGMSRYSIGVERRLARGQAR 385


>gi|83854939|ref|ZP_00948469.1| ABC glutamate/glutamine/aspartate/asparagine transporter, inner
           membrane subunit BztC [Sulfitobacter sp. NAS-14.1]
 gi|83842782|gb|EAP81949.1| ABC glutamate/glutamine/aspartate/asparagine transporter, inner
           membrane subunit BztC [Sulfitobacter sp. NAS-14.1]
          Length = 431

 Score =  221 bits (562), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 141/434 (32%), Positives = 226/434 (52%), Gaps = 63/434 (14%)

Query: 5   CKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWV 64
               PYVR  +L    PP   +G + W+ ++ F +    +LT   + ++   + G + W+
Sbjct: 6   AASVPYVRDTMLPQHAPPPTAQGPVKWVRESLFSSIPYTILTLAALYVIYLILSGFLPWL 65

Query: 65  FLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGN-YPMAQRWRPILVF 123
            L  VW  SN   C  V  G        A C++ + +R+ Q +FG  YP    WRP L F
Sbjct: 66  -LGGVWTTSNIRECREVLDGVQ------AGCFSVLTERWNQLLFGIAYPQDGYWRPTLAF 118

Query: 124 LTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFF------------------------- 158
           +   + ++P+L  + PR  +   +++     +  +                         
Sbjct: 119 VLLFVAVSPVLFSNLPRGLILFTVIYPFIAFWLIWGGSLLVPLSALLAVVVGYVVYSRIV 178

Query: 159 ---------------------------VLYGGLGLSIVETSLWGGLLVTLVISFFGIIIS 191
                                       L G L L  V +   GG ++ +++    + +S
Sbjct: 179 KTSFAGGLFAGLIAGVVTWFVLGFITPSLSGVLALEPVASRNMGGFMLNMILGVICVSLS 238

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +P+GILLALGR S++P+++  C+ FIE  RGVPL+T+LF+A+++L  FLP   + D +LR
Sbjct: 239 LPMGILLALGRQSSLPIIKLICVVFIEFIRGVPLITLLFVANVVLAYFLPPGTNFDLILR 298

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
            ++ ++ FASAYIAEV+RGGL ++ +GQ+EAA+SLGL Y Q MRLII+PQ +K  IPGIV
Sbjct: 299 VIIMITMFASAYIAEVIRGGLAALPRGQYEAADSLGLDYAQAMRLIILPQALKISIPGIV 358

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRV-NFSESTWISSVTPTTGLIFIGFVFWIFCFSIS 370
           N  +GLFKD++L+SII+MFDL+G++R    + + W           F   +F++ C+ IS
Sbjct: 359 NVAVGLFKDTTLVSIISMFDLVGMIRGPILASTDWNGVYW--ELWGFAALLFFVVCYGIS 416

Query: 371 LYSVFIEKTLHKGS 384
            YS ++E+ L    
Sbjct: 417 QYSQWLERQLQTDH 430


>gi|254488499|ref|ZP_05101704.1| amino acid ABC transporter, permease protein [Roseobacter sp.
           GAI101]
 gi|214045368|gb|EEB86006.1| amino acid ABC transporter, permease protein [Roseobacter sp.
           GAI101]
          Length = 431

 Score =  221 bits (562), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 138/435 (31%), Positives = 222/435 (51%), Gaps = 63/435 (14%)

Query: 5   CKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWV 64
            +   +VR  +L  + PP   +G + W+  + F +    +LT   +  +   + G + W+
Sbjct: 6   AQTVTFVRDTMLPQAAPPSTAQGPVKWMRDSLFSSIPYTILTIAALYAIFVLLSGFLPWL 65

Query: 65  FLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGN-YPMAQRWRPILVF 123
            L  VW  SN   C  V  G          C++ + +R+ Q +FG  YP    WRP L F
Sbjct: 66  -LGGVWTTSNIRECREVLDGA------RGGCFSVLAERWNQLLFGIAYPQDGYWRPTLAF 118

Query: 124 LTGSILLTPMLIPSFPRK------FLNSILLFGLF------------------------- 152
           +   + ++P+L  + PRK          +  + ++                         
Sbjct: 119 ILLFVAVSPVLFAAVPRKLLIVTLLYPFVAFWLIWGGSLLVPLAALISLCVGYLVYSKLV 178

Query: 153 ---------------PIFSFFVLYGGLG------LSIVETSLWGGLLVTLVISFFGIIIS 191
                              F   +   G      L  V +   GG ++ +++    + +S
Sbjct: 179 KTSFAAGLAAGVATAVFIWFIAGFITPGLSGVLALEEVASRNMGGFMLNMILGVICVSLS 238

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +PLGILLALGR S++P+++  C+ FIE  RGVPL+T+LF+A+++L  FLP   + D +LR
Sbjct: 239 LPLGILLALGRQSSLPIIKLICVVFIEFIRGVPLITLLFVANVVLAYFLPPGTNFDLILR 298

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
            ++ ++ FASAYIAEV+RGGL ++ +GQ+E A SLGL Y Q MRLII+PQ +K  IPGIV
Sbjct: 299 VIIMITMFASAYIAEVIRGGLAALPRGQYEGAESLGLDYAQSMRLIILPQALKISIPGIV 358

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRV-NFSESTWISSVTPTTGLIFIGFVFWIFCFSIS 370
           N  +GLFKD++L+SII+MFDL+G++R    + + W           F   +F++ C+ IS
Sbjct: 359 NVAVGLFKDTTLVSIISMFDLVGMIRGPILASTDWNGVYW--ELWGFAAALFFVVCYGIS 416

Query: 371 LYSVFIEKTLHKGSK 385
            YS ++E+ L    +
Sbjct: 417 QYSQWLERQLQTDHR 431


>gi|238789895|ref|ZP_04633675.1| Inner membrane amino-acid ABC transporter permease protein yhdY
           [Yersinia frederiksenii ATCC 33641]
 gi|238721968|gb|EEQ13628.1| Inner membrane amino-acid ABC transporter permease protein yhdY
           [Yersinia frederiksenii ATCC 33641]
          Length = 323

 Score =  220 bits (561), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 155/333 (46%), Positives = 213/333 (63%), Gaps = 14/333 (4%)

Query: 53  LLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYP 112
           +   IP +++W   +A W G+ RT CT              ACW FI+ R+ QF++G YP
Sbjct: 1   MWQLIPPLLNWAIFNANWRGTTRTDCT-----------REGACWVFIHARFGQFMYGLYP 49

Query: 113 MAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFV-LYGGLGLSIVET 171
           + QRWR     + G + L P+L  + PR+          +P+F + +   G  GLS+VET
Sbjct: 50  IDQRWRINTTLIIGLLTLIPLLWRAMPRRGRYLAGWMVTYPLFVWMMLYGGFFGLSLVET 109

Query: 172 SLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFM 231
             WGGL +TL+I+  GI  ++PLGILLAL R S++PV+R   + FIE +RGVPL+TVLFM
Sbjct: 110 RQWGGLTLTLIIAAVGIAGALPLGILLALARRSSMPVVRILSVVFIEFWRGVPLITVLFM 169

Query: 232 ASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYL 291
           +S+MLPLF+ +   +DKL+RAL+GV  F SAY+AEV+RGGLQ++ KGQ EAA SLGL Y 
Sbjct: 170 SSVMLPLFMTEGTSIDKLIRALVGVVLFQSAYVAEVVRGGLQALPKGQTEAAESLGLGYW 229

Query: 292 QKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTP 351
           +   L+I+PQ +K VIPG+VNT I LFKD+SL+ II +FDL   V+    +  W+     
Sbjct: 230 KTQGLVILPQALKMVIPGLVNTIIALFKDTSLVIIIGLFDLFSSVQQATVDPAWLG--MS 287

Query: 352 TTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
           T G +F   V+WIFCFS+S YS  +EK  H G 
Sbjct: 288 TEGYVFAAAVYWIFCFSMSRYSQHLEKRFHTGR 320


>gi|224371698|ref|YP_002605862.1| ABC-type branched-chain amino acid transport-system, permease
           component [Desulfobacterium autotrophicum HRM2]
 gi|223694415|gb|ACN17698.1| ABC-type branched-chain amino acid transport-system, permease
           component [Desulfobacterium autotrophicum HRM2]
          Length = 384

 Score =  219 bits (557), Expect = 8e-55,   Method: Composition-based stats.
 Identities = 132/363 (36%), Positives = 208/363 (57%), Gaps = 9/363 (2%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
                P+   G+I W+ +N F +P + +LT   + LL    P +I W  LDA +  S   
Sbjct: 28  PALPAPLESVGVIGWLKQNLFSSPLNAMLTLAALALLWKIFPPLISWAILDANFSLSAL- 86

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
                            ACW FI+ ++   + G YP    WRP++ F+  + +     + 
Sbjct: 87  ----PQGADPGTIERTGACWTFIFVKFRVLMTGLYPEQLLWRPVMAFVIFAAVCAVTALR 142

Query: 137 SFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGI 196
               + +  +  +   P+  +F++ GG+GL++V+ SLWGGL+++  ++  GII+S+PLGI
Sbjct: 143 LLGVRMIMGM--WLFLPLPLYFLINGGMGLTVVDQSLWGGLMLSTGLAAIGIIMSIPLGI 200

Query: 197 LLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGV 256
           LLALGR S   V+R   I  IE  RGVPL+T+LFMAS+MLP+FLP   +++ LLR  +G+
Sbjct: 201 LLALGRRSEWVVIRSLSIGMIESIRGVPLITILFMASVMLPIFLPREMNINNLLRVQIGI 260

Query: 257 SAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIG 316
             F++AYIAEV+RGGLQ+I +GQ EAA SLGL        +++PQ ++ V+P ++   + 
Sbjct: 261 ILFSAAYIAEVVRGGLQAIPQGQIEAATSLGLPGWVVTAFVVLPQALRHVVPSLIGRCVA 320

Query: 317 LFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFI 376
           LFKD+SL+ I+ + D LG+++ +  +  W+         +F   V+WI CFS+S Y   I
Sbjct: 321 LFKDTSLVIIVGLLDFLGMIKASAQDPDWLG--YDAEAYVFCALVYWIICFSMSRYGRSI 378

Query: 377 EKT 379
           E  
Sbjct: 379 EHR 381


>gi|114771235|ref|ZP_01448655.1| glutamate/glutamine/aspartate/asparagine ABC transporter, permease
           protein [alpha proteobacterium HTCC2255]
 gi|114548160|gb|EAU51047.1| glutamate/glutamine/aspartate/asparagine ABC transporter, permease
           protein [alpha proteobacterium HTCC2255]
          Length = 434

 Score =  218 bits (556), Expect = 8e-55,   Method: Composition-based stats.
 Identities = 151/436 (34%), Positives = 223/436 (51%), Gaps = 60/436 (13%)

Query: 6   KEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVF 65
            +  +VRK ++     P+ Q GII W  KN F    + +LT ++   ++  +  I+ W  
Sbjct: 2   ADLSFVRKEIIPQRAAPLSQTGIIGWFRKNMFSDIPNTILTIIVGYFIISILGNILPW-V 60

Query: 66  LDAVWIGSNRTVCTTVSQG-GIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFL 124
               W   + T C  +    G    G   ACW  I +R+ Q +FG YP    WRPIL F+
Sbjct: 61  FSPTWNSVSLTECRGILAELGRSGHGGGGACWGVIRERWLQLLFGFYPSELYWRPILAFV 120

Query: 125 T----------------GSILLTPMLIPSFPRKFLNSILL-------------------- 148
                               L        F   +  SI                      
Sbjct: 121 LLGLALAPVLFDKASRKLIYLTAIYPFLCFWLIWGGSIWFPVTVFSGFIVAYLGYVYVNK 180

Query: 149 ----------FGLFPIFSFFVLYGG----------LGLSIVETSLWGGLLVTLVISFFGI 188
                         P+  +  +             +G   +E+   GG ++ ++I   GI
Sbjct: 181 AFGSLAGVIASIALPVLWWLFITSPLSISLHSIMPIGSEAIESDRLGGFMLAVLIGVTGI 240

Query: 189 IISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDK 248
            +S+P+GILLALGR SN+P+L+  C+ FIE  RGVPL+T+LF+AS +L +FLP   + D 
Sbjct: 241 ALSLPIGILLALGRQSNLPILKAVCVCFIEFIRGVPLITLLFVASTLLNIFLPPGSNFDL 300

Query: 249 LLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIP 308
           +LR ++ V+ FASAY+AEV+RGGL ++ KGQ+EAA+SLGL Y +  RLIIMPQ +K  IP
Sbjct: 301 ILRVMIMVTLFASAYMAEVVRGGLAALPKGQYEAADSLGLDYWKAQRLIIMPQALKISIP 360

Query: 309 GIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFS 368
           GIV+TFIGLFKD++L+SII + D LG+     ++  W   +       F+G +F+IFCFS
Sbjct: 361 GIVSTFIGLFKDTTLVSIIGLLDPLGLSTNIRADMAWNGILW--ELYGFVGLIFFIFCFS 418

Query: 369 ISLYSVFIEKTLHKGS 384
           +S YS+++E+ L  G 
Sbjct: 419 MSRYSMYLERKLATGH 434


>gi|71083648|ref|YP_266368.1| putative amino-acid ABC transporter permease protein yhdY
           [Candidatus Pelagibacter ubique HTCC1062]
 gi|71062761|gb|AAZ21764.1| Similar to amino-acid ABC transporter permease protein yhdY
           [Candidatus Pelagibacter ubique HTCC1062]
          Length = 426

 Score =  218 bits (555), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 132/358 (36%), Positives = 214/358 (59%), Gaps = 18/358 (5%)

Query: 32  IHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGW 91
           ++KN   +  +  L+  II L++FS+P +++W   DA   G  +  CT            
Sbjct: 82  LNKNINPSNFNAALSLCIIFLIIFSLPPLLNWFIFDANISGDTKEACTG----------- 130

Query: 92  NAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFGL 151
             ACW +I   + +F++G YP A++WR  + F+     +          +   S+    +
Sbjct: 131 GGACWVYIKVWFNRFMYGMYPNAEQWRINITFIAVLSFMAAGFFVPAKFRNYLSLYYTLI 190

Query: 152 FPIFSFFVLYG-----GLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNI 206
            PI SF ++Y        GL  VET  WGGL +T ++SFF +I   P+G++LALGR S++
Sbjct: 191 LPIISFILIYYLISGGSFGLEWVETGAWGGLSLTFIVSFFSLIFCFPIGMMLALGRRSDL 250

Query: 207 PVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAE 266
           PV++Y+ ++FIE +RGVPL+TVLFM+++M P+FLPD   VDKL+R ++ ++ F +AY AE
Sbjct: 251 PVVKYSSLSFIEFWRGVPLITVLFMSAVMFPMFLPDGTYVDKLIRVVVAITLFEAAYTAE 310

Query: 267 VLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISI 326
           V+RGGLQ++ +GQ++AA SLG+ Y +    +I+PQ +K VIPGI NTF+ L KD+ LI +
Sbjct: 311 VIRGGLQALPRGQYDAAKSLGMGYWKLHIFVILPQALKLVIPGIANTFLALVKDTPLIFV 370

Query: 327 INMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
           + + +++G++ +  +   W+       G +F G +FWI C+S+S YS  +E       
Sbjct: 371 VGLLEVVGMLNLAKTNPEWLG--FSMEGYVFAGIIFWIICYSMSKYSQKLELKYKTDR 426


>gi|294675894|ref|YP_003576509.1| glutamate/aspartate ABC transporter permease BztC [Rhodobacter
           capsulatus SB 1003]
 gi|3182936|sp|Q52665|BZTC_RHOCA RecName: Full=Glutamate/glutamine/aspartate/asparagine transport
           system permease protein BztC
 gi|1655714|gb|AAB17888.1| BztC [Rhodobacter capsulatus SB 1003]
 gi|294474714|gb|ADE84102.1| glutamate/aspartate ABC transporter, permease protein BztC
           [Rhodobacter capsulatus SB 1003]
          Length = 434

 Score =  218 bits (554), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 148/437 (33%), Positives = 223/437 (51%), Gaps = 61/437 (13%)

Query: 6   KEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVF 65
            +  +VR  +L P   PV Q G I W+ +N F  P +  LT   +   ++ +     W+ 
Sbjct: 2   SDTSFVRTEMLAPRPAPVSQVGAIKWMRENLFSGPLNTALTVFGLLATVWLVQAAAPWL- 60

Query: 66  LDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQR--------- 116
           L  VW  ++ T C  +      P+    ACWA I  R+ QF+FG YP+ Q          
Sbjct: 61  LHGVWNANSLTECRAIIAERWGPEA-TGACWAVIRVRWNQFLFGFYPVDQYWRLFVTFAG 119

Query: 117 -------------------------------------WRPILVFLTGSIL---------- 129
                                                W P+ V    +IL          
Sbjct: 120 LFLALAPVLFDALPRKLIWGTLLYPLAAFWLLWGGPIWGPVSVLAGFAILGLLFTALAPK 179

Query: 130 LTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGII 189
           L   +             L+   PI +       L L  V++  +GG L+ LVI    I+
Sbjct: 180 LGVPVSAGIGLVVAALFWLYAAAPIEAALQSALPLALPEVDSDQFGGFLLALVIGVTAIV 239

Query: 190 ISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKL 249
           +S+PLGILLALGR S++ +++   +  IE  RGVPL+T+LF AS++L  FLP   + D +
Sbjct: 240 VSLPLGILLALGRQSDMLIVKSLSVGIIEFVRGVPLITLLFTASLLLQYFLPPGTNFDLI 299

Query: 250 LRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPG 309
           LR ++ V+ FA+AYIAEV+RGGL ++ +GQ+EAA++LGL Y Q  RLIIMPQ +K  IPG
Sbjct: 300 LRVVILVTLFAAAYIAEVIRGGLAALPRGQYEAADALGLDYWQAQRLIIMPQALKISIPG 359

Query: 310 IVNTFIGLFKDSSLISIINMFD-LLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFS 368
           IV++FIGLFKD++L++ + +FD L GI  V  S+  W  +       IF+  +F++F FS
Sbjct: 360 IVSSFIGLFKDTTLVAFVGLFDPLKGISNVVRSDMAWKGTYW--EPYIFVALIFFLFNFS 417

Query: 369 ISLYSVFIEKTLHKGSK 385
           +S YS+++E+ L +  +
Sbjct: 418 MSRYSMYLERKLKRDHR 434


>gi|91763311|ref|ZP_01265275.1| amino-acid ABC transporter permease protein yhdY-like protein
           [Candidatus Pelagibacter ubique HTCC1002]
 gi|91717724|gb|EAS84375.1| amino-acid ABC transporter permease protein yhdY-like protein
           [Candidatus Pelagibacter ubique HTCC1002]
          Length = 426

 Score =  217 bits (553), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 132/358 (36%), Positives = 214/358 (59%), Gaps = 18/358 (5%)

Query: 32  IHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGW 91
           ++KN   +  +  L+  II L++FS+P +++W   DA   G  +  CT            
Sbjct: 82  LNKNINPSNFNAALSLCIIFLIIFSLPPLLNWFIFDANISGDTKEACTG----------- 130

Query: 92  NAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFGL 151
             ACW +I   + +F++G YP A++WR  + F+     +          +   S+    +
Sbjct: 131 GGACWVYIKVWFNRFMYGMYPNAEQWRINITFIAVLSFMAAGFFVPAKFRNYLSLYYTLI 190

Query: 152 FPIFSFFVLYG-----GLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNI 206
            PI SF ++Y        GL  VET  WGGL +T ++SFF +I   P+G++LALGR S++
Sbjct: 191 LPIISFILIYYLISGGSFGLEWVETGAWGGLSLTFIVSFFSLIFCFPIGMMLALGRRSDL 250

Query: 207 PVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAE 266
           PV++Y+ ++FIE +RGVPL+TVLFM+++M P+FLPD   VDKL+R ++ ++ F +AY AE
Sbjct: 251 PVVKYSSLSFIEFWRGVPLITVLFMSAVMFPMFLPDGTYVDKLIRVVVAITLFEAAYTAE 310

Query: 267 VLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISI 326
           V+RGGLQ++ +GQ++AA SLG+ Y +    +I+PQ +K VIPGI NTF+ L KD+ LI +
Sbjct: 311 VIRGGLQALPRGQYDAAKSLGMGYWKLHIFVILPQALKLVIPGIANTFLALVKDTPLIFV 370

Query: 327 INMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
           + + +++G++ +  +   W+       G +F G +FWI C+S+S YS  +E       
Sbjct: 371 VGLLEVVGMLNLAKTNPEWLG--FSMEGYVFAGIIFWIICYSMSKYSQKLELKYKTDR 426


>gi|171058821|ref|YP_001791170.1| polar amino acid ABC transporter inner membrane subunit [Leptothrix
           cholodnii SP-6]
 gi|170776266|gb|ACB34405.1| polar amino acid ABC transporter, inner membrane subunit
           [Leptothrix cholodnii SP-6]
          Length = 366

 Score =  216 bits (550), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 122/373 (32%), Positives = 202/373 (54%), Gaps = 12/373 (3%)

Query: 14  RLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGS 73
             +    P         W  +N F        T L+I    +++P +  W    AVW G 
Sbjct: 6   SPIAARPPTRRSTTPWRWAQRNLFAGVPSSFATLLLIASFAWALPQLWIWGVSHAVWSG- 64

Query: 74  NRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPM 133
           N   C             + ACW  I +++   IFG YP   +WRP++  L    +L   
Sbjct: 65  NAEACQAARG--------SGACWGVITEKHRLVIFGRYPYDAQWRPLIATLAMFTMLVIS 116

Query: 134 LIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMP 193
            +    R +   +  +       F ++ GG GL+ V T  WGGL +T+ ++   I+++ P
Sbjct: 117 CVRRCWRPW--LVPAWAGVLAVFFVLMGGGFGLAKVGTDQWGGLPLTVTLATLSIVLAFP 174

Query: 194 LGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRAL 253
           + + +ALGR S +P +R  C  ++EL RGVPL++VLFMAS M PL +P     D LLR L
Sbjct: 175 IAVAVALGRRSKLPAIRSLCTLYVELIRGVPLISVLFMASFMFPLLMPSGTSPDVLLRVL 234

Query: 254 LGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNT 313
           +G++ F++AY+AE++R GLQ+I  GQ EAA S+GL + Q  RL+++PQ +  V+P ++N 
Sbjct: 235 VGITLFSAAYMAEIVRAGLQAIPAGQLEAAASVGLGWWQTQRLVVLPQALAAVVPSLMNN 294

Query: 314 FIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYS 373
           FI +FKD+SLI+++++++L G + +  S            G +FI  ++++ CF++S YS
Sbjct: 295 FIAIFKDTSLITVVSLYELTGSLGLALSGDPVWRPFK-IEGYLFITAIYFVICFAMSRYS 353

Query: 374 VFIEKTLHKGSKK 386
           +++E  L +   +
Sbjct: 354 LWVEAQLGRSRNR 366


>gi|86135805|ref|ZP_01054384.1| glutamate/glutamine/aspartate/asparagine ABC transporter, permease
           protein [Roseobacter sp. MED193]
 gi|85826679|gb|EAQ46875.1| glutamate/glutamine/aspartate/asparagine ABC transporter, permease
           protein [Roseobacter sp. MED193]
          Length = 432

 Score =  215 bits (548), Expect = 8e-54,   Method: Composition-based stats.
 Identities = 141/435 (32%), Positives = 222/435 (51%), Gaps = 64/435 (14%)

Query: 6   KEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVF 65
               +V   ++  S PP    G   W+  N F +  + +LT   + LL   +   + W  
Sbjct: 7   NSIAFVATSVIPESPPPAGDTGAYKWVRDNLFSSIPNSILTLAALALLYSLLSNTLPW-I 65

Query: 66  LDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGN-YPMAQRWRPILVFL 124
           L+ VW  S+   C  V  G       + AC++ + +R+ Q ++G  YP  Q WRP L  +
Sbjct: 66  LNGVWTTSSLAECREVLNG------KSGACFSVLSERWNQLLYGFKYPTDQYWRPNLALV 119

Query: 125 TGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGL-------------------- 164
              I L P+L    PRK L   +++     +  +     +                    
Sbjct: 120 LLLIALAPVLFFDLPRKLLAFTVIYPFLAFWLIWGGTIMVPIVALIGFAVAAVVFQKLGK 179

Query: 165 ---------------------------------GLSIVETSLWGGLLVTLVISFFGIIIS 191
                                             LS V +   GG ++ +++    + +S
Sbjct: 180 GSFAAGFFGAIVAALVIWKVGGMLIPEGASESAMLSSVPSRDLGGFMLNMMLGVTCVSLS 239

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +PLGI LALGR S++P++++ C+ FIE  RGVPL+T+LF+AS+ML  F P    VD  LR
Sbjct: 240 VPLGIALALGRQSSMPLIKWICVVFIEFVRGVPLITLLFVASVMLSYFFPPDATVDLFLR 299

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
            ++ ++ F++AYIAEV+RGGL ++ KGQ+EAA+SLGL Y Q MRLII+PQ +K  IPGIV
Sbjct: 300 VVIMITLFSAAYIAEVIRGGLAALPKGQYEAADSLGLDYPQAMRLIILPQALKISIPGIV 359

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRV-NFSESTWISSVTPTTGLIFIGFVFWIFCFSIS 370
           N  +GLFKD++L+S+I+MFD++G++R    + + W         L F   +F++ C+ IS
Sbjct: 360 NVAVGLFKDTTLVSVISMFDMVGMIRGPILASTEWNGVYW--ELLGFAAALFFVVCYGIS 417

Query: 371 LYSVFIEKTLHKGSK 385
            YS ++E+ L  G +
Sbjct: 418 QYSQWLERRLATGHR 432


>gi|167041374|gb|ABZ06127.1| putative binding-protein-dependent transport system inner membrane
           component [uncultured marine microorganism
           HF4000_005K23]
          Length = 420

 Score =  214 bits (544), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 137/354 (38%), Positives = 218/354 (61%), Gaps = 14/354 (3%)

Query: 32  IHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGW 91
           ++KN      + +L+ L+I +L+ +IPG+++W+F+DA +IG+++  CT            
Sbjct: 80  LNKNINSNWFNAILSLLVIFVLIKTIPGLLNWLFIDANFIGTSKEECTG----------- 128

Query: 92  NAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFGL 151
           + ACW FI   +++ ++G YP  + WR    FL   + +   +      K    I L  +
Sbjct: 129 DGACWIFINVWFKRLVYGIYPSTEIWRINAAFLILIVTVITAIFVGPKIKKYIIIFLLFI 188

Query: 152 FPIFSF-FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLR 210
           FP  +   +  G  GL  V T+ WGGL +T +++ F ++   P+G+L ALGR S+ PV++
Sbjct: 189 FPFIAISLISGGIFGLKWVATNAWGGLSLTFIVAIFAMLFCFPVGMLFALGRRSSYPVIK 248

Query: 211 YACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRG 270
           Y  I FIE +RGVPL+TVLFMAS+M P+FLPD   +DKL+R ++ ++ F +AY+AEV+RG
Sbjct: 249 YTSIGFIEFWRGVPLITVLFMASVMFPMFLPDGTYMDKLVRVIIAITLFEAAYMAEVIRG 308

Query: 271 GLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMF 330
           GLQ++ KGQ++A+ SLG+ Y +   LII+PQ +K  IPGI NTFI LFKD+ LI ++ + 
Sbjct: 309 GLQALPKGQYDASKSLGMGYWRMHLLIILPQALKITIPGIANTFIALFKDTPLILVVGLL 368

Query: 331 DLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
           +LLG++ +  +   W+       G +F   V+WIFC+S+S YS  +E+      
Sbjct: 369 ELLGMIDMAKANPDWLGFAR--EGYVFAAIVYWIFCYSMSRYSQNLERKYKTDR 420


>gi|126731769|ref|ZP_01747573.1| probable ABC transporter permease protein [Sagittula stellata E-37]
 gi|126707596|gb|EBA06658.1| probable ABC transporter permease protein [Sagittula stellata E-37]
          Length = 364

 Score =  213 bits (543), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 119/363 (32%), Positives = 193/363 (53%), Gaps = 12/363 (3%)

Query: 22  PVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTV 81
           P        W+ KN F +    +LT  +   L      +++W  LDAV+   +  VC   
Sbjct: 13  PNATLPFGQWMKKNLFNSIPQGILTVFVAACLARFAWFVLNWGVLDAVFYTDDPDVCRAA 72

Query: 82  SQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRK 141
           +           ACWA I +++   +FG YP  ++WR +++     + +   L+P F   
Sbjct: 73  A----------GACWAVIVEKHRPMLFGLYPYDEQWRLVIMMAIYLVTVVVSLMPRFWNL 122

Query: 142 FLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALG 201
                L           +  G  G+  V ++ WGGL +T+++    ++I MP+ +LLALG
Sbjct: 123 KFLVPLWIFSVVSIFTLLFGGVFGMPFVPSTDWGGLPLTMILFSGTVLIGMPVAVLLALG 182

Query: 202 RNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFAS 261
           R S +PV +   + FIE  RGVPL+T+LF+A  + PLFLP   +V+KLLR  +G++ F +
Sbjct: 183 RRSPLPVAKGVSVVFIEALRGVPLITILFVAVNVFPLFLPAGVEVNKLLRITVGIAVFFA 242

Query: 262 AYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDS 321
            Y AEV+RGGLQ+I  GQ+EAA+SL L+Y Q  R II+PQ ++  +P I N  I   K++
Sbjct: 243 CYQAEVIRGGLQAIPTGQYEAADSLNLTYWQTTRRIILPQALRISLPAITNHIIAAMKNT 302

Query: 322 SLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
           S + II +FD+L        +  W          +F+  ++  F +++SLY+  +EK ++
Sbjct: 303 SFVIIIGLFDILTATTAVMQDPLWRRYY--VEAYLFVAAIYLFFGYALSLYARQVEKWIN 360

Query: 382 KGS 384
           +G 
Sbjct: 361 QGR 363


>gi|99080137|ref|YP_612291.1| amino acid ABC transporter permease [Ruegeria sp. TM1040]
 gi|99036417|gb|ABF63029.1| Amino acid ABC transporter permease protein 3-TM region
           His/Glu/Gln/Arg/opine [Ruegeria sp. TM1040]
          Length = 442

 Score =  213 bits (541), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 124/444 (27%), Positives = 211/444 (47%), Gaps = 67/444 (15%)

Query: 6   KEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVF 65
            +  +VR  +L P  PP  + G++ W+  N F    + +LT + +  ++  + G+I W +
Sbjct: 2   SDISFVRTEMLPPKEPPASEVGVLGWMRANLFSNWFNSVLTLVSLYFVIQILIGLITWAW 61

Query: 66  LDAVWIGSNRTV-----------------CTTVSQGGIQP-------------------- 88
           +   W   +                    C  V                           
Sbjct: 62  V-PTWSAGSLPECRVIFEELGRTGHNAGACWGVIAERWPQLLFGFYPNGSEPGTADLRWR 120

Query: 89  -----------------DGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLT 131
                                 A   +    Y   +         W P+++     +   
Sbjct: 121 PVLAFLLLFVALAPVLFADKVPAKLIYFSAAYPFLMPWLLWGGTVWTPVMIAAGFVVGYF 180

Query: 132 PMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLG----------LSIVETSLWGGLLVTL 181
                S     L  ++   +  +  +  +   +           L  VE+  +GG ++++
Sbjct: 181 VYKAVSQATSELIGLISGVVGAVVWWLFVASFIASVLAGIVPLALESVESRQFGGFMLSI 240

Query: 182 VISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLP 241
           +I    I +S+P+GI+LALGR S++ +++  C+ FIE  RGVPL+T+LF+AS +L +F+P
Sbjct: 241 LIGVVAIGLSLPIGIVLALGRQSDLLIVKTLCVGFIEFIRGVPLITLLFVASTLLNIFMP 300

Query: 242 DTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQ 301
              + D ++R  + V+ FASAY+AEV+RGGL ++ KGQ+E A+SLGL+Y Q  RLIIMPQ
Sbjct: 301 PGTNFDIIMRVFIMVTLFASAYMAEVIRGGLAALPKGQYEGADSLGLNYWQAQRLIIMPQ 360

Query: 302 VIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFV 361
            +K  IPGIV+TFIG+FKD++L+S+I +FD L +     +++ W   V       FI  +
Sbjct: 361 ALKISIPGIVSTFIGVFKDTTLVSVIGLFDPLNLTNAIRADANWNGLVW--ELYGFIALL 418

Query: 362 FWIFCFSISLYSVFIEKTLHKGSK 385
           F++FCF +S YS+++E+ L  G +
Sbjct: 419 FFVFCFGMSRYSMYLERKLQTGHR 442


>gi|260577144|ref|ZP_05845121.1| polar amino acid ABC transporter, inner membrane subunit
           [Rhodobacter sp. SW2]
 gi|259020618|gb|EEW23937.1| polar amino acid ABC transporter, inner membrane subunit
           [Rhodobacter sp. SW2]
          Length = 434

 Score =  211 bits (538), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 140/434 (32%), Positives = 213/434 (49%), Gaps = 61/434 (14%)

Query: 9   PYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDA 68
            Y+R  +L    PP+  RGII WI +N F    +  LT   +  + + +   + W FL  
Sbjct: 5   SYLRDTVLPQLPPPLVDRGIIKWIRENLFSGVLNTFLTLAGLAAVWWLLAASLPW-FLHG 63

Query: 69  VWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQR------------ 116
           VW  ++   C ++       +G   ACWA + +R+ QFIFG YP                
Sbjct: 64  VWDANSLGECRSIIAAEFG-EGAQGACWAMLRERWHQFIFGFYPPEAYWRVGLAFVLLFV 122

Query: 117 ----------------------------------WRPILVFLTGSILLTPMLIPS----- 137
                                             W P++      +L     +       
Sbjct: 123 ALAPVLFTEVPRLLLWGTVIYPALGYWLLWGGSIWGPVVAMAGFGLLALVFKLLRPLLGV 182

Query: 138 -----FPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISM 192
                          LF   P+         +GL  VE+  +GG L+++VI    I  S+
Sbjct: 183 PVAGGLGFVAAVLWWLFAQGPVAGLLAGVMPVGLVPVESDRFGGFLLSIVIGVTSIAASL 242

Query: 193 PLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRA 252
           PLGILLALGR S++ +++   + FIE  RGVPL+T+LF AS++L  FLP     D +LR 
Sbjct: 243 PLGILLALGRRSDMFLVKTLSVAFIEFIRGVPLITMLFTASLLLQYFLPPGTSFDLILRV 302

Query: 253 LLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVN 312
            + V+ FA+AY+AEV+RGG+ ++ +GQ+EAA++LGL Y    RLII+PQ +K  IP IV+
Sbjct: 303 DILVTIFAAAYLAEVVRGGMAALPRGQYEAADALGLDYWSAERLIILPQALKISIPSIVS 362

Query: 313 TFIGLFKDSSLISIINMFD-LLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISL 371
           TFI LFKD++L+S + + D L GI  +  ++  W          +F+G VF++ CFS+S 
Sbjct: 363 TFISLFKDTTLVSFVGLLDPLKGISTIVRADMAWKGVYW--EPYLFVGAVFFVLCFSMSR 420

Query: 372 YSVFIEKTLHKGSK 385
           YS+++E+ L    K
Sbjct: 421 YSMYLERKLKTDHK 434


>gi|258545566|ref|ZP_05705800.1| general amino acid ABC superfamily ATP binding cassette
           transporter, permease protein [Cardiobacterium hominis
           ATCC 15826]
 gi|258519266|gb|EEV88125.1| general amino acid ABC superfamily ATP binding cassette
           transporter, permease protein [Cardiobacterium hominis
           ATCC 15826]
          Length = 339

 Score =  208 bits (530), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 157/347 (45%), Positives = 216/347 (62%), Gaps = 15/347 (4%)

Query: 36  FFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAAC 95
            F +P   +LT L + LL   +P +  W    A + GS    CT+             AC
Sbjct: 1   MFASPVHAVLTVLALYLLYRIVPQLFLWALWLADFRGSTAADCTS-----------GGAC 49

Query: 96  WAFIYDRYEQFIFGNYPMAQRWRPILVF--LTGSILLTPMLIPSFPRKFLNSILLFGLFP 153
           W FI  R  QF++G YP ++RWR  L+F  +T +  L         R +     L  L  
Sbjct: 50  WVFIKVRLSQFLYGFYPESERWRVWLLFLGITPATFLALWCCEGKKRLWALLFALLVLPV 109

Query: 154 IFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYAC 213
           +  + +  G  GL  V  +LWGG+++TLV++  G++ S+P GILLALGR S++P LR  C
Sbjct: 110 LSWYLLRGGVFGLPEVRPNLWGGMMLTLVVASAGLLFSLPFGILLALGRTSDMPFLRGVC 169

Query: 214 ITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQ 273
           + FIEL+RGVPLVTVLFMA++MLPLFLP +W +D L+RAL+GV+ FASAY+AEV+RGGLQ
Sbjct: 170 VAFIELWRGVPLVTVLFMANVMLPLFLPPSWHIDNLMRALIGVALFASAYMAEVVRGGLQ 229

Query: 274 SISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLL 333
           +I +GQFEAA+SLGL Y  KMRLII+PQ +  VIPGI NTF+GLFKD++L+SII ++D L
Sbjct: 230 AIPRGQFEAADSLGLGYWAKMRLIILPQALTTVIPGITNTFVGLFKDTTLVSIIGLYDFL 289

Query: 334 GIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTL 380
           GIV     +  W+       G  F   V+++ C+ +S  S  IE+  
Sbjct: 290 GIVHSAGQDPAWLGHG--MEGYAFCALVYFLLCYGMSHTSYRIERHF 334


>gi|253690351|ref|YP_003019541.1| polar amino acid ABC transporter, inner membrane subunit
           [Pectobacterium carotovorum subsp. carotovorum PC1]
 gi|251756929|gb|ACT15005.1| polar amino acid ABC transporter, inner membrane subunit
           [Pectobacterium carotovorum subsp. carotovorum PC1]
          Length = 369

 Score =  208 bits (530), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 120/363 (33%), Positives = 195/363 (53%), Gaps = 12/363 (3%)

Query: 22  PVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTV 81
           P   R  + W+ ++ F +    +LT L+  L+      ++HW  LDAVW  ++  +C   
Sbjct: 12  PSQLRTPLLWLRRHLFSSVPQTVLTLLLAVLMWNVGNKLLHWGILDAVWYTADPDICRAA 71

Query: 82  SQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRK 141
           +           ACWA I +++   +FG YP  + WR +L      + L   L+P F   
Sbjct: 72  A----------GACWAVIVEKHRPILFGLYPYDEHWRLVLAMGIWFLALGLSLMPRFWHS 121

Query: 142 FLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALG 201
            +   L        +  +  G  GLS V +S WGGL +T+++    ++I MP+ +LLALG
Sbjct: 122 RILLPLWLVAVVSIAILMSGGVFGLSDVPSSEWGGLPLTILLFSGTVVIGMPVSVLLALG 181

Query: 202 RNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFAS 261
           R S +P LR   + FIE  RGVPL+T+LF+A  + PLFLP   +++KLLR ++G++ F +
Sbjct: 182 RRSPLPFLRGLSVIFIEGLRGVPLITILFVAVNVFPLFLPAGMEINKLLRIIIGIALFFA 241

Query: 262 AYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDS 321
            Y AEV+RGGLQS+ +GQ+EAA +L L Y      I++PQ ++  +P + N  I   K++
Sbjct: 242 CYQAEVIRGGLQSVPRGQYEAAMALNLGYWHTTTKIVLPQALRICLPAMTNHIIAAMKNT 301

Query: 322 SLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
           S + II +FD+L        +  W          +FI  ++ +F F +S Y++++EK + 
Sbjct: 302 SFVIIIGLFDILTATSSVMQDPLWRRYY--IETYLFISAIYLLFGFLLSRYALWVEKRID 359

Query: 382 KGS 384
              
Sbjct: 360 ASR 362


>gi|227325812|ref|ZP_03829836.1| Polar amino acid ABC transporter, inner membrane subunit precursor
           [Pectobacterium carotovorum subsp. carotovorum WPP14]
          Length = 369

 Score =  208 bits (529), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 121/363 (33%), Positives = 195/363 (53%), Gaps = 12/363 (3%)

Query: 22  PVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTV 81
           P   R  + W+ ++ F +    +LT L+  L+      ++HW  LDAVW  ++  +C   
Sbjct: 12  PSRLRTPLLWLRRHLFSSVPQTVLTLLLAVLMWNVGNKLLHWGILDAVWYTTDPDICRVA 71

Query: 82  SQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRK 141
           +           ACWA I +++   +FG YP  + WR +L      + L   L+P F   
Sbjct: 72  A----------GACWAVIVEKHRPILFGLYPYDEHWRLVLAMGIWFLALGLSLMPRFWHS 121

Query: 142 FLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALG 201
            +   L        +  +  G  GLS V +S WGGL +T+++    ++I MP+ +LLALG
Sbjct: 122 RILLPLWIVAVVGIAILMSGGVFGLSYVPSSEWGGLPLTILLFSGTVVIGMPVSVLLALG 181

Query: 202 RNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFAS 261
           R S +P LR   + FIE  RGVPL+T+LF+A  + PLFLP   +++KLLR ++G++ F +
Sbjct: 182 RRSPLPFLRGLSVIFIEGLRGVPLITILFVAVNVFPLFLPAGMEINKLLRIIIGIALFFA 241

Query: 262 AYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDS 321
            Y AEV+RGGLQS+ +GQ+EAA +L L Y      II+PQ ++  +P + N  I   K++
Sbjct: 242 CYQAEVIRGGLQSVPRGQYEAAMALNLGYWHTTTKIILPQALRICLPAMTNHIIAAMKNT 301

Query: 322 SLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
           S + II +FD+L        +  W          +FI  ++ +F F +S Y++++EK + 
Sbjct: 302 SFVIIIGLFDILTATSSVMQDPLWRRYY--IETYLFISAIYLLFGFLLSRYALWVEKRID 359

Query: 382 KGS 384
              
Sbjct: 360 ASR 362


>gi|254464309|ref|ZP_05077720.1| amino acid ABC transporter, permease protein [Rhodobacterales
           bacterium Y4I]
 gi|206685217|gb|EDZ45699.1| amino acid ABC transporter, permease protein [Rhodobacterales
           bacterium Y4I]
          Length = 432

 Score =  208 bits (528), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 124/439 (28%), Positives = 205/439 (46%), Gaps = 70/439 (15%)

Query: 5   CKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWV 64
            +   +VR+  + P+ PP  + G++ W+ +N F    +  LT   + ++   +   + W 
Sbjct: 6   AQTVAFVRETQIPPAPPPASETGVVKWLRENLFSNAANSALTIAALAVIYMVLQNTLPW- 64

Query: 65  FLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGN-YPMAQRWRPILVF 123
            L+ VW  S+   C  + QG         AC++ + +R+ Q ++G  YP    WRP L  
Sbjct: 65  ILNGVWTTSSLAECREILQG------KTGACFSVLTERWNQLLYGFKYPSDAYWRPNLAL 118

Query: 124 LTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIV-------------- 169
           +       P+L    PRK    ++   ++P  +F++++GG  +  V              
Sbjct: 119 VLLLFAAAPVLFFDLPRK---LLIFTAIYPFLAFWLIWGGTLMVPVVALLGFAAAAAVFQ 175

Query: 170 ---ETSLWGGLLVTLVISFFGIIISMPL--------------------GILLALGRNSNI 206
              ++S        +  +F   I    L                    G +L L      
Sbjct: 176 TFGKSSFAIAFFGAIAAAFAVWIAGGMLIPEGASEDAWLSPVPSRDLGGFMLNLMLGVTC 235

Query: 207 PVLRYACITFIELFRG--VPLVTVLFM-----------------ASIMLPLFLPDTWDVD 247
             L       + L R   +PL+  + +                 AS+ML  F P    VD
Sbjct: 236 VSLSLPLGIALALGRQSDMPLIKWMCVIFIEFVRGVPLITLLFVASVMLAYFFPPESTVD 295

Query: 248 KLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVI 307
             LR ++ ++ F++AYIAEV+RGGL ++ KGQ+EAA+SLGL Y Q MRLII+PQ +K  I
Sbjct: 296 LFLRVVIMITMFSAAYIAEVIRGGLAALPKGQYEAADSLGLDYAQAMRLIILPQALKISI 355

Query: 308 PGIVNTFIGLFKDSSLISIINMFDLLGIVRV-NFSESTWISSVTPTTGLIFIGFVFWIFC 366
           PGIVN  +GLFKD++L+S+I+MFDL+G++R    + + W         L F   +F++ C
Sbjct: 356 PGIVNVAVGLFKDTTLVSVISMFDLVGMIRGPILASTEWNGVYW--ELLGFAALLFFVVC 413

Query: 367 FSISLYSVFIEKTLHKGSK 385
           + IS YS ++E+ L    +
Sbjct: 414 YGISQYSQWLERRLATDHR 432


>gi|261823406|ref|YP_003261512.1| polar amino acid ABC transporter inner membrane protein
           [Pectobacterium wasabiae WPP163]
 gi|261607419|gb|ACX89905.1| polar amino acid ABC transporter, inner membrane subunit
           [Pectobacterium wasabiae WPP163]
          Length = 369

 Score =  206 bits (524), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 126/363 (34%), Positives = 198/363 (54%), Gaps = 12/363 (3%)

Query: 22  PVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTV 81
           P   R  + W+H++ F +    +LT L++ L+      ++HW  LDAVW  ++  VC   
Sbjct: 12  PSRLRTPLLWMHRHLFSSMPQTILTLLLVVLMWIIGNKLLHWGILDAVWYTTDPDVCRAA 71

Query: 82  SQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRK 141
           +           ACWA I +++   +FG YP  + WR +L      + L   L+P F   
Sbjct: 72  A----------GACWAVIVEKHRPILFGLYPYDEHWRLVLAMGIWFLALGLSLMPRFWHS 121

Query: 142 FLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALG 201
            +   L        +  +  G  GLS V +S WGGL +T+++    ++I MP+ ILLALG
Sbjct: 122 RILLPLWIIAVVAIAILMSGGLFGLSYVPSSEWGGLPLTILLFSGTVVIGMPVSILLALG 181

Query: 202 RNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFAS 261
           R S +P LR   + FIE  RGVPL+T+LF+A  + PLFLP   +++KLLR ++G++ F +
Sbjct: 182 RRSPLPFLRGLSVVFIEGLRGVPLITILFVAVNVFPLFLPAGMEINKLLRIIIGIALFFA 241

Query: 262 AYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDS 321
            Y AEV+RGGLQS+ +GQ+EAA +L LSY      II+PQ ++  +P + N  I   K++
Sbjct: 242 CYQAEVIRGGLQSVPRGQYEAAMALNLSYWHTTTKIILPQALRICLPAMTNHIIAAMKNT 301

Query: 322 SLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
           S + II +FD+L        +  W          IFI  ++ +F F +S Y++++EK + 
Sbjct: 302 SFVIIIGLFDILTATSSVMQDPLWRRYY--IETYIFISAIYLLFGFLLSRYALWVEKRID 359

Query: 382 KGS 384
              
Sbjct: 360 ASR 362


>gi|302339788|ref|YP_003804994.1| polar amino acid ABC transporter inner membrane subunit
           [Spirochaeta smaragdinae DSM 11293]
 gi|301636973|gb|ADK82400.1| polar amino acid ABC transporter, inner membrane subunit
           [Spirochaeta smaragdinae DSM 11293]
          Length = 357

 Score =  206 bits (523), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 148/355 (41%), Positives = 216/355 (60%), Gaps = 13/355 (3%)

Query: 28  IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQ 87
           ++  I +++F +P  I+L+ +I+ L +     +I W F++AVW G NR V          
Sbjct: 8   LLKTIKRDYFNSPFTIMLSLVILYLAVRLGIWLIQWAFINAVWSGENREV---------- 57

Query: 88  PDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSIL 147
               N A WAFI  +   FIFG YP  Q WR I+ FL  ++   P  +     K L    
Sbjct: 58  -AVKNGATWAFIRAKIRFFIFGFYPKDQIWRIIITFLIMALSFIPYFMKKIHHKVLVFAS 116

Query: 148 LFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIP 207
              ++PI   F L GG GL  V T+ WGGL +TL++S  G++ S P+GI LALGR S+ P
Sbjct: 117 HMLIWPIVIIFFLSGGAGLEKVSTNDWGGLTLTLILSSLGLLYSFPIGIALALGRRSSWP 176

Query: 208 VLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEV 267
           V+R   + +IE FRG+PL+T+LFMAS+++P FLP    VDK++R ++G++ F SAY+AEV
Sbjct: 177 VIRGLSVAYIEFFRGIPLITILFMASVVVPFFLPPQISVDKIIRIIVGMTCFQSAYLAEV 236

Query: 268 LRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISII 327
           +RGGLQSI KGQ+EA++SLG  +  +  LII+PQV+K  +  I    I   KD++L+ II
Sbjct: 237 IRGGLQSIPKGQYEASDSLGFGFSLQQYLIILPQVLKVTVANIGGISISFLKDTTLVLII 296

Query: 328 NMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHK 382
            MFDLLG+V    S+S W+       G +F G ++W+ CF+IS  +  IE+ +H 
Sbjct: 297 GMFDLLGMVSPLASDSNWLG--MEPEGYLFAGLIYWLICFTISRITNRIEEKVHT 349


>gi|255262639|ref|ZP_05341981.1| glutamate/glutamine/aspartate/asparagine transport system
           permeaseprotein BztC [Thalassiobium sp. R2A62]
 gi|255104974|gb|EET47648.1| glutamate/glutamine/aspartate/asparagine transport system
           permeaseprotein BztC [Thalassiobium sp. R2A62]
          Length = 432

 Score =  205 bits (522), Expect = 9e-51,   Method: Composition-based stats.
 Identities = 139/436 (31%), Positives = 218/436 (50%), Gaps = 64/436 (14%)

Query: 5   CKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWV 64
            +   +VR   + P+ PP    G + WI  N F TP + +LT + + ++   + G + W 
Sbjct: 6   SQSVAFVRTEDVPPAPPPANATGPVKWIKDNLFATPANSVLTVIALLVIYMVLSGTLPW- 64

Query: 65  FLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGN-YPMAQRWRPILVF 123
             + +W   +  VC  +  G       + AC+A + +R+ Q +FG  YP    WRP L F
Sbjct: 65  VFNGIWDSPSLAVCREMLNGE------SGACFAVLTERWNQLLFGFKYPSDLYWRPALAF 118

Query: 124 LTGSILLTPMLIPSFPRKFLNSILL----------------------------------- 148
               +   P+L    PRK L    L                                   
Sbjct: 119 ALLFVAAAPVLFFDLPRKILIFTGLYPFIAYYLIWGGSIFTPLLALAGFVAGGYVYQRFV 178

Query: 149 ------------------FGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIII 190
                             + +              +  V++   GG ++ +++    + +
Sbjct: 179 KGSFAVGFFGAIAAAVLVWTIGGFIIPSSEITEGAMQSVQSRDLGGFMLNMMLGVTCVSL 238

Query: 191 SMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLL 250
           S+P+GI LALGR S++P+++Y C+ FIE  RGVPL+T+LF+AS+ML  F P    VD  L
Sbjct: 239 SLPIGIALALGRQSSMPIIKYICVVFIEFIRGVPLITLLFVASVMLSYFFPPEATVDLFL 298

Query: 251 RALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGI 310
           R ++ ++ F++AYIAEV+RGGL ++ KGQ+EAA+SLGL Y Q MRLII+PQ +K  IPGI
Sbjct: 299 RVVIMITIFSAAYIAEVVRGGLAALPKGQYEAADSLGLDYTQAMRLIILPQALKISIPGI 358

Query: 311 VNTFIGLFKDSSLISIINMFDLLGIVRV-NFSESTWISSVTPTTGLIFIGFVFWIFCFSI 369
           VN  +GLFKD++L+S+I+MFD++G++R    + + W            + F   I C+ I
Sbjct: 359 VNVSVGLFKDTTLVSVISMFDMVGMIRGPILASTEWNGVYWELFAFAALLFF--IVCYGI 416

Query: 370 SLYSVFIEKTLHKGSK 385
           S YS ++E+ L    K
Sbjct: 417 SQYSQWLERRLATDHK 432


>gi|189023947|ref|YP_001934715.1| Tetracycline resistance protein [Brucella abortus S19]
 gi|189019519|gb|ACD72241.1| Tetracycline resistance protein [Brucella abortus S19]
          Length = 289

 Score =  204 bits (520), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 180/289 (62%), Positives = 227/289 (78%), Gaps = 1/289 (0%)

Query: 99  IYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIF-SF 157
           +  +YEQF++G YP+++RWR  L  L  + LL P+LIP  P+K LN+IL F +FP+   F
Sbjct: 1   MNAKYEQFLYGRYPISERWRVDLTALIFAALLVPLLIPKIPKKGLNAILFFLVFPVVAFF 60

Query: 158 FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFI 217
            ++ G  GL  VET LWGGLLVTLV+SF GI +S+PLGI+LALGR S +PV++   I FI
Sbjct: 61  LLVGGWFGLPYVETPLWGGLLVTLVLSFVGIAVSLPLGIVLALGRRSKLPVIKTLSIIFI 120

Query: 218 ELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISK 277
           E+ RGVPLVTVLFMAS+MLPLFLP     DKLLRAL+GV+ FASAY+AEV+RGGLQ+I +
Sbjct: 121 EMVRGVPLVTVLFMASVMLPLFLPPGVTFDKLLRALIGVALFASAYMAEVVRGGLQAIPR 180

Query: 278 GQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVR 337
           GQ+E A++LGLSY QK  L+++PQ +K VIPGIVNTFIGLFKD+SL+ II MFDLLGIVR
Sbjct: 181 GQYEGADALGLSYWQKTGLVVLPQALKLVIPGIVNTFIGLFKDTSLVYIIGMFDLLGIVR 240

Query: 338 VNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
            NFS++ W S  TP TGLIF GFVFWIFCF++S YS+F+E+ L  G K+
Sbjct: 241 QNFSDANWASPQTPATGLIFAGFVFWIFCFAMSRYSIFMERRLDTGHKR 289


>gi|319793874|ref|YP_004155514.1| polar amino acid ABC transporter, inner membrane subunit
           [Variovorax paradoxus EPS]
 gi|315596337|gb|ADU37403.1| polar amino acid ABC transporter, inner membrane subunit
           [Variovorax paradoxus EPS]
          Length = 352

 Score =  203 bits (517), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 124/357 (34%), Positives = 199/357 (55%), Gaps = 13/357 (3%)

Query: 25  QRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQG 84
            +G IAW     +G+P   L T L+I +L +    I  W  + AV+   +   C  V   
Sbjct: 5   AQGPIAW-RSELWGSPLRALATVLLIAVLAWIGFHIFEWAVVHAVFRA-DAEACRAVQ-- 60

Query: 85  GIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLN 144
                  + ACW  + +++   +FG +P  ++WRP +  +  S +      P   R +L 
Sbjct: 61  -------HGACWGVVAEKWRPMLFGRFPYEEQWRPAIAVVVLSAVTVLSAWPRSWRWWLV 113

Query: 145 SILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNS 204
            + +  L       +  G +GLS V TS WGGL +T+ ++  G+ ++ PL +LLALGR S
Sbjct: 114 PLWVVALVLFVL-LMRGGVMGLSHVPTSRWGGLPLTIGLAVVGLALAFPLALLLALGRRS 172

Query: 205 NIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYI 264
             PV+R    ++IEL RGVPL++VLFMAS +LPL  P  W  D L+R L G++ F +AY+
Sbjct: 173 GWPVVRTLSASYIELVRGVPLISVLFMASFLLPLLWPAGWQPDVLVRVLAGLTLFVAAYL 232

Query: 265 AEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLI 324
           AE++RGGLQ++ +GQ E A +LG       R I++PQ ++ V+P + N+ +G  KD+SL+
Sbjct: 233 AEIIRGGLQAVPRGQTEVAMALGFGRWPVQRDIVLPQALRLVVPALTNSVVGTLKDTSLV 292

Query: 325 SIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
           +++ +F+L G + +               G +FI  V+W+ CF +S YSV++E+ L 
Sbjct: 293 TVVGLFELTGALGLALGGDPIWRPFY-LEGYLFIAAVYWVLCFGLSRYSVWLERRLA 348


>gi|126736640|ref|ZP_01752380.1| amino acid ABC transporter, permease protein [Roseobacter sp. CCS2]
 gi|126713953|gb|EBA10824.1| amino acid ABC transporter, permease protein [Roseobacter sp. CCS2]
          Length = 432

 Score =  203 bits (515), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 134/436 (30%), Positives = 219/436 (50%), Gaps = 64/436 (14%)

Query: 5   CKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWV 64
                +VR   L    PP  + G++ W+ +N F +    +LT + + ++   +  +  W+
Sbjct: 6   AHSVAFVRTEPLPELPPPPGETGMVKWMQQNLFSSIPSSILTLVSLYVIYLLVAFVAPWM 65

Query: 65  FLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGN-YPMAQRWRPILVF 123
             + +W   +   C T   G         AC++ I +R+ Q +FG  YP    WRP L F
Sbjct: 66  -ANGIWNTDSLAECRTALDGA------TGACFSVISERWNQLLFGFSYPTEFYWRPGLAF 118

Query: 124 LTGSILLTPMLIPSFPRKF------LNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGL 177
           +   +   P++    PRK          I  + ++    +  L+   G+ +        +
Sbjct: 119 ILLFVAAAPVMFFDLPRKMLIFTGLYPFIAFWLIWGGTIYTPLFALAGVVVGYLVYSRYV 178

Query: 178 LVTLVISFFGIIIS---------------------------------------------- 191
             +  + FFG +I+                                              
Sbjct: 179 KDSFAMGFFGGVIAAFITWFIGGYIVDAIAPAEPFLEAVASRNMGGFMLNMILGVVCVSL 238

Query: 192 -MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLL 250
            +PLGI+LALGR S++P++++ C+ FIE  RGVPL+T+LF+A+++L  FLP     D +L
Sbjct: 239 SLPLGIVLALGRQSDMPIIKWICVVFIEFIRGVPLITLLFVANVVLAFFLPPGTTFDLIL 298

Query: 251 RALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGI 310
           R ++ ++ F++AYIAEV+RGGL ++ KGQ+EAA+SLGL Y Q MRLII+PQ +K  IPGI
Sbjct: 299 RVIIMITMFSAAYIAEVIRGGLAALPKGQYEAADSLGLDYAQAMRLIILPQALKISIPGI 358

Query: 311 VNTFIGLFKDSSLISIINMFDLLGIVRV-NFSESTWISSVTPTTGLIFIGFVFWIFCFSI 369
           VN  +GLFKD+ L+S+I+MFDLLG++R    S + W          +    +F++ C+ I
Sbjct: 359 VNVAVGLFKDTVLVSVISMFDLLGMIRGPILSSTEWNGVYW--ELFMAASVLFFVVCYGI 416

Query: 370 SLYSVFIEKTLHKGSK 385
           S YS ++E+ L    +
Sbjct: 417 SQYSQWLERRLATDHR 432


>gi|317407541|gb|EFV87491.1| ABC-type amino acid transport system [Achromobacter xylosoxidans
           C54]
          Length = 321

 Score =  202 bits (514), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 128/327 (39%), Positives = 197/327 (60%), Gaps = 13/327 (3%)

Query: 60  IIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRP 119
           +++W  LDAVW G+   VC             + ACWAF+ ++  Q +FG YP  ++WRP
Sbjct: 8   LLNWAVLDAVWPGATGDVCRQA----------SGACWAFLGEKMRQILFGIYPPGEQWRP 57

Query: 120 ILVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLV 179
            +V L    +    L P   R     I + GL    +  +  G LGL+ V TS WGGL +
Sbjct: 58  TVVCLFILAMTVFSLSPRQWRARTAVIWIAGLLAGLA-LMQGGMLGLARVPTSSWGGLPI 116

Query: 180 TLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLF 239
           TL+++   +   +PLG+LLALGR  ++P  R+  I  IEL RG+PLV++LFMASI+LP+ 
Sbjct: 117 TLLLAVCALGAGLPLGVLLALGRRGSLPTARFISIGVIELIRGLPLVSLLFMASIVLPIM 176

Query: 240 LPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIM 299
           LP    +D LLRA + ++ F++AY+AEV+RGGLQ+I  GQ EA+ +LGLS+ Q  RL+++
Sbjct: 177 LPAGMTIDSLLRAGIALTVFSAAYLAEVIRGGLQAIPPGQAEASRALGLSWWQMTRLVVL 236

Query: 300 PQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIG 359
           PQ +++VI  + NT I + K++SL+ I+ +FDLL   R   ++  W +        +FI 
Sbjct: 237 PQALRKVIAPLTNTAIVMIKNTSLVLIVGLFDLLSSGRAALTDPAWPTPY--VETYLFIA 294

Query: 360 FVFWIFCFSISLYSVFIEKTLHKGSKK 386
            +++  CF +S YS+++E    KG  +
Sbjct: 295 SIYFCICFGLSRYSMWLEHRYKKGELR 321


>gi|330950962|gb|EGH51222.1| amino acid ABC transporter permease [Pseudomonas syringae Cit 7]
          Length = 279

 Score =  201 bits (510), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 144/281 (51%), Positives = 199/281 (70%), Gaps = 3/281 (1%)

Query: 107 IFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSF-FVLYGGLG 165
           ++G +P   RWR  L  +   +   P+ I  FPRK +  I    ++P+ +F  +  G  G
Sbjct: 1   MYGYFPNELRWRVDLTAILAIVGAAPLFISKFPRKAVYGIAFLVIYPVVAFYLLHGGAFG 60

Query: 166 LSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPL 225
           L+ V TS WGGL++TLVI+  GI+ ++PLGI+LALGR SN+P +R  C+TFIE +RGVPL
Sbjct: 61  LTNVPTSQWGGLMLTLVIATVGIVGALPLGIVLALGRRSNMPAVRVVCVTFIEFWRGVPL 120

Query: 226 VTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANS 285
           +TVLFM+S+MLPLF+P+  + DKLLRAL+GV  F SAYIAEV+RGG+Q+I KGQ+EAA++
Sbjct: 121 ITVLFMSSVMLPLFMPEGMNFDKLLRALIGVILFQSAYIAEVVRGGMQAIPKGQYEAASA 180

Query: 286 LGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTW 345
           +GL Y + M L+I+PQ +K VIPGIVNTFI LFKD+SL+ II +FDLL  V+   ++  W
Sbjct: 181 MGLGYWRSMGLVILPQALKMVIPGIVNTFIALFKDTSLVIIIGLFDLLNSVKQATADPAW 240

Query: 346 ISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
           +     T G +F   VFWIFCF +S YS+ +E+ L  G K+
Sbjct: 241 LG--MATEGYVFAALVFWIFCFGMSRYSMHLERKLDTGHKR 279


>gi|119897620|ref|YP_932833.1| putative amino acid permease [Azoarcus sp. BH72]
 gi|119670033|emb|CAL93946.1| putative amino acid permease [Azoarcus sp. BH72]
          Length = 362

 Score =  200 bits (509), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 117/356 (32%), Positives = 188/356 (52%), Gaps = 20/356 (5%)

Query: 32  IHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGW 91
           +    F +P   L T LI+  LL+    +  W  +DAVW+               + +  
Sbjct: 12  LRGRCFDSPWSALATVLILAALLWLGQRVAGWAVIDAVWVAD-----------AARCEAA 60

Query: 92  NAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSF--------PRKFL 143
             ACW  I +++   +FG YP   +WRP+L      + +   L  +          R   
Sbjct: 61  TGACWGVIAEKHRAILFGRYPFDAQWRPLLATAILLVAIVATLRAAGSRPRPDGNRRWRR 120

Query: 144 NSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRN 203
            ++       +F   +  G  GL+ V T LWGGL +TL+++  GI  + PL I+LALGR+
Sbjct: 121 VALAWVVTIALFPVLMGGGVAGLAPVPTELWGGLPLTLMLAVGGIATAFPLAIVLALGRS 180

Query: 204 SNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAY 263
             +P +R     ++EL R VPLV  LF+AS ++PL LP  W VD L R  + ++ FA+AY
Sbjct: 181 GPLPAMRAVSSVYVELIRSVPLVPALFLASFLVPLLLPADWQVDVLFRVQVAITLFAAAY 240

Query: 264 IAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSL 323
           +AE +RG L ++  GQ +AA +LGL + Q  R I++PQ ++   P I N+FI LFKD+SL
Sbjct: 241 LAEAIRGALLALPDGQRQAAAALGLGWWQTQRHILLPQALRNATPSIANSFINLFKDTSL 300

Query: 324 ISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKT 379
           + ++++++L G + +  +      S     G +FIG ++W  CF++S  S  +E+ 
Sbjct: 301 VVVVSLYELTGALEIALAGDAEWRSYQ-LEGYVFIGAIYWTGCFALSRASRRLEQR 355


>gi|152998088|ref|YP_001342923.1| polar amino acid ABC transporter inner membrane subunit
           [Marinomonas sp. MWYL1]
 gi|150839012|gb|ABR72988.1| polar amino acid ABC transporter, inner membrane subunit
           [Marinomonas sp. MWYL1]
          Length = 372

 Score =  200 bits (509), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 118/361 (32%), Positives = 200/361 (55%), Gaps = 15/361 (4%)

Query: 22  PVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTV 81
           P     ++ WI +N F T  D ++T  +I LL   +P  + W+F  A + G+NR  C   
Sbjct: 24  PFSFSRVMVWIKRNLFNTWLDSVVTLALIALLCLLLPKALDWLFFSATFSGTNRADC--- 80

Query: 82  SQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRK 141
                      AACW  I    + +I+G +P +++WR    F  G      +     P+K
Sbjct: 81  --------APGAACWIPIRQYMDYYIYGPFPESEQWRVNSAFAVGLFAFPLLFSQRIPQK 132

Query: 142 FLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALG 201
           ++ +     + P+  + +L GG     + TS  GGL +T  +    + +S+P+ ILLALG
Sbjct: 133 WIVA--YILVLPVVLWLLLKGGFIFEDISTSALGGLTLTFFLGIIAMCLSLPVSILLALG 190

Query: 202 RNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFAS 261
           R S +P+LR+AC  +IE+ R VP++T LFMAS++L LFLP    +D L R L  +   ++
Sbjct: 191 RQSQLPILRWACTGYIEIIRSVPVITFLFMASLVLQLFLPSGVSIDVLFRVLFVLIFVSA 250

Query: 262 AYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDS 321
            Y AE++RG +Q++ KGQ EA+ ++G  Y + M  ++MPQ ++  +P ++  FIGLFK++
Sbjct: 251 VYKAEIIRGAIQAVPKGQIEASYAMGCGYWKTMAYVVMPQALRNSVPALITNFIGLFKET 310

Query: 322 SLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
           +L+ I+ + +++G +   F  + W+       G I I   F+I CFSI+ Y  ++E+ + 
Sbjct: 311 TLVMILGLLEVMGAINATFHNAEWLGLHA--EGPIVISAFFFIACFSIAQYGAYLERRIK 368

Query: 382 K 382
           +
Sbjct: 369 R 369


>gi|148240913|ref|YP_001220414.1| inner membrane amino-acid ABC transporter permease protein
           [Bradyrhizobium sp. BTAi1]
 gi|146411289|gb|ABQ39742.1| Inner membrane amino-acid ABC transporter permease protein
           [Bradyrhizobium sp. BTAi1]
          Length = 360

 Score =  200 bits (508), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 139/369 (37%), Positives = 215/369 (58%), Gaps = 14/369 (3%)

Query: 11  VRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVW 70
           ++   L     PV  +  +    +  FG+P +  LT     +L  ++P ++ W+ LDAV 
Sbjct: 1   MKTISLPLPEAPVPSQASLRQAARLLFGSPLNAALTLAFGAMLAVALPPMLRWLVLDAVL 60

Query: 71  IGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILL 130
              +   C             + ACW+FIY +  Q +FG YP+ +RWRP LV L    LL
Sbjct: 61  FNPDPAACRAA----------SGACWSFIYVKSGQLLFGIYPVEERWRPALVCLLILALL 110

Query: 131 TPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIII 190
              + P+     L  + +  L  I    ++ GGLGL  V TS WGGL VTL+++   I I
Sbjct: 111 GWSVRPASWTPRLLGLWISALALIVW--MMGGGLGLEEVPTSAWGGLPVTLILTVVAIGI 168

Query: 191 SMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLL 250
           + P+GILLAL R S +P +R A +  IE  RG+PL+++LF+ASIMLPLFLP+    DK +
Sbjct: 169 AFPVGILLALARRSTMPAVRIAAVVTIESVRGLPLLSILFVASIMLPLFLPEALLPDKFV 228

Query: 251 RALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGI 310
           RAL+ ++ FA+AY+AEV+RGGLQ+I +GQ+EAA +LGL + +    +I+PQ I+ VIP +
Sbjct: 229 RALVALTIFAAAYLAEVIRGGLQAIPRGQYEAAAALGLPFWRTQYRVILPQAIRVVIPAL 288

Query: 311 VNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSIS 370
            NT I + K++SL+ ++ +FDL+   +   ++  W S        +FIG +F+   FS +
Sbjct: 289 ANTIIVMIKNTSLVLVVGLFDLISSGKAALADPAWPSP--AAETFLFIGGIFFALSFSFA 346

Query: 371 LYSVFIEKT 379
            ++ F+E+ 
Sbjct: 347 RFADFLERR 355


>gi|163848773|ref|YP_001636817.1| polar amino acid ABC transporter inner membrane subunit
           [Chloroflexus aurantiacus J-10-fl]
 gi|222526723|ref|YP_002571194.1| polar amino acid ABC transporter inner membrane subunit
           [Chloroflexus sp. Y-400-fl]
 gi|163670062|gb|ABY36428.1| polar amino acid ABC transporter, inner membrane subunit
           [Chloroflexus aurantiacus J-10-fl]
 gi|222450602|gb|ACM54868.1| polar amino acid ABC transporter, inner membrane subunit
           [Chloroflexus sp. Y-400-fl]
          Length = 410

 Score =  199 bits (507), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 134/400 (33%), Positives = 207/400 (51%), Gaps = 33/400 (8%)

Query: 18  PSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTV 77
               P  Q G+I W+ KN F T  + ++T +++ +++ ++   + W+     W  +   +
Sbjct: 10  SRRAPRQQIGLIEWLRKNLFSTWYNAIITIVLLYIVVQAVTSFVSWMVTAPGWPAAFTNI 69

Query: 78  CTTVSQGGIQPDGWN----------------------------AACWAFIYDRYEQFIFG 109
              ++        W                              A    +   +  F F 
Sbjct: 70  KLLLTWTYPVDQLWRPQAAMALVLLLLGLSAGVWGGTVRMVAFGAAAISVGIGFAAFTFP 129

Query: 110 NYPMAQRWRPILVFLTGSILLTPM---LIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGL 166
           + P        L     + LL            R     I+ + L       +L GGLGL
Sbjct: 130 DLPDQTSLPGWLFMFLCAGLLVGSDQLARRLGKRLRWPLIIAWLLSYPAVILILRGGLGL 189

Query: 167 SIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLV 226
            IVET LWGGLL+TL+++  GI++S PLG+LLALGR S++PV+R  C+ +IEL RGVPLV
Sbjct: 190 PIVETKLWGGLLLTLLLAISGIVLSFPLGVLLALGRRSSLPVIRVFCVLYIELIRGVPLV 249

Query: 227 TVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSL 286
           TVLFM +++LPLF+P    +D L+RA++ V+ F++AY+AE +RGGLQSI KGQ EAA +L
Sbjct: 250 TVLFMGALLLPLFIPGGESIDALVRAIVAVTLFSAAYLAENVRGGLQSIPKGQIEAARAL 309

Query: 287 GLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWI 346
           GL+  Q   LI +PQ ++ V+P +V  FI LFKD+SL+ II + DLLG  +    +  W+
Sbjct: 310 GLNVFQTTLLITLPQALRAVVPVLVGQFIALFKDTSLVVIIGLVDLLGAAQNIVGQPQWL 369

Query: 347 SSVTPT--TGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
            +         + I  ++W+F F++S  S  IE  + +  
Sbjct: 370 GTPGGVWRETFLVIAAIYWVFSFTMSRISKRIEDQIARSR 409


>gi|288959840|ref|YP_003450180.1| general L-amino acid transport system permease protein
           [Azospirillum sp. B510]
 gi|288912148|dbj|BAI73636.1| general L-amino acid transport system permease protein
           [Azospirillum sp. B510]
          Length = 357

 Score =  199 bits (507), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 132/367 (35%), Positives = 199/367 (54%), Gaps = 15/367 (4%)

Query: 16  LQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNR 75
           LQ + P          +    FGTP +  +T   + LL +++P ++ W  LDAVW+G   
Sbjct: 6   LQSAPPASLPEPRWRRLWSGLFGTPLNAAVTLGCLALLGWTVPPLLRWTLLDAVWVGP-- 63

Query: 76  TVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLI 135
                      +      ACWAFI ++    +FG Y + ++WRP         L     +
Sbjct: 64  ---------ADRCADAAGACWAFIGEKLRYILFGFYDLDRQWRPAAAGAILLALAGVSGM 114

Query: 136 PSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
           P F R+    + LFGL           G     V T  W GL V+L+++  G++ + PL 
Sbjct: 115 PLFWRRATLGLWLFGLAAALLLLTGGPGGP--AVPTERWSGLPVSLLLAVVGLVGAFPLA 172

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           +LLAL R S +  +R   + FIE+ RGVPL+ VL++A+++LPL LP    +DKLLRA + 
Sbjct: 173 VLLALARRSAMGGVRTLAVLFIEVTRGVPLIAVLYVATLLLPLMLPAGAAIDKLLRAQIA 232

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           +  F SAY+AE++R GLQSI  GQ+EAA +LGL Y Q MRL+I+PQ ++ VIP IV   I
Sbjct: 233 IILFVSAYLAEIIRAGLQSIPAGQYEAAQALGLGYWQSMRLVILPQALRTVIPSIVTLAI 292

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
           GLF+D++LI +I +FDLL   R    +  W+          F+  ++   C + S YS++
Sbjct: 293 GLFQDTTLIIVIGLFDLLNTARTAAKDPAWLGFYD--EAFGFVALIYLTVCVAASRYSLW 350

Query: 376 IEKTLHK 382
           +E+ L +
Sbjct: 351 LERRLQR 357


>gi|148658093|ref|YP_001278298.1| polar amino acid ABC transporter inner membrane subunit
           [Roseiflexus sp. RS-1]
 gi|148570203|gb|ABQ92348.1| polar amino acid ABC transporter, inner membrane subunit
           [Roseiflexus sp. RS-1]
          Length = 403

 Score =  199 bits (506), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 140/395 (35%), Positives = 212/395 (53%), Gaps = 29/395 (7%)

Query: 16  LQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNR 75
            +   PP  +  I+ W+HKN F T  + LLT +++ L    + G++ W F  A W     
Sbjct: 12  AEALPPPTERSSIVRWLHKNLFSTWYNALLTVVMLFLAALIVRGVLEWAFTQARWEVITA 71

Query: 76  TV-CTTVSQGGIQPDGWNAACWAFIYDRYEQ--------------------FIFGNYPMA 114
            +    V Q  +       AC A +                          FI       
Sbjct: 72  NLRLFMVGQYPVAALWRIWACVALLALLIGMSWSIWGGAQRGGAIAFGALPFILAIITSD 131

Query: 115 QRWRPILVF--LTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLG---LSIV 169
           +  R  L+   + G +        S   + ++ +     FPI    V   G     +  V
Sbjct: 132 ETARLALLITGIAGVVGYALSWRWSAALRRISIVGWILYFPILFVLVSGVGADDSPIPPV 191

Query: 170 ETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVL 229
            T+LWGGLL+TL++S  GI+ S PLG+LLALGR S++PV+R+ C+ +IEL RGVP ++VL
Sbjct: 192 PTNLWGGLLLTLLLSVVGIVFSFPLGVLLALGRQSSLPVVRWLCVAYIELIRGVPFISVL 251

Query: 230 FMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLS 289
           FMA +MLPLFLP    +D+++RA+ GV  F++AY+AE +RGGLQSI +GQ+EAA +LGL+
Sbjct: 252 FMAQLMLPLFLP-GITIDRVVRAMAGVVIFSAAYLAENVRGGLQSIPRGQYEAARALGLN 310

Query: 290 YLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSV 349
             +   LII+PQ ++ VIP +V  FI LFKD+SL+ I+ + DL+GI R   ++  ++   
Sbjct: 311 PWKMTLLIILPQALRAVIPILVGQFIALFKDTSLVVIVGLLDLMGIARTVLAQPDFLGLQ 370

Query: 350 TPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
                  F+ F++ IFC+ +S +S  +E  LH G 
Sbjct: 371 A--EVYTFVAFIYGIFCYLMSAFSQRLEAKLHTGR 403


>gi|218248365|ref|YP_002373736.1| polar amino acid ABC transporter inner membrane subunit [Cyanothece
           sp. PCC 8801]
 gi|218168843|gb|ACK67580.1| polar amino acid ABC transporter, inner membrane subunit
           [Cyanothece sp. PCC 8801]
          Length = 401

 Score =  199 bits (506), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 128/392 (32%), Positives = 198/392 (50%), Gaps = 33/392 (8%)

Query: 21  PPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTT 80
           PPV +   + WI KN F T  +  LT + +  L +    +I W F  A W      +   
Sbjct: 12  PPVDKINPLNWIQKNLFSTWYNSCLTIVSLLFLYWIGSILISWTFTQAQWAVIESNLSLF 71

Query: 81  VSQGGIQPDGWNAACWAFIYDRYEQFIFG----------NYPMAQRWRPILVFLTGSILL 130
                     W A     I        +G             +       ++F   +I +
Sbjct: 72  FVGRYPTNLLWRAWLSLAIIVSLSGLSWGILARNLRLFNRVNLTLLTSLGVIFALLAIPI 131

Query: 131 T-----------------PMLIPSFPRKFLNSILLFGLFPIFSFFVLYG----GLGLSIV 169
           +                   +     ++        GL  + +FFVL      GL L  V
Sbjct: 132 SIQSSLLLLGMLILLVFNAWVGQKLGQRIQGLGNWLGLCWLITFFVLLWLLQGGLFLETV 191

Query: 170 ETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVL 229
           +   + GL++TL+ +   I++S P GILLALGR S++ V+R+  I +IE+ RG+PL+ +L
Sbjct: 192 KLDNFSGLILTLLTAIVSIVLSFPFGILLALGRQSSLNVIRWLSIAYIEVIRGLPLIGIL 251

Query: 230 FMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLS 289
           FMA IMLPL LP     D+++RA+ G + F++AY+AE +RGGLQS+ KGQ EAA +LGL+
Sbjct: 252 FMAQIMLPLILPVGSRPDRVIRAIAGFTLFSAAYLAENVRGGLQSVPKGQIEAAKALGLN 311

Query: 290 YLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSV 349
            +  +  I++PQ +K VIP IV  FI LFKD+SL++I+ + DLLGI +   +   +I   
Sbjct: 312 PIFVLIFIVLPQALKAVIPSIVGQFISLFKDTSLLAIVGLVDLLGISQSILANPKFIGRY 371

Query: 350 TPTTGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
                 +FI  ++WIFC+S+S  S  +E+ L+
Sbjct: 372 G--EVYLFIAVIYWIFCYSMSWASRKLEQKLN 401


>gi|330899536|gb|EGH30955.1| amino acid ABC transporter permease [Pseudomonas syringae pv.
           japonica str. M301072PT]
          Length = 283

 Score =  199 bits (505), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 134/291 (46%), Positives = 185/291 (63%), Gaps = 12/291 (4%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
                   PP    G +AW+ +N F +  + LLT   + L+   +P II W  LDA WIG
Sbjct: 4   HTFKPDMPPPGKVFGPVAWMRQNLFSSWINTLLTLFSLYLIYLVVPPIISWSLLDANWIG 63

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
           + +  CT              ACW FI  R+ QF++G +P   RWR  L  +   +   P
Sbjct: 64  TTKADCTKA-----------GACWVFIEQRFGQFMYGYFPNELRWRVDLTAILAIVGAAP 112

Query: 133 MLIPSFPRKFLNSILLFGLFPIFSF-FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIIS 191
           + I  FPRK +  I    ++P+ +F  +  G  GL+ V TS WGGL++TLVI+  GI+ +
Sbjct: 113 LFISKFPRKAVYGITFLVIYPVVAFYLLHGGAFGLTNVPTSQWGGLMLTLVIATVGIVGA 172

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +PLGILLALGR SN+P +R  C+TFIE +RGVPL+TVLFM+S+MLPLF+P+  + DKLLR
Sbjct: 173 LPLGILLALGRRSNMPAVRVVCVTFIEFWRGVPLITVLFMSSVMLPLFMPEGMNFDKLLR 232

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQV 302
           AL+GV  F SAYIAEV+RGG+Q+I KGQ+EAA+++GL Y + M L+I+PQ 
Sbjct: 233 ALIGVILFQSAYIAEVVRGGMQAIPKGQYEAASAMGLGYWRSMGLVILPQA 283


>gi|319940742|ref|ZP_08015083.1| polar amino acid ABC transporter [Sutterella wadsworthensis
           3_1_45B]
 gi|319805802|gb|EFW02576.1| polar amino acid ABC transporter [Sutterella wadsworthensis
           3_1_45B]
          Length = 366

 Score =  198 bits (503), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 121/358 (33%), Positives = 199/358 (55%), Gaps = 16/358 (4%)

Query: 32  IHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGW 91
           + +N F +P   +L+ ++  ++L  +  +  W  ++AVW   N   C             
Sbjct: 17  LRENCFYSPAASVLSVVLGLIILAVVGYVFDWGIVNAVWD-PNPAACREA---------- 65

Query: 92  NAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRK---FLNSILL 148
           + ACW F+ +++   IFG +P   +WRP L  L    +L    IP+   +    +     
Sbjct: 66  SGACWGFVAEKWRLIIFGRFPYELQWRPGLATLIIVGMLVVSAIPACWTRQGVRMLLWGW 125

Query: 149 FGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPV 208
              F  F   +L G   L  + T +WGGL +T++I+ FG+  S PLGILLA+GR S +P+
Sbjct: 126 VAAFFAFFILMLGGVFNLEPIGTDMWGGLPLTVIITLFGMAASSPLGILLAIGRRSRMPI 185

Query: 209 LRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVL 268
           +      +IEL RGVPL+TVLF+A+ + PL LP+    D   R  +G++ F +AY+AE +
Sbjct: 186 VSALSTGYIELVRGVPLITVLFVATFVFPLLLPEWLQCDAFWRVAIGIALFQAAYMAETV 245

Query: 269 RGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIIN 328
           RGGLQ+IS+GQ+ AA SLG +  Q  + +I+PQ +  +IP  VN+ +  F D+SL+++++
Sbjct: 246 RGGLQTISQGQYAAARSLGFTERQCYQYVILPQALVAIIPAFVNSLLSCFMDTSLVTVVS 305

Query: 329 MFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
           M+DL G +++   ++ W +      G +FI  V++I  F IS YS ++E  L     +
Sbjct: 306 MYDLTGSLKLALGDAVWRAYF--IEGYVFIALVYFISSFIISRYSQWLELRLKGAKAR 361


>gi|103487894|ref|YP_617455.1| amino acid ABC transporter permease [Sphingopyxis alaskensis
           RB2256]
 gi|98977971|gb|ABF54122.1| Amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine [Sphingopyxis alaskensis RB2256]
          Length = 730

 Score =  198 bits (503), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 119/369 (32%), Positives = 190/369 (51%), Gaps = 15/369 (4%)

Query: 14  RLLQPSLPPVYQRGII-AWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
           +       P+       +W+ +N F   +  +LT  I+ +    +   + W+  +A + G
Sbjct: 373 QSAPLEPFPLRSAAAWPSWMRRNLFRGGRQSILTIAILAMTAAFVGKGLSWLLFEATFAG 432

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
                      G       + ACW F+ +     +FG YP A++WR           L  
Sbjct: 433 -----------GAADCRLASGACWPFLRENARLILFGTYPEAEQWRSAAAATALLSCLAF 481

Query: 133 MLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISM 192
             +P F R     +   G   +    +  G  GLS V    W GL VTL+++   ++ + 
Sbjct: 482 SFVPRFWRSR-LGLAWLGAIAVAVLLLRGGFAGLSYVPMEKWSGLPVTLLLASLAVVGAF 540

Query: 193 PLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRA 252
           PL ILLA GR S    +R+  + FIEL RG PL+ VLF+A+++ PLF+P    +D L R 
Sbjct: 541 PLAILLAFGRRSTRRGIRWPSVVFIELVRGTPLIGVLFLAAVLFPLFVPSYLSIDSLPRV 600

Query: 253 LLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVN 312
            L +  F +AY+AEV+RGGL ++  GQ EAA++LGL+  Q  R I++PQ +K  +PG+VN
Sbjct: 601 QLALIFFTAAYMAEVIRGGLLAVPVGQAEAAHALGLTKWQARRHILLPQALKVSVPGLVN 660

Query: 313 TFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLY 372
           T I   K+++L+ I+ +FDLL   R+++ E+ W          +F G +F++ CFS+S  
Sbjct: 661 TSISEVKNTTLVLIVGVFDLLQTTRLSYVEAQWRPYFA--EAYLFTGTIFFLLCFSLSRL 718

Query: 373 SVFIEKTLH 381
           S+ IE+ L 
Sbjct: 719 SMKIERKLD 727



 Score = 70.2 bits (170), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 44/196 (22%), Positives = 80/196 (40%), Gaps = 7/196 (3%)

Query: 188 IIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDT--WD 245
            ++ + +     L        +R            VPL+    +       F        
Sbjct: 171 PVLLIAIVACAILLGAVRRGAVRTRTALAFAGISLVPLLLWGGIDLPRAGRFGTVGGLSF 230

Query: 246 VDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKR 305
             + L  +  +S +ASAY+AE+ RG + ++  GQ EAA +LGLS  Q M  I++PQ ++ 
Sbjct: 231 STEFLTLVTSLSVYASAYLAEIFRGAILAVPAGQSEAAKALGLSPAQTMGRIVIPQALRI 290

Query: 306 VIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIF 365
            IP + +  +   K+SSL   I   + + +V    S++          G+  I   F + 
Sbjct: 291 AIPPMTSWHLNTIKNSSLGVAIGYPEFVSVVDTVISQT-----GQAIEGVGLIVATFLLL 345

Query: 366 CFSISLYSVFIEKTLH 381
             S++  +    + L 
Sbjct: 346 SLSLAFVTGRYARRLG 361


>gi|257060311|ref|YP_003138199.1| polar amino acid ABC transporter inner membrane subunit [Cyanothece
           sp. PCC 8802]
 gi|256590477|gb|ACV01364.1| polar amino acid ABC transporter, inner membrane subunit
           [Cyanothece sp. PCC 8802]
          Length = 401

 Score =  198 bits (502), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 127/392 (32%), Positives = 198/392 (50%), Gaps = 33/392 (8%)

Query: 21  PPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTT 80
           PPV +   + WI KN F T  +  LT + +  L +    +I W F  A W      +   
Sbjct: 12  PPVDKINPLNWIQKNLFSTWYNSCLTIVSLLFLYWIGSILISWTFTQAQWAVIESNLSLF 71

Query: 81  VSQGGIQPDGWNAACWAFIYDRYEQFIFG----------NYPMAQRWRPILVFLTGSILL 130
                     W A     I        +G             +       ++F   +I +
Sbjct: 72  FVGRYPTNLLWRAWLSLAIIVSLSGLSWGILARNLRLFNRVNLTLLTSLGVIFALLAIPI 131

Query: 131 T-----------------PMLIPSFPRKFLNSILLFGLFPIFSFFVLYG----GLGLSIV 169
           +                   +     ++        GL  + +FFVL      GL L  V
Sbjct: 132 SIQSSLLLLGMLILLVFNAWVGQKLGQRIQGLGNWLGLCWLITFFVLLWLLQGGLFLETV 191

Query: 170 ETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVL 229
           +   + GL++TL+ +   I++S P GILLALGR S++ V+R+  I +IE+ RG+PL+ +L
Sbjct: 192 KLDNFSGLILTLLTAIVSIVLSFPFGILLALGRQSSLNVIRWLSIAYIEVIRGLPLIGIL 251

Query: 230 FMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLS 289
           FMA IMLPL LP     ++++RA+ G + F++AY+AE +RGGLQS+ KGQ EAA +LGL+
Sbjct: 252 FMAQIMLPLILPVGSRPERVIRAIAGFTLFSAAYLAENVRGGLQSVPKGQIEAAKALGLN 311

Query: 290 YLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSV 349
            +  +  I++PQ +K VIP IV  FI LFKD+SL++I+ + DLLGI +   +   +I   
Sbjct: 312 PIFVLIFIVLPQALKAVIPSIVGQFISLFKDTSLLAIVGLVDLLGISQSILANPKFIGRY 371

Query: 350 TPTTGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
                 +FI  ++WIFC+S+S  S  +E+ L+
Sbjct: 372 G--EVYLFIAVIYWIFCYSMSWASRKLEQKLN 401


>gi|158334197|ref|YP_001515369.1| polar amino acid ABC transporter, permease protein [Acaryochloris
           marina MBIC11017]
 gi|158304438|gb|ABW26055.1| polar amino acid ABC transporter, permease protein [Acaryochloris
           marina MBIC11017]
          Length = 397

 Score =  197 bits (501), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 126/397 (31%), Positives = 202/397 (50%), Gaps = 32/397 (8%)

Query: 15  LLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSN 74
           +   S  P+    ++ W+ +N F T  + LLT + + ++     G+  W+F  A W    
Sbjct: 1   MPPKSPTPLSTSSLLIWLRRNLFSTWYNGLLTVISLWIIYLGGRGLFRWMFSQAQWTVLQ 60

Query: 75  RTVCTTVSQGGIQPDGWNAACW---------------------AFIYDRYEQFIFGNYPM 113
             +             W                                      G  P+
Sbjct: 61  ANLRLFFVGRFPIDQIWRVWLILVLVSAVTSLTIGVVQWNRILPISMGLLTAISLGIVPL 120

Query: 114 AQRWRPILVFLTGSILLTPMLIPSFPRKFLNSIL---------LFGLFPIFSFFVLYGGL 164
                P LV++     +  + +   P    +            ++ L      ++L GGL
Sbjct: 121 VGGQGPELVWVAAIGSVAVLNLLGGPWLKTHLSPRLLSRGLPAVWFLTAFIILWLLMGGL 180

Query: 165 GLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVP 224
           G+S + T++W G L+T+V +   I +S PLG+LLALGR S +PV+R   + +IE+ RG+P
Sbjct: 181 GISTIGTNVWQGFLLTVVAAVVSIALSFPLGVLLALGRRSPLPVIRTLSVLYIEVIRGLP 240

Query: 225 LVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAAN 284
           L+ VLF+A +MLPL LP    +D + RA+ G++ F++AY+AE +RGGLQSI +GQFEAA 
Sbjct: 241 LIGVLFVAGVMLPLILPSQVQLDAVFRAICGLTLFSAAYLAENVRGGLQSIPQGQFEAAK 300

Query: 285 SLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSEST 344
           +LGL+ +  + L+++PQ ++ VIP IV  FIGLFKD+SL+SII + +L G+ R   S+  
Sbjct: 301 ALGLNPMLVLGLVVLPQALRSVIPAIVGQFIGLFKDTSLLSIIGLVELTGVSRSVLSQPR 360

Query: 345 WISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
           +I         +FIG ++W+FC+ +SL S  +E  L 
Sbjct: 361 FIGRHG--EVYLFIGLLYWLFCYLMSLGSRRLEHQLG 395


>gi|303256339|ref|ZP_07342355.1| general amino acid ABC transporter, permease protein
           [Burkholderiales bacterium 1_1_47]
 gi|330999034|ref|ZP_08322759.1| general L-amino acid transport system permease protein AapM
           [Parasutterella excrementihominis YIT 11859]
 gi|302861068|gb|EFL84143.1| general amino acid ABC transporter, permease protein
           [Burkholderiales bacterium 1_1_47]
 gi|329575776|gb|EGG57302.1| general L-amino acid transport system permease protein AapM
           [Parasutterella excrementihominis YIT 11859]
          Length = 366

 Score =  197 bits (501), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 119/356 (33%), Positives = 195/356 (54%), Gaps = 15/356 (4%)

Query: 32  IHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGW 91
           + ++FF +P   ++T  +  L+  +      W   DA++                  +  
Sbjct: 12  LWRSFFYSPVASVVTIGLFLLIGAAGWYAWKWGVADAIFRAD----------FKACMNNH 61

Query: 92  NAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRK---FLNSILL 148
           + ACW F+ +++   +FG +P  ++WR         ++L     P    +    + +   
Sbjct: 62  DGACWGFVAEKWRLILFGRFPYDEQWRAAAATGGVILMLVISAFPQLWNRTGCKILTAGW 121

Query: 149 FGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPV 208
                 F   +L G  GLS ++   WGGL +T++++ FG+  S PLGILLALGR S +  
Sbjct: 122 ILALGAFFVLMLGGCFGLSKIDPDYWGGLPLTIILTLFGMTASTPLGILLALGRRSKMSA 181

Query: 209 LRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVL 268
           +R  CI +IEL RGVPL+TVLF+AS + PL LP  + +D   R ++G+  F +AY+AE +
Sbjct: 182 IRMLCIGYIELVRGVPLITVLFVASFIFPLILPPGFRIDAFWRIVIGIVLFQTAYMAETI 241

Query: 269 RGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIIN 328
           RGGLQ+I KGQ+EAA SLGLS  Q    +I+PQ +  VIP  VN  +  F D+SL++I++
Sbjct: 242 RGGLQTIPKGQYEAAASLGLSKYQIYTSVILPQALVTVIPAFVNNLLSTFMDTSLVTIVS 301

Query: 329 MFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
           M+DL G +R+   +  W +      G +FI  ++++F   +S YS+++EK + +  
Sbjct: 302 MYDLTGSLRLALGDPNWRNFF--LEGYLFIAIIYFVFSLIMSRYSIWLEKRIQRSK 355


>gi|239815920|ref|YP_002944830.1| polar amino acid ABC transporter inner membrane subunit [Variovorax
           paradoxus S110]
 gi|239802497|gb|ACS19564.1| polar amino acid ABC transporter, inner membrane subunit
           [Variovorax paradoxus S110]
          Length = 352

 Score =  196 bits (499), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 123/361 (34%), Positives = 201/361 (55%), Gaps = 13/361 (3%)

Query: 25  QRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQG 84
            +G IAW     +G+P   L T L++ LL +     + W  L AV+   +   C  V   
Sbjct: 5   AQGPIAW-RSELWGSPPRALATVLLLALLAWGGYHAVEWGVLHAVFR-PDAEACRAVQ-- 60

Query: 85  GIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLN 144
                  + ACW  + +++   +FG +P  ++WRP +     S +      P   R +L 
Sbjct: 61  -------HGACWGVVAEKWRPMLFGRFPYEEQWRPAIAVAVLSAVTVMSAWPRSWRWWLA 113

Query: 145 SILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNS 204
            + +  L       +  G  GL+ V TS WGGL +T+ ++  G+ ++ PL +LLALGR S
Sbjct: 114 LLWVVALVLFVL-LMRGGVAGLAPVPTSRWGGLPLTIGLAVVGLALAFPLALLLALGRRS 172

Query: 205 NIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYI 264
             PV+R    ++IEL RGVPL++VLFMAS +LPL  P  W  D L+R L G++ F +AY+
Sbjct: 173 GWPVVRTLSASYIELVRGVPLISVLFMASFLLPLLWPAGWQPDVLVRVLAGLTLFVAAYL 232

Query: 265 AEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLI 324
           AE++RGGLQ++ +GQ E A +LG       R I++PQ ++ V+P + N+ +G  KD+SL+
Sbjct: 233 AEIIRGGLQAVPRGQTEVAMALGFGRWPVQRDIVLPQALRLVVPALTNSVVGTLKDTSLV 292

Query: 325 SIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
           +++ +F+L G + +               G +F+  V+W+ CF +S YSV++E+ L +G+
Sbjct: 293 TVVGLFELTGALGLALGGDPTWRPFY-LEGYLFVAAVYWVLCFGLSRYSVWLERRLGEGA 351

Query: 385 K 385
           +
Sbjct: 352 R 352


>gi|300865206|ref|ZP_07110024.1| polar amino acid ABC transporter, inner membrane subunit
           [Oscillatoria sp. PCC 6506]
 gi|300336797|emb|CBN55174.1| polar amino acid ABC transporter, inner membrane subunit
           [Oscillatoria sp. PCC 6506]
          Length = 398

 Score =  196 bits (498), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 132/398 (33%), Positives = 206/398 (51%), Gaps = 32/398 (8%)

Query: 17  QPSLPPVYQR-GIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNR 75
            P LPPV +      W  KN F +  + LLT + + ++   + G   WV   A W     
Sbjct: 4   APLLPPVSESPTPWNWARKNLFSSWYNSLLTVICLTIIFQFLKGFAIWVTTKAQWRVIEA 63

Query: 76  TVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYP-MAQRWRPILVFLTGSILLTPML 134
            +    +    +   W       I        +GN+      W   L+ + G+ +   +L
Sbjct: 64  NLPLFFAGRFPRELHWRLWIIVGIITLLGGLTWGNFNRQVSLWNHPLLIVLGASITAALL 123

Query: 135 IP--------------------------SFPRKFLNSILLFGLFPIFSFFVLYGGLGLSI 168
            P                          +        +     FP+  + +  GGLGL  
Sbjct: 124 FPTDLTSRLWLLGNIIIAAASYSFGRQINPQVMRWLPLSWVFSFPVILWLI-KGGLGLKE 182

Query: 169 VETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTV 228
           V T+ WGGL++TL  +   I +S PLG+LLALGR S++PV++Y  I +IE+ RG+PL+ +
Sbjct: 183 VPTNDWGGLMLTLFAAVVSIALSFPLGVLLALGRQSSLPVVKYFSILYIEIVRGLPLIGI 242

Query: 229 LFMASIMLPLFLPDTWD-VDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLG 287
           LF+  +ML  FLP     +D+L+RA+  ++ F++AY+AE +RGGLQS+ +GQ EAA SLG
Sbjct: 243 LFLGQVMLQFFLPPGAPKLDRLVRAIAALTLFSAAYLAENVRGGLQSVPRGQIEAARSLG 302

Query: 288 LSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWIS 347
           L+    + LI++PQ ++ VIP IV  FIGLFKD+SL+S+  + +L+GI R   +   +  
Sbjct: 303 LNTPLVILLIVLPQALRAVIPAIVGQFIGLFKDTSLLSLFGILELVGISRTVLANPAYSG 362

Query: 348 SVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSK 385
                   +FIG ++W+FC+S+SL S  +E+TL  G K
Sbjct: 363 RYA--EVYVFIGVIYWVFCYSMSLASRKLEQTLGVGQK 398


>gi|298491369|ref|YP_003721546.1| polar amino acid ABC transporter inner membrane subunit ['Nostoc
           azollae' 0708]
 gi|298233287|gb|ADI64423.1| polar amino acid ABC transporter, inner membrane subunit ['Nostoc
           azollae' 0708]
          Length = 340

 Score =  196 bits (498), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 123/364 (33%), Positives = 197/364 (54%), Gaps = 39/364 (10%)

Query: 29  IAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQP 88
           + W+ KN F T  + LLT + +  L + + G + W F  A W                  
Sbjct: 4   VTWLRKNLFSTWYNTLLTIICLYFLFWIVKGCLLWAFDQAQW------------------ 45

Query: 89  DGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILL 148
                     I      F+ G +  +  WR  +V    +IL    L     +  +     
Sbjct: 46  --------QVIPVNLHLFLVGRFLQSLYWRIWIVLGIITILTLITLSLFTKKSNIIKRRF 97

Query: 149 -----------FGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGIL 197
                      + L    + +++ GG GL  V T+LW GLL+TL+++   I++S P+G++
Sbjct: 98  SQSITPWIAPTWLLSFPINIWLIGGGFGLQSVSTNLWNGLLLTLLMAIVSIVLSFPIGVI 157

Query: 198 LALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVS 257
           LALGR SN+ + R+  I +IE+ RG+P++ +LF+A +MLPLFLP    +D+L+R + G+ 
Sbjct: 158 LALGRTSNLFLTRWFSILYIEIVRGLPIIGILFIAQVMLPLFLPTELRLDRLIRGIAGLV 217

Query: 258 AFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGL 317
            F++AY+AE +RGGLQSI +GQ EA+ +LG +    + LII+PQ ++ VIP IV  FI L
Sbjct: 218 LFSAAYMAENVRGGLQSIPRGQTEASKALGFNTPLVVILIILPQALRAVIPAIVGQFISL 277

Query: 318 FKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIE 377
           FKD+SL+S++ + +L GI R   ++  ++         IFIG ++ +FC+S+SL S  +E
Sbjct: 278 FKDTSLLSLVGLVELTGIARSILAQPQFLGRYA--EVYIFIGLIYCLFCYSMSLASRKLE 335

Query: 378 KTLH 381
           K L 
Sbjct: 336 KQLG 339


>gi|159042876|ref|YP_001531670.1| glutamate/glutamine/aspartate/asparagine ABC transport system
           permease [Dinoroseobacter shibae DFL 12]
 gi|157910636|gb|ABV92069.1| glutamate/glutamine/aspartate/asparagine ABC transport system
           permease [Dinoroseobacter shibae DFL 12]
          Length = 432

 Score =  196 bits (497), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 148/441 (33%), Positives = 222/441 (50%), Gaps = 65/441 (14%)

Query: 1   MIDSCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGI 60
           M D+     +VR   + PS PPV + GI+ W+  N F +    +LT L    + +    +
Sbjct: 1   MSDTHASAAFVRTEEIPPSPPPVSEVGIVNWLRSNLFYSIPSSILTLLTAAFIYWLSSIL 60

Query: 61  IHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPI 120
           + W+F + VW  ++   C  +  G I        C+A I +R+ Q IFGNYP  + WR +
Sbjct: 61  MPWMF-NGVWDANSIRDCREILDGAI------GGCFAVIAERWPQLIFGNYPNEEYWRAV 113

Query: 121 LVFL---TGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGL----------- 166
           L F+        +    +P     F         + I+        + L           
Sbjct: 114 LAFVGLFVALAPVLFFKLPRKMLWFTGLFPFIAYWLIWGGSAWVSVMALVGVVVGYVAFK 173

Query: 167 -----------------------------------------SIVETSLWGGLLVTLVISF 185
                                                      VE+   GG ++  ++  
Sbjct: 174 ALEERSFFGAIVAALFATLLFWIFISPLAVNALSSVVALSLPQVESRFIGGFMINFILGT 233

Query: 186 FGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWD 245
            GI +S+PLGI LALGR SN+P+++  C+ FIE  RGVPL+T+LF+AS+ML  FLP    
Sbjct: 234 SGIALSLPLGIALALGRQSNLPIIKGVCVVFIEFIRGVPLITLLFVASVMLAYFLPPGTS 293

Query: 246 VDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKR 305
            D +LR ++ ++ FASAYIAE +RGGL ++ +GQ+EA +SLGL Y Q MRLII+PQ +K 
Sbjct: 294 FDLVLRVIIMITLFASAYIAEAIRGGLAALPRGQYEAGDSLGLDYWQSMRLIILPQALKI 353

Query: 306 VIPGIVNTFIGLFKDSSLISIINMFDLLGIVRV-NFSESTWISSVTPTTGLIFIGFVFWI 364
            IP IVN  IGLFKD++L+SII+MFD+LG+++    S + W         L F G +F++
Sbjct: 354 SIPSIVNIAIGLFKDTTLVSIISMFDMLGMIQGPILSSTEWFGVYW--ELLGFAGVLFFV 411

Query: 365 FCFSISLYSVFIEKTLHKGSK 385
           FC+ IS YS ++E+ L    +
Sbjct: 412 FCYGISQYSQWLERQLATEHR 432


>gi|284052501|ref|ZP_06382711.1| polar amino acid ABC transporter, inner membrane subunit
           [Arthrospira platensis str. Paraca]
          Length = 405

 Score =  196 bits (497), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 134/397 (33%), Positives = 211/397 (53%), Gaps = 32/397 (8%)

Query: 19  SLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVC 78
              P   R    W+  N F T  + L T  I   LL+ + G + W  + A W      + 
Sbjct: 11  RQAPSQSRDFPQWLRDNLFNTWYNGLFTMAIASFLLWMLVGFVSWARVTAQWEVIPANLH 70

Query: 79  TTVSQGGIQPDGW------------NAACWAFIYDRYEQFIFGN---------YPMAQRW 117
             +         W            +   W F+  R       N           MA   
Sbjct: 71  LFMVGRFPSDQYWRLWLLLGIVSILSGLTWGFLARRQTILFSQNIVISLSVVAMLMALVP 130

Query: 118 RPILVFLTGSILLTPMLIPSFPRKF---------LNSILLFGLFPIFSFFVLYGGLGLSI 168
            PI   +    LL  +++ S+  +                + +  I S +++ GGLGL  
Sbjct: 131 TPIPYRIMAIALLFILVVSSWGGRKIASRKPQLGKWLPFSWFMLLIISLWLIGGGLGLRG 190

Query: 169 VETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTV 228
           V T LWGGL++TL++S   I++  PLG+LLALGR S++PV+R   I +IE+ RG+PL+T+
Sbjct: 191 VSTDLWGGLMLTLLMSVISILLCFPLGVLLALGRQSDLPVIRGLSIAYIEVIRGLPLITI 250

Query: 229 LFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGL 288
           LFM  I+LPLFLP+    D++LRA++G++ F+SAY+AE +RGGLQ+I +GQ+EAA +LG+
Sbjct: 251 LFMGQILLPLFLPEGMRPDRILRAIVGLTMFSSAYLAENVRGGLQAIPRGQYEAAKALGI 310

Query: 289 SYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISS 348
           +    M LII+PQ +K  IP IV  FI LF+D++L++I+ + +LLGI R   +   ++  
Sbjct: 311 NAPLTMALIILPQALKISIPSIVGQFISLFQDTTLLAIVGLVELLGISRSILANPRFLGR 370

Query: 349 VTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSK 385
                  +F+G ++W+FC+ +SL S  +EK L+  ++
Sbjct: 371 YA--EVYLFVGILYWLFCYLMSLASRKLEKQLNTENR 405


>gi|209528046|ref|ZP_03276526.1| polar amino acid ABC transporter, inner membrane subunit
           [Arthrospira maxima CS-328]
 gi|209491532|gb|EDZ91907.1| polar amino acid ABC transporter, inner membrane subunit
           [Arthrospira maxima CS-328]
          Length = 405

 Score =  195 bits (496), Expect = 9e-48,   Method: Composition-based stats.
 Identities = 133/402 (33%), Positives = 208/402 (51%), Gaps = 32/402 (7%)

Query: 14  RLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGS 73
                   P        W+  N F T  + L+T  I   LL+ + G + W  L A W   
Sbjct: 6   EPTLNRQAPSQSTDFPQWLRDNLFNTWYNGLVTIAIASFLLWMLVGFVSWARLVAQWEVI 65

Query: 74  NRTVCTTVSQGGIQPDGW------------NAACWAFIYDRYEQFIFGN---------YP 112
              +   +         W            +   W F+  R       N           
Sbjct: 66  PANLHLFMVGRFPSDQYWRLWLLLGIVSILSGLTWGFLARRQTILFSQNIVIFLSVVAML 125

Query: 113 MAQRWRPILVFLTGSILLTPMLIPSFPRKF---------LNSILLFGLFPIFSFFVLYGG 163
           MA     I   +    LL   +  S+  +                + +  I S +++ GG
Sbjct: 126 MALLPTAISYRIIAIALLFVFVFSSWGGRQIGSRKPLLGKWLPFSWFVLLIISLWLIGGG 185

Query: 164 LGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGV 223
           LGL  V T LWGGL++TL++S   I++  P+G+LLALGR S++PV+R   I +IE+ RG+
Sbjct: 186 LGLRGVSTDLWGGLMLTLLMSVISILLCFPIGVLLALGRQSDLPVIRGLSIAYIEIIRGL 245

Query: 224 PLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAA 283
           PL+T+LFM  I+LPLFLP+    D++LRA++G++ F+SAY+AE +RGGLQ+I +GQ+EAA
Sbjct: 246 PLITILFMGQILLPLFLPEGMRPDRILRAIVGLTMFSSAYLAENVRGGLQAIPRGQYEAA 305

Query: 284 NSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSES 343
            +LGL+    M LII+PQ +K  IP IV  FI LF+D++L++I+ + +LLGI R   +  
Sbjct: 306 KALGLNPALTMVLIILPQALKISIPSIVGQFISLFQDTTLLAIVGLVELLGISRSILANP 365

Query: 344 TWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSK 385
            ++         +F+G ++W+FC+ +SL S  +EK L+  ++
Sbjct: 366 QFLGRYA--EVYLFLGVLYWLFCYLMSLASRKLEKQLNTENR 405


>gi|291569088|dbj|BAI91360.1| putative ABC transporter permease protein [Arthrospira platensis
           NIES-39]
          Length = 405

 Score =  195 bits (495), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 134/397 (33%), Positives = 211/397 (53%), Gaps = 32/397 (8%)

Query: 19  SLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVC 78
              P   R    W+  N F T  + L T  I   LL+ + G + W  + A W      + 
Sbjct: 11  RQAPSQSRDFPQWLRDNLFNTWYNGLFTMAIASFLLWMLIGFVSWARVTAKWEVIPANLH 70

Query: 79  TTVSQGGIQPDGW------------NAACWAFIYDRYEQFIFGN---------YPMAQRW 117
             +         W            +   W F+  R       N           MA   
Sbjct: 71  LFMVGRFPSDQYWRLWLLLGIVSILSGLTWGFLARRQTILFSQNIVISLSVVAMLMALVP 130

Query: 118 RPILVFLTGSILLTPMLIPSFPRKF---------LNSILLFGLFPIFSFFVLYGGLGLSI 168
            PI   +    LL  +++ S+  +                + +  I S +++ GGLGL  
Sbjct: 131 TPIPYRIMAIALLFILVVSSWGGRKIASRKPQLGKWLPFSWFMLLIISLWLIGGGLGLRG 190

Query: 169 VETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTV 228
           V T LWGGL++TL++S   I++  PLG+LLALGR S++PV+R   I +IE+ RG+PL+T+
Sbjct: 191 VSTDLWGGLMLTLLMSVISILLCFPLGVLLALGRQSDLPVIRGLSIAYIEVIRGLPLITI 250

Query: 229 LFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGL 288
           LFM  I+LPLFLP+    D++LRA++G++ F+SAY+AE +RGGLQ+I +GQ+EAA +LG+
Sbjct: 251 LFMGQILLPLFLPEGMRPDRILRAIVGLTMFSSAYLAENVRGGLQAIPRGQYEAAKALGI 310

Query: 289 SYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISS 348
           +    M LII+PQ +K  IP IV  FI LF+D++L++I+ + +LLGI R   +   ++  
Sbjct: 311 NAPLTMALIILPQALKISIPSIVGQFISLFQDTTLLAIVGLVELLGISRSILANPRFLGR 370

Query: 349 VTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSK 385
                  +F+G ++W+FC+ +SL S  +EK L+  ++
Sbjct: 371 YA--EVYLFVGILYWLFCYLMSLASRKLEKQLNTENR 405


>gi|67923501|ref|ZP_00516976.1| Amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine [Crocosphaera watsonii WH 8501]
 gi|67854643|gb|EAM49927.1| Amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine [Crocosphaera watsonii WH 8501]
          Length = 391

 Score =  195 bits (495), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 119/383 (31%), Positives = 190/383 (49%), Gaps = 33/383 (8%)

Query: 28  IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG---SNRTVCTTVSQG 84
            I WI KN F    + LLT + +  + +   G+I W    A W     + R         
Sbjct: 11  PINWIKKNLFSNWFNSLLTLVSLSFIFWVGSGLISWAIFQAQWGVIGDNLRLFFVGQYPV 70

Query: 85  GIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP-------- 136
            +    W +    F    +       Y    +   + +  + ++ +T + IP        
Sbjct: 71  SLLWRAWTSLAIIFSLIGFSWGTIKYYSNLFKPINLFILGSITVFITLLSIPVSLVSSAK 130

Query: 137 --------------------SFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGG 176
                                 P       L++ L       +L G   L  V    + G
Sbjct: 131 LLGILLLLVIFALIGQQTSKKLPTFSNWLSLIWVLTFFLLLGLLQGAFFLRPVRLDDFSG 190

Query: 177 LLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIML 236
           L++TL ++   II+S P G+LLALGR S +PV+R+  I +IEL RG+PL+ +LFMA +ML
Sbjct: 191 LILTLFVAIISIILSFPFGVLLALGRQSELPVIRWLSIAYIELIRGLPLIGILFMAQVML 250

Query: 237 PLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRL 296
           PL LP    + +++RA+ G + F++AY+AE +RGGLQS+ KGQ EAA +LGL+    +  
Sbjct: 251 PLILPQDMRIQRVIRAIAGFTLFSAAYLAENVRGGLQSVPKGQTEAAKALGLNGFFVLIF 310

Query: 297 IIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLI 356
           +++PQ ++ VIP IV  FI LFKD+SL++I+ + DLLG+ +   +   +I         I
Sbjct: 311 VVLPQALRVVIPAIVGQFISLFKDTSLLAIVGLVDLLGMSQSILANPKFIGRYG--EVYI 368

Query: 357 FIGFVFWIFCFSISLYSVFIEKT 379
           F+  ++W+FC+S+SL S  +E  
Sbjct: 369 FVAAIYWVFCYSMSLLSRQLENK 391


>gi|126464335|ref|YP_001045448.1| polar amino acid ABC transporter, inner membrane subunit
           [Rhodobacter sphaeroides ATCC 17029]
 gi|126106146|gb|ABN78676.1| polar amino acid ABC transporter, inner membrane subunit
           [Rhodobacter sphaeroides ATCC 17029]
          Length = 370

 Score =  195 bits (495), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 123/355 (34%), Positives = 188/355 (52%), Gaps = 12/355 (3%)

Query: 30  AWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPD 89
           AW+  N F +    LLT ++  +L+     ++ W  ++AV+  ++  VC           
Sbjct: 27  AWLRANLFSSVWQSLLTLVVAVVLIRFFWFVLDWGVVNAVFYTTDPDVCRAA-------- 78

Query: 90  GWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLF 149
               ACWA I +++   +FG YP  + WR +L+       +   L P          L  
Sbjct: 79  --TGACWAVIVEKHRPMLFGLYPYDEHWRLVLMMAVYLGTVVLSLWPRCWNLRFLVPLWI 136

Query: 150 GLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVL 209
                    +  G LGL  V TS WGGL +T+++    ++I MP+ +LLALGR + +PV 
Sbjct: 137 VSSLSIGILMFGGVLGLRYVPTSEWGGLPLTMLLFTGTVLIGMPVAVLLALGRRAPLPVA 196

Query: 210 RYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLR 269
           R   + FIE  RGVPL+T+LF+A  + PLFLP   +V+KLLR  +G++ F + Y AEV+R
Sbjct: 197 RGVSVVFIEALRGVPLITILFVAVNVFPLFLPAGVEVNKLLRITVGIAIFFACYQAEVIR 256

Query: 270 GGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINM 329
           GGLQ+I  GQ+EAA SL LSY Q  R II+PQ ++  +P I N  I   K++S + II +
Sbjct: 257 GGLQAIPTGQYEAAASLSLSYWQTTRRIILPQALRISLPAITNHIIAAMKNTSFVIIIGL 316

Query: 330 FDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
           FD+L        +  W          +F+  V+  F +++SLY+  +EK +  G 
Sbjct: 317 FDILTATTAVMQDPLWRKFY--IEAYLFVAAVYLFFGYALSLYARQVEKWIASGR 369


>gi|156741440|ref|YP_001431569.1| polar amino acid ABC transporter inner membrane subunit
           [Roseiflexus castenholzii DSM 13941]
 gi|156232768|gb|ABU57551.1| polar amino acid ABC transporter, inner membrane subunit
           [Roseiflexus castenholzii DSM 13941]
          Length = 403

 Score =  195 bits (495), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 138/395 (34%), Positives = 207/395 (52%), Gaps = 29/395 (7%)

Query: 16  LQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNR 75
            +   PP  +  ++ W+HKN F T  + LLT +++ L  F + GI+ W    A W   + 
Sbjct: 12  AEALPPPTERYSVVRWMHKNLFSTWYNTLLTIIMLALTAFLVRGILEWALTQARWEVISA 71

Query: 76  TVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLT---- 131
            +   +         W       +        +G +   QR   I       IL      
Sbjct: 72  NLRLFLVGQYPVTALWRIWACVALLAFLIGMSWGIWGRTQRGGAIAFGALPFILAITTSD 131

Query: 132 -------------------PMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLG---LSIV 169
                                   S   + ++ I     FPI    V   G     L  V
Sbjct: 132 ETSRVALLITGIAGVVGYTLSWRWSGALRRVSIIGWILYFPILFVLVSGFGAADSVLPPV 191

Query: 170 ETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVL 229
            T+LWGGLL+TL+++  GI++S PLG+LLALGR S +PV+ + C+ +IEL RGVP ++VL
Sbjct: 192 PTNLWGGLLLTLLLTVVGIVLSFPLGVLLALGRQSKLPVIHWLCVIYIELIRGVPFISVL 251

Query: 230 FMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLS 289
           FMA +MLPLFLP    +D+++RA+ GV  F++AY+AE +RGGLQSI +GQ+EAA +LGLS
Sbjct: 252 FMAQLMLPLFLP-GVTIDRVVRAMAGVIIFSAAYLAENVRGGLQSIPRGQYEAARALGLS 310

Query: 290 YLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSV 349
             +   LII+PQ ++ VIP +V  FI LFKD+SL+ I+ + DL+GI R   ++  ++   
Sbjct: 311 AWKMTLLIILPQALRAVIPILVGQFIALFKDTSLVVIVGLLDLMGIARTVLAQPDFLGLQ 370

Query: 350 TPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
                  F+ FV+ +FC+ +S +S  +E  LH G 
Sbjct: 371 A--EVYTFVAFVYGVFCYLMSAFSQRLEAQLHTGR 403


>gi|221370065|ref|YP_002521161.1| Polar amino acid ABC transporter, inner membrane subunit precursor
           [Rhodobacter sphaeroides KD131]
 gi|221163117|gb|ACM04088.1| Polar amino acid ABC transporter, inner membrane subunit precursor
           [Rhodobacter sphaeroides KD131]
          Length = 370

 Score =  194 bits (493), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 123/355 (34%), Positives = 188/355 (52%), Gaps = 12/355 (3%)

Query: 30  AWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPD 89
           AW+  N F +    LLT ++  +L+     ++ W  ++AV+  ++  VC           
Sbjct: 27  AWLRANLFSSVWQSLLTLVVAVVLIRFFWFVLDWGVVNAVFYTTDPDVCRAA-------- 78

Query: 90  GWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLF 149
               ACWA I +++   +FG YP  + WR +L+       +   L P          L  
Sbjct: 79  --TGACWAVIVEKHRPMLFGLYPYDEHWRLVLMMAVYLGTVVLSLWPRCWNLRFLVPLWI 136

Query: 150 GLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVL 209
                    +  G LGL  V TS WGGL +T+++    ++I MP+ +LLALGR + +PV 
Sbjct: 137 VSSLSIGILMFGGVLGLRYVPTSEWGGLPLTMLLFTGTVLIGMPVAVLLALGRRAPLPVA 196

Query: 210 RYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLR 269
           R   + FIE  RGVPL+T+LF+A  + PLFLP   +V+KLLR  +G++ F + Y AEV+R
Sbjct: 197 RGVSVVFIEALRGVPLITILFVAVNVFPLFLPAGVEVNKLLRITVGIAIFFACYQAEVIR 256

Query: 270 GGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINM 329
           GGLQ+I  GQ+EAA SL LSY Q  R II+PQ ++  +P I N  I   K++S + II +
Sbjct: 257 GGLQAIPTGQYEAAASLSLSYWQTTRRIILPQALRISLPAITNHIIAAMKNTSFVIIIGL 316

Query: 330 FDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
           FD+L        +  W          +F+  V+  F +++SLY+  +EK +  G 
Sbjct: 317 FDILTATTAVMQDPLWRKFY--IEAYLFVAAVYLFFGYALSLYARQVEKWIASGR 369


>gi|222102265|ref|YP_002546855.1| ABC-type amino acid transport system, permease component
           [Agrobacterium radiobacter K84]
 gi|221728382|gb|ACM31391.1| ABC-type amino acid transport system, permease component
           [Agrobacterium radiobacter K84]
          Length = 356

 Score =  194 bits (493), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 120/364 (32%), Positives = 200/364 (54%), Gaps = 18/364 (4%)

Query: 25  QRGIIAWIH----KNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTT 80
           Q G+  W      K       + ++T   + +L++ +  ++ W    A+W G+       
Sbjct: 5   QIGLSKWRRRPVTKGLLDNRSNTIITICSLAILVWMVTPLLRWAGRAAIWSGT------- 57

Query: 81  VSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPR 140
              G         ACWAFI  ++   IFG YP A +WRP L      +LL+    P    
Sbjct: 58  ---GSDCSVEGAGACWAFIAAKFRFIIFGFYPPALQWRPALAMFCICVLLSISANPR--Y 112

Query: 141 KFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLAL 200
                ++ + +  +  + ++ G L    + T+ WGGL +TL++S  G+  + P+ +LLAL
Sbjct: 113 WGSKLLISWPVVILLLWLLMAGILVAPPIPTNQWGGLPITLIVSVIGLATAFPIALLLAL 172

Query: 201 GRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFA 260
            R S++ +LR   + FIE  RG+PL+ VL++A +++P+ LP    +DKLLRA +G++ F 
Sbjct: 173 ARRSSMGILRTLAVAFIECLRGIPLIAVLYIAMLIIPMALPSEATLDKLLRAQIGITLFV 232

Query: 261 SAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKD 320
           SAY+AEV+R GLQSI  GQ EAA SLG  Y +  +L+++PQ ++ VIP IVN  IG+  +
Sbjct: 233 SAYLAEVIRAGLQSIPAGQLEAAYSLGFGYWRTTQLVVLPQALRAVIPAIVNLSIGILLN 292

Query: 321 SSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTL 380
           +SL+++I + DLL   ++  ++  W+     T   +F G +++   F  S YS+++E+ L
Sbjct: 293 TSLLAVIGISDLLNTGKIAATDPVWLGFY--TEAFVFTGAIYFAISFVASRYSLWLERRL 350

Query: 381 HKGS 384
             G 
Sbjct: 351 AAGR 354


>gi|262404014|ref|ZP_06080569.1| amino acid ABC transporter permease protein [Vibrio sp. RC586]
 gi|262349046|gb|EEY98184.1| amino acid ABC transporter permease protein [Vibrio sp. RC586]
          Length = 279

 Score =  193 bits (490), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 143/281 (50%), Positives = 205/281 (72%), Gaps = 3/281 (1%)

Query: 107 IFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFS-FFVLYGGLG 165
           ++G YP A+ WRP L F+T +I +  +     P++    ++   ++P F+   +  G  G
Sbjct: 1   MYGFYPAAELWRPRLFFITLAIFVALLAYEKTPKRGWIWLVFVNIYPFFAAILLYGGVFG 60

Query: 166 LSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPL 225
           L +VET  WGGLLVTL+I+  GII+S+P+G+ LALGR S++P++R  C  +IE++RGVPL
Sbjct: 61  LEVVETHKWGGLLVTLIIALVGIIVSLPIGVALALGRRSDMPIIRSLCTVYIEVWRGVPL 120

Query: 226 VTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANS 285
           +TVLFMAS+MLPLFL +  +++KLLRAL+GV  F++AY+AEV+RGGLQ+I KGQ+EAA++
Sbjct: 121 ITVLFMASVMLPLFLSEGSEINKLLRALIGVVMFSAAYMAEVIRGGLQAIPKGQYEAADA 180

Query: 286 LGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTW 345
           LGLSY +KM LII+PQ +K  IP IVNTFIGLFKD+SL+ II MFD+LGI +   ++  W
Sbjct: 181 LGLSYWKKMGLIILPQALKITIPSIVNTFIGLFKDTSLVLIIGMFDVLGIGQSANTDPNW 240

Query: 346 ISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
           +     T   +F+  VFW+FCF +S YS+++E  LH G K+
Sbjct: 241 LG--FATESYVFVALVFWVFCFGMSRYSIWLEGKLHTGHKR 279


>gi|153822068|ref|ZP_01974735.1| amino acid ABC transporter, permease protein [Vibrio cholerae B33]
 gi|126520401|gb|EAZ77624.1| amino acid ABC transporter, permease protein [Vibrio cholerae B33]
          Length = 279

 Score =  193 bits (490), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 144/281 (51%), Positives = 202/281 (71%), Gaps = 3/281 (1%)

Query: 107 IFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFS-FFVLYGGLG 165
           ++G YP A+ WRP L F T ++ +  +     P++    ++   ++P F+   +  G  G
Sbjct: 1   MYGFYPAAELWRPRLFFFTLALFVALLAYEKTPKRGWIWLVFVNIYPFFAALLLYGGVFG 60

Query: 166 LSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPL 225
           L +VET  WGGLLVTL+I+  GII S+P+G+ LALGR S++P++R  C  +IE++RGVPL
Sbjct: 61  LEVVETHKWGGLLVTLIIALVGIIASLPIGVALALGRRSDMPIIRSLCTVYIEVWRGVPL 120

Query: 226 VTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANS 285
           +TVLFMAS+MLPLFL    ++DKLLRAL+GV  F++AY+AEV+RGGLQ+I KGQ+EAA++
Sbjct: 121 ITVLFMASVMLPLFLSQGSEIDKLLRALIGVVMFSAAYMAEVIRGGLQAIPKGQYEAADA 180

Query: 286 LGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTW 345
           LGLSY +KM LII+PQ +K  IP IVNTFIGLFKD+SL+ II MFD+LGI +   ++  W
Sbjct: 181 LGLSYWKKMGLIILPQALKITIPSIVNTFIGLFKDTSLVLIIGMFDVLGIGQSANTDPNW 240

Query: 346 ISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
           +     T   +F+  VFWIFCF +S YS+++E  LH G K+
Sbjct: 241 LG--FATESYVFVALVFWIFCFGMSRYSIWLEGKLHTGHKR 279


>gi|319782289|ref|YP_004141765.1| binding-protein-dependent transport systems inner membrane
           component [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317168177|gb|ADV11715.1| binding-protein-dependent transport systems inner membrane
           component [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 359

 Score =  193 bits (490), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 108/354 (30%), Positives = 181/354 (51%), Gaps = 11/354 (3%)

Query: 32  IHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGW 91
           + + FF TP   +++   + +++F +  +++W    AV+  S          G       
Sbjct: 17  LRRRFFATPLQAVVSLACLTIMVFLVWKLLNWAVFSAVFTTS---------GGPEACQAT 67

Query: 92  NAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFGL 151
             ACW+ I  R+    FG YP  ++WR  L  +   ++     IP+F      +++    
Sbjct: 68  AGACWSVIAARWRIIFFGLYPYEEQWRSALACVAVVVMTVLSCIPAFWTGRRIALVWGAG 127

Query: 152 FPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRY 211
             +F   +  G LGL+ V    WGGL +TL I     +I  PL I LAL R S +P +  
Sbjct: 128 TGLFYVLMKGGVLGLAHVGEEAWGGLALTLFIFVTTCLIGFPLAICLALLRRSELPWISR 187

Query: 212 ACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGG 271
                I+  R +PL+++LF  +++LP  LP     DKL R +LG + F SAY AE++RGG
Sbjct: 188 TTGLIIDGVRSLPLISILFTFAVVLPFALPQWLQGDKLYRVILGSALFFSAYQAEIVRGG 247

Query: 272 LQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFD 331
           +Q ++ GQ EAA +LG+ Y Q++  I++PQ ++  +P  +N F+  FK++SL+ I+  F+
Sbjct: 248 MQGVATGQEEAAMALGMRYWQRISRILLPQAMRNAMPATINQFVISFKETSLVVIVGFFE 307

Query: 332 LLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSK 385
           +L      +    W           FI F+++IF FS+S Y  F+E+ +    +
Sbjct: 308 ILASGNAAYGTGEW--RFAYVEVYAFIAFIYFIFVFSLSRYGAFLERRMSVSER 359


>gi|220910018|ref|YP_002485329.1| polar amino acid ABC transporter inner membrane subunit [Cyanothece
           sp. PCC 7425]
 gi|219866629|gb|ACL46968.1| polar amino acid ABC transporter, inner membrane subunit
           [Cyanothece sp. PCC 7425]
          Length = 341

 Score =  193 bits (489), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 131/367 (35%), Positives = 199/367 (54%), Gaps = 30/367 (8%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
                  LPP  +     W+ +N F T  + LLT      +   +  + +W    A W  
Sbjct: 3   DHPPAELLPPDSRLTPYQWLQRNLFNTWYNSLLTLTCAGTIAAILWFMFNWAITQAEW-- 60

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
                                   A +     +F+ G YP A  WR  LV      +   
Sbjct: 61  ------------------------AVVQQNLPRFLVGRYPPALYWRLWLVLALVVGMGIW 96

Query: 133 MLIPSFPRKFLNSILLF--GLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIII 190
           +      +  LN + L    L  +   +++ GGLGL+ V+T+LW GLL+TL++S   I++
Sbjct: 97  IASRKKAQTKLNLVNLALPALLFLVMLWLIGGGLGLTPVKTNLWNGLLLTLLLSAVSIVL 156

Query: 191 SMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLL 250
           + PLG+LLALGR S++P+LR    T+IE+ RG+PL+ VLFMA +MLPL LP    +D+LL
Sbjct: 157 AFPLGVLLALGRQSSLPLLRGFSTTYIEILRGLPLIGVLFMAQVMLPLVLPADLRLDRLL 216

Query: 251 RALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGI 310
           RA+ G+  F +AY+AE +RGGLQS+ +GQ EAA +LG +    + LI++PQ ++ VIP I
Sbjct: 217 RAIAGLVLFNAAYLAENVRGGLQSVPRGQIEAAQALGFNIPLTLLLIVLPQALRTVIPAI 276

Query: 311 VNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSIS 370
           V  FI L KD+SL+S+  + +L GI R   ++  ++     T   +FIG ++W FCF++S
Sbjct: 277 VGQFISLIKDTSLLSLFALLELTGIARSILAQPQFLGHY--TEVYLFIGLIYWFFCFTLS 334

Query: 371 LYSVFIE 377
            YS  +E
Sbjct: 335 HYSRRLE 341


>gi|219847285|ref|YP_002461718.1| polar amino acid ABC transporter inner membrane subunit
           [Chloroflexus aggregans DSM 9485]
 gi|219541544|gb|ACL23282.1| polar amino acid ABC transporter, inner membrane subunit
           [Chloroflexus aggregans DSM 9485]
          Length = 410

 Score =  193 bits (489), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 128/400 (32%), Positives = 207/400 (51%), Gaps = 33/400 (8%)

Query: 18  PSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTV 77
               P  Q G++ W+ KN F T  ++++T +++ +++ ++   + W+     W  +   +
Sbjct: 10  SRRAPRQQIGLVEWLRKNLFSTWYNVIITLVLLYVIVQAVTSFVSWMITAPGWPAAFTNI 69

Query: 78  CTTVSQGGIQPDGW-NAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP 136
              ++        W   A    +   +         + +        +   I +     P
Sbjct: 70  KLLLTWTYPVDQLWRPQAAMGLVLLLFGLSAGVWGGIVRTVAMGAALVCVVIGIAAFTFP 129

Query: 137 SFPRK------------------------------FLNSILLFGLFPIFSFFVLYGGLGL 166
             P +                                  I+ + L       +L GGLGL
Sbjct: 130 DLPDQTSLPGWLFLFLCVVLLVGGDQGARQIRATLRWPLIIAWILSYPAVILILRGGLGL 189

Query: 167 SIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLV 226
            IVET LWGGL++TL+++  GI++S PLG+LLALGR S++PV+R  C+ +IEL RGVPLV
Sbjct: 190 PIVETKLWGGLMLTLLLAISGIVLSFPLGVLLALGRRSSLPVIRTFCVLYIELIRGVPLV 249

Query: 227 TVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSL 286
           TVLFM +++LPLFLP    +D L+RA + V+ F++AY+AE +RGGLQ+I +GQ EAA +L
Sbjct: 250 TVLFMGALLLPLFLPGGESIDALVRATVAVTLFSAAYLAENVRGGLQAIPRGQVEAARAL 309

Query: 287 GLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWI 346
           GL+ +Q   LI +PQ ++ V+P +V  FI LFKD+SL+ II + DLLG  +    +  W+
Sbjct: 310 GLNVVQTTLLITLPQALRAVVPVLVGQFIALFKDTSLVVIIGLVDLLGAAQNIVGQPQWL 369

Query: 347 SSVTPT--TGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
            +         + I  V+W+F F++S  S  IE  + +  
Sbjct: 370 GTPGGVWRETFLVIAAVYWLFSFTMSRVSKRIEDQIARSR 409


>gi|172039038|ref|YP_001805539.1| amino acid ABC transporter permease, His/Glu/Gln/Arg/opine
           [Cyanothece sp. ATCC 51142]
 gi|171700492|gb|ACB53473.1| amino acid ABC transporter permease protein, His/Glu/Gln/Arg/opine
           [Cyanothece sp. ATCC 51142]
          Length = 391

 Score =  192 bits (487), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 121/383 (31%), Positives = 194/383 (50%), Gaps = 33/383 (8%)

Query: 27  GIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGI 86
             +AWI KN F +  + LLT + +  + +   G+I+W F  A W   +  +         
Sbjct: 10  SPVAWIKKNLFNSWFNSLLTIISLIFIYWVSSGLINWAFFQAQWGVLSANLRLFFVGQYP 69

Query: 87  QPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPIL------------------------- 121
               W A     I        +G       +   +                         
Sbjct: 70  ANLLWRAWTSLAIIISLVGLSWGTLSPKNNFFNPVKLTLLGLIALLSVLLAIPISLISSA 129

Query: 122 ------VFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWG 175
                       ++L   +  +FP       LL+ +       +L G   L  V    + 
Sbjct: 130 MLLAILFLFIIFVVLGQQISQTFPNFKNWLSLLWFITFFLLLGLLQGAFFLRDVRLDDFS 189

Query: 176 GLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIM 235
           GL++T+ ++   I++S P GILLALGR SN+PV+R+  I +IEL RG+PL+ +LFMA +M
Sbjct: 190 GLILTIFVAVISIVLSFPFGILLALGRQSNLPVIRWLSIGYIELIRGLPLIGILFMAQVM 249

Query: 236 LPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMR 295
           LPL LP    + +++RA+ G + F++AY+AE +RGGLQS+ KGQ EAA ++GL+    + 
Sbjct: 250 LPLILPQEMRIQRVVRAIAGFTLFSAAYLAENVRGGLQSVPKGQIEAAKAVGLNGFFVLI 309

Query: 296 LIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGL 355
           L+++PQ ++ VIP IV  FI LFKD+SL++I+ + DLLGI +   +   +I +       
Sbjct: 310 LVVLPQALRVVIPTIVGQFISLFKDTSLLAIVGLVDLLGISQSILANPKFIGTYG--EVY 367

Query: 356 IFIGFVFWIFCFSISLYSVFIEK 378
           +F+  ++WIFC+S+SL S  +EK
Sbjct: 368 LFVAAIYWIFCYSMSLLSRKLEK 390


>gi|148555537|ref|YP_001263119.1| polar amino acid ABC transporter inner membrane subunit
           [Sphingomonas wittichii RW1]
 gi|148500727|gb|ABQ68981.1| polar amino acid ABC transporter, inner membrane subunit
           [Sphingomonas wittichii RW1]
          Length = 362

 Score =  191 bits (484), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 118/345 (34%), Positives = 189/345 (54%), Gaps = 15/345 (4%)

Query: 42  DILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYD 101
           ++L TA+I+   + ++P ++ W     VW G +   C               ACWAF+  
Sbjct: 32  NLLTTAIIVLFAIRTVPHLLSWAVTHGVWSG-DGAACREA-----------GACWAFLRA 79

Query: 102 RYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLY 161
           +    +FG YP A+RWRPILV L         L  +   +   +   F +       +  
Sbjct: 80  KMPFILFGIYPEAERWRPILVVLILGAATLWSLPRAHWTRATLAFWGFAIVASL-LLMAG 138

Query: 162 GGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFR 221
           G LGLS V TS WGGL +T++++ F + +  P GI+LAL R S++PV R+     IE+ R
Sbjct: 139 GRLGLSPVPTSAWGGLPITMLLTIFSLALGFPFGIVLALARRSDMPVYRWTATALIEVMR 198

Query: 222 GVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFE 281
            +PLVT+LF+AS+M PL LP     D L RAL+     +SAYIAEV+RGGLQ +  GQ E
Sbjct: 199 AMPLVTLLFVASVMAPLLLPAGVTADNLTRALVAFVLSSSAYIAEVVRGGLQGVPPGQRE 258

Query: 282 AANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFS 341
           +A +LGL     +  II+PQ I++ +  + +T + + K+SSL+ ++ +FDLL   RV+ +
Sbjct: 259 SARALGLGRSTVLLSIILPQAIRKALAPLTSTVVVIIKNSSLVLVVGLFDLLSAGRVSLN 318

Query: 342 ESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
           +  W +        + I  ++++ C+  + Y++ +E+T   G  +
Sbjct: 319 DPAWPTPYA--ETYLVIALIYFVICYGFARYALHLERTTQGGEGR 361


>gi|192291279|ref|YP_001991884.1| polar amino acid ABC transporter inner membrane subunit
           [Rhodopseudomonas palustris TIE-1]
 gi|192285028|gb|ACF01409.1| polar amino acid ABC transporter, inner membrane subunit
           [Rhodopseudomonas palustris TIE-1]
          Length = 362

 Score =  190 bits (482), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 111/351 (31%), Positives = 200/351 (56%), Gaps = 15/351 (4%)

Query: 36  FFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAAC 95
            FG  +  L+T  ++ L+L+    ++ W+ LDA W GS+                   AC
Sbjct: 27  LFGGWRRALVTFAVLALILWLGVPLLQWLLLDATWQGSSAE-----------CAARGGAC 75

Query: 96  WAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIF 155
           WAF+  +   F+F  YP    WRP++V     +LL    +P         ++ + +    
Sbjct: 76  WAFVAAKLRFFLFAFYPADGLWRPVVVCGLLIVLLLASAMPRLWG--ARLVVAWPVVIGL 133

Query: 156 SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACIT 215
              ++ G  G ++V ++ WGGL +TL++       S+P+ +LL+L R S + ++R+  I 
Sbjct: 134 CLALMSGLPGGAVVSSNQWGGLPITLLVWVICFATSVPIAVLLSLARRSRMRIVRWLAIG 193

Query: 216 FIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSI 275
           +IEL R +P+V +L+ A+++LP+ LP +  +DKL RA++ ++ F +AY+AEV+RGGLQ++
Sbjct: 194 YIELMRAIPMVAILYFATLILPMALPGSVPLDKLPRAIVMLALFWTAYVAEVVRGGLQAV 253

Query: 276 SKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGI 335
            +GQ EAA +LGL Y + MRLI++PQ ++ V+PG+VN  IG    +SL+++I + D++G 
Sbjct: 254 PRGQEEAALALGLGYWRSMRLIVLPQALRAVVPGLVNLGIGFLLATSLLAVIGIMDIIGA 313

Query: 336 VRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
            +   ++  W+         + +  V+++  +S S YS+++E+ L   S +
Sbjct: 314 AKAAAADPEWLGYYK--EAFLVVALVYFVMGYSGSRYSLWLERRLGTFSGR 362


>gi|282899901|ref|ZP_06307862.1| Amino acid ABC transporter, permease protein, 3- TM region protein,
           His/Glu/Gln/Arg/opine [Cylindrospermopsis raciborskii
           CS-505]
 gi|281195171|gb|EFA70107.1| Amino acid ABC transporter, permease protein, 3- TM region protein,
           His/Glu/Gln/Arg/opine [Cylindrospermopsis raciborskii
           CS-505]
          Length = 340

 Score =  189 bits (481), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 132/362 (36%), Positives = 201/362 (55%), Gaps = 43/362 (11%)

Query: 31  WIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDG 90
           W+ KN F    + +LT + +  L     G++ W+F  A W                    
Sbjct: 6   WLRKNLFNNWYNGVLTIVCVIGLFSLGRGVLFWIFNQAKW-------------------- 45

Query: 91  WNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKF-------- 142
                   +      F+ G +P +  WR  L  +  SI+          +          
Sbjct: 46  ------QVVTVNIHLFLVGRFPRSLYWRIWLALVINSIVGLITWHGLMQKYHLPKNQLLQ 99

Query: 143 -------LNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLG 195
                       ++ L  I + ++L GG GL  V T+LW GLL+TL+++F  I +S PLG
Sbjct: 100 KAYQLIRPLLAPIWLLTFIITIWLLGGGFGLQSVPTNLWNGLLLTLLMAFVSIALSFPLG 159

Query: 196 ILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLG 255
           +LLALGRNS +PV+R+  I +IEL RG+PL+ +LF+A +MLPLFLP  W +D+L+R + G
Sbjct: 160 VLLALGRNSELPVIRWFSILYIELVRGLPLIGILFIAQVMLPLFLPADWRLDRLVRGVAG 219

Query: 256 VSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFI 315
           +  F++AY+AE +RGGLQSI KGQFEAA +LGL+    + L+++PQ ++ VIP IV  FI
Sbjct: 220 LVLFSAAYMAENVRGGLQSIPKGQFEAARALGLNTFLLLILVVLPQALRAVIPTIVGQFI 279

Query: 316 GLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVF 375
           GLFKD+SL+S++ + +L GI R   ++  ++         IFIG V+W+FC+S+SL +  
Sbjct: 280 GLFKDTSLLSLVGLVELTGIARSILAQPQFLGRY--MEVYIFIGAVYWLFCYSMSLAARR 337

Query: 376 IE 377
           +E
Sbjct: 338 LE 339


>gi|119489534|ref|ZP_01622295.1| Amino acid ABC transporter, permease protein, 3-TM
           region,His/Glu/Gln/Arg/opine [Lyngbya sp. PCC 8106]
 gi|119454613|gb|EAW35760.1| Amino acid ABC transporter, permease protein, 3-TM
           region,His/Glu/Gln/Arg/opine [Lyngbya sp. PCC 8106]
          Length = 404

 Score =  189 bits (481), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 118/402 (29%), Positives = 203/402 (50%), Gaps = 32/402 (7%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
                 S  PV       W+ KN F T  + +LT +I  LL +++  +I W   +A W  
Sbjct: 4   TTPPSNSAAPVESSTPREWMLKNLFNTWYNTILTLVISGLLFWTLASLITWARTEAKWSV 63

Query: 73  SNRTVCTTVSQGGIQPDGWN------------AACWAFIYDRYEQFIFGNY--------- 111
               +             W                W  +          N          
Sbjct: 64  IPANLPLFFVGRFPSDQYWRLWIVLSLICLLAGLTWGILARNVPVLFRQNIVIIISIVCM 123

Query: 112 -----PMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLG- 165
                P+   +R +L+ +   ++ +        +   N              +    +G 
Sbjct: 124 MMTIVPVGIPYRILLIGMVLLVVASAWGGKQLSKTQPNLTKWLPFSWFICLIISVWLIGG 183

Query: 166 ---LSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRG 222
              L  V T+LWGGL++TL++S   I++  P+G++LALGR S++P++R+  I +IE+ RG
Sbjct: 184 GLGLESVSTNLWGGLMLTLLMSIISILLCFPIGVMLALGRQSSLPIIRFLSIAYIEVIRG 243

Query: 223 VPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEA 282
           +PL+T+LFM  +++PLFLP+    D++LRA++G++ F+SAY+AE +RGGLQ+I +GQ EA
Sbjct: 244 LPLITILFMGQVLVPLFLPEGMRPDRILRAIVGLTMFSSAYLAENVRGGLQAIPRGQIEA 303

Query: 283 ANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSE 342
           A +LGLS    + L+++PQ +K  IP IV  FI LF+D++L++I+ + +LLG+ R   + 
Sbjct: 304 AKALGLSTPLTLGLVVLPQALKISIPSIVGQFISLFQDTTLLAIVGLVELLGMSRSILAN 363

Query: 343 STWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
             ++   +     +FIG ++W+FC+ +S  S  +E+ L+   
Sbjct: 364 PKFLGRYS--EVYLFIGILYWLFCYLMSQASRKLEQQLNTER 403


>gi|197104924|ref|YP_002130301.1| ABC-type amino acid transport system, permease component
           [Phenylobacterium zucineum HLK1]
 gi|196478344|gb|ACG77872.1| ABC-type amino acid transport system, permease component
           [Phenylobacterium zucineum HLK1]
          Length = 358

 Score =  189 bits (480), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 131/359 (36%), Positives = 201/359 (55%), Gaps = 14/359 (3%)

Query: 21  PPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTT 80
           PP   RG  A +    FG+P +++LT  +          ++ W  LDA  + +    C  
Sbjct: 9   PPRAARGP-AVLAARLFGSPLNVVLTLAVAWAAWSLAAPLVRWAVLDAAVLPAEPAACRD 67

Query: 81  VSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPR 140
           +          + ACW+F+  +  Q +FG YP+ +RWRP LV      LL   L P+  R
Sbjct: 68  I----------SGACWSFVVAKSGQILFGIYPIEERWRPTLVCAVLLGLLAYSLRPAAWR 117

Query: 141 KFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLAL 200
               + L     P     +  G  GLS V T++WGGL VTL+++   I  + PL ILLAL
Sbjct: 118 P-HLAALWAAALPGVLLLMFGGFAGLSYVATTMWGGLPVTLILTVTAIGGAFPLAILLAL 176

Query: 201 GRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFA 260
           GR +++PV+R  C+ FIE+ R +PL+++LF+ASIMLPL LP+    DK  RA++ +  FA
Sbjct: 177 GRRADLPVIRTLCVLFIEVTRAMPLLSLLFIASIMLPLLLPEPLLPDKFFRAMIALLLFA 236

Query: 261 SAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKD 320
           +AY+AEV+RGGLQ++  GQ EAA +LGL Y +  R +++PQ +  VIP + NT I + K+
Sbjct: 237 AAYLAEVIRGGLQALPPGQAEAARALGLGYWRTQRFVVLPQALALVIPSLTNTIIVMIKN 296

Query: 321 SSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKT 379
           +SL+ ++ +FDL+   R   ++  W S        IFI  V++  CF    ++  +E+ 
Sbjct: 297 TSLVLVVGLFDLISSGRAALADPEWSSP--AMETYIFIASVYFALCFGFGRFARALERR 353


>gi|312115906|ref|YP_004013502.1| polar amino acid ABC transporter inner membrane protein
           [Rhodomicrobium vannielii ATCC 17100]
 gi|311221035|gb|ADP72403.1| polar amino acid ABC transporter, inner membrane subunit
           [Rhodomicrobium vannielii ATCC 17100]
          Length = 358

 Score =  189 bits (479), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 136/346 (39%), Positives = 198/346 (57%), Gaps = 12/346 (3%)

Query: 34  KNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNA 93
           +   G   +  +T  +   L F   G + ++   A W G + + C               
Sbjct: 17  RRLLGRAVNAAVTLTLGVALAFVAYGALSFLVFGAAWSG-DVSACRATE----------G 65

Query: 94  ACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFGLFP 153
           ACW F+  + +QF+FG YP  + WR     L    LL    +               L  
Sbjct: 66  ACWPFVAAKLKQFVFGRYPDDELWRAAAAMLLPPALLLAAFLARRRFGLAGFAAAVVLGL 125

Query: 154 IFSFF-VLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYA 212
             +F  V   G+ L+ V T +WGGL +TL++S+ GI  S+PLGI+LAL R S+ PV R+ 
Sbjct: 126 PLAFLLVAGDGVLLAPVSTDVWGGLTLTLLVSYTGIAASLPLGIVLALMRRSSWPVPRWL 185

Query: 213 CITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGL 272
            I FIE +RGVPLVTVLFMA++MLPLFLP+   V+K  RAL  ++ FASAY+AEV+RGGL
Sbjct: 186 AICFIEFWRGVPLVTVLFMAAVMLPLFLPEGASVNKPARALFAIAVFASAYMAEVIRGGL 245

Query: 273 QSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDL 332
           QS+ + Q  A  +LGL Y Q + L+I+PQ I+  +PGI  TFIGL KD++L+ +I +FD 
Sbjct: 246 QSVPENQVTAGRALGLRYSQILALVILPQAIRSALPGIAGTFIGLLKDTTLVLVIGLFDF 305

Query: 333 LGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEK 378
           LG++++  ++  W +S T  TG  F   VFW  C++I+  S ++E+
Sbjct: 306 LGMIQLAAADPAWSASTTTLTGYAFAALVFWSLCYAIARVSAYLER 351


>gi|282897628|ref|ZP_06305628.1| Amino acid ABC transporter, permease protein, 3- TM region protein,
           His/Glu/Gln/Arg/opine [Raphidiopsis brookii D9]
 gi|281197551|gb|EFA72447.1| Amino acid ABC transporter, permease protein, 3- TM region protein,
           His/Glu/Gln/Arg/opine [Raphidiopsis brookii D9]
          Length = 343

 Score =  189 bits (479), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 132/352 (37%), Positives = 201/352 (57%), Gaps = 23/352 (6%)

Query: 31  WIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQP-- 88
           W+ KN F    + +LT + + +L     GI+ W+F  A W      +    S        
Sbjct: 9   WLRKNLFNNWYNGVLTIVCVIVLFSLGKGILFWIFNQAKWEVVTANIHFIFSWQIPPGFI 68

Query: 89  ---DGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNS 145
                     + +  D         Y + +       +     LL P+            
Sbjct: 69  LANLASFGNQFYYRVDNLVWVD-AKYHLPENQLLQKAYQLIVPLLAPIWF---------- 117

Query: 146 ILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSN 205
                L  I + ++L GGLGL  V T+LW GLL+TL+++F  I++S PLG+LLALGRNS 
Sbjct: 118 -----LTFIITIWLLGGGLGLQSVPTNLWNGLLLTLLMAFVSIVLSFPLGVLLALGRNSE 172

Query: 206 IPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIA 265
           +PV+R+  I +IEL RG+PL+ +LF+A +MLPLFLPD W +D+L+R + G+  F++AY+A
Sbjct: 173 LPVIRWFSILYIELVRGLPLIGILFIAQVMLPLFLPDNWRLDRLVRGVAGLVLFSAAYMA 232

Query: 266 EVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLIS 325
           E +RGGLQSI +GQFEAA +LGL+    + L+I+PQ ++ VIP IV  FIGLFKD+SL+S
Sbjct: 233 ENVRGGLQSIPRGQFEAARALGLNTFLLLILVILPQALRAVIPTIVGQFIGLFKDTSLLS 292

Query: 326 IINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIE 377
           ++ + +L GI R   ++  ++         IFIG ++W+FC+S+SL +  +E
Sbjct: 293 LVGLVELTGIARSILAQPQFLGRY--MEVYIFIGVIYWVFCYSMSLIARELE 342


>gi|307150942|ref|YP_003886326.1| polar amino acid ABC transporter inner membrane subunit [Cyanothece
           sp. PCC 7822]
 gi|306981170|gb|ADN13051.1| polar amino acid ABC transporter, inner membrane subunit
           [Cyanothece sp. PCC 7822]
          Length = 398

 Score =  188 bits (478), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 122/390 (31%), Positives = 188/390 (48%), Gaps = 33/390 (8%)

Query: 21  PPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTT 80
           PP+       WI KN F +  + LLT + I  + +    +I+W+F  A W          
Sbjct: 9   PPIKPINPSEWIQKNLFSSWLNSLLTLISIIFIYWVGTHLINWIFTQANWQVITANFRLF 68

Query: 81  VSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPR 140
                     W       I        +G                  IL    ++ +   
Sbjct: 69  FVGYYPVELLWRVWITLGITIFLGGLTWGILSRKTPLFNPTSLTVLFILAAICVLVTLIT 128

Query: 141 KFL-------------------------------NSILLFGLFPIFSFFVLYGGLGLSIV 169
                                                 L+ L  +  +++L GGL L  V
Sbjct: 129 GIQSSLLLWGMLLILILTAFSGKKIGQQIPSLSSWLSPLWLLTFLVIWWLLRGGLFLQPV 188

Query: 170 ETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVL 229
             SL  G ++T+V++   I +  P G+LLALGR S++PV+R+  I +IE+ RG+PL+ +L
Sbjct: 189 SLSLISGFILTIVVAIVSIFLCFPFGVLLALGRQSSLPVIRWLSIGYIEIIRGLPLIGIL 248

Query: 230 FMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLS 289
           FMA +MLPL LP     D ++RA+ G + F++AY+AE +RGGLQS+ +GQ EAA +LGL+
Sbjct: 249 FMAQVMLPLVLPLGVRPDSIVRAIAGYTIFSAAYLAENIRGGLQSVPRGQTEAAIALGLN 308

Query: 290 YLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSV 349
            L  + LII+PQ +K VIP IV  FI LFKD+SL++I+ + DLLGI +   +   +    
Sbjct: 309 PLLVLGLIILPQALKAVIPTIVGQFISLFKDTSLLAIVGLVDLLGISQSILANPKYQG-- 366

Query: 350 TPTTGLIFIGFVFWIFCFSISLYSVFIEKT 379
                 +FI F++W+ C ++SL S  +E+ 
Sbjct: 367 RNVEVYLFIAFIYWLCCSAMSLASRKLEQK 396


>gi|218437715|ref|YP_002376044.1| polar amino acid ABC transporter inner membrane protein [Cyanothece
           sp. PCC 7424]
 gi|218170443|gb|ACK69176.1| polar amino acid ABC transporter, inner membrane subunit
           [Cyanothece sp. PCC 7424]
          Length = 402

 Score =  188 bits (478), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 122/392 (31%), Positives = 193/392 (49%), Gaps = 33/392 (8%)

Query: 21  PPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTT 80
           PP+ +     WIHKN F +  +  LT + +  + +    +I W+F +A W      +   
Sbjct: 12  PPIKRVSPGEWIHKNLFSSWFNGFLTLISLLFIGWVGFNLIDWIFTEAQWQVITANLRLF 71

Query: 81  VSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLI----- 135
                     W       I        +G +            +   I     +      
Sbjct: 72  FVGYYPIELLWRTWISLGILVSLGGLSWGIFSRQTLLFNRTSLMILFIFAAICVFFTVTS 131

Query: 136 ----------------------PSFPRKFLNSILLFGLFPIFSFFVLYG----GLGLSIV 169
                                     +   +     GL  + +F +++     GL L +V
Sbjct: 132 GLMTSLILWGMLLLLILCAVGGKKLGQSVPSLGTWLGLIWLGTFLIVWWLLRGGLFLDLV 191

Query: 170 ETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVL 229
             SL  GL++TL ++   I++S P G+LLALGR S++PV+R+  I +IEL RG PL+ +L
Sbjct: 192 PLSLISGLILTLSVAIVSIVLSFPFGVLLALGRQSSLPVIRWLSIAYIELIRGFPLIGIL 251

Query: 230 FMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLS 289
           FMA +MLPL LP     D ++RA+ G + F++AY+AE +RGGLQS+ +GQ EAA +LGL+
Sbjct: 252 FMAQVMLPLVLPLGVRPDSIVRAIAGFTLFSAAYLAENVRGGLQSVPRGQTEAAKALGLN 311

Query: 290 YLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSV 349
            L  + LI++PQ +K VIP +V  FI LFKD+SL++I+ + DLLGI +   +   +    
Sbjct: 312 PLLVLSLIVLPQALKAVIPTLVGQFISLFKDTSLLAIVGLVDLLGISQSILANPKYQG-- 369

Query: 350 TPTTGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
                 +FIGF++W+ C ++SL S  IE  + 
Sbjct: 370 RNVEVYLFIGFMYWLCCSAMSLASRKIETKMS 401


>gi|166366535|ref|YP_001658808.1| amino acid ABC-transporter permease protein [Microcystis aeruginosa
           NIES-843]
 gi|166088908|dbj|BAG03616.1| amino acid ABC-transporter permease protein [Microcystis aeruginosa
           NIES-843]
          Length = 331

 Score =  188 bits (477), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 120/356 (33%), Positives = 184/356 (51%), Gaps = 35/356 (9%)

Query: 31  WIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDG 90
           W+ KN F T  +++LT   + L L+     + W    A W                    
Sbjct: 4   WLRKNLFNTWYNVILTLAGLFLSLWGGLSFLDWAINQAKW-------------------- 43

Query: 91  WNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFG 150
                 A + +    F+ G YP    WR  L+    + L       +  R       L  
Sbjct: 44  ------AVVTENIGLFVVGRYPEQSIWRIWLILTILAALSLFSWQLNRGRFPNCPAFLQR 97

Query: 151 LFPIFSFFVLYGGLGL-------SIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRN 203
            + +     L     L         +      GL++TL+++   +I+S PLG+LLALGR 
Sbjct: 98  WWGLLWLLTLPLIAWLLLGGLFLKAIPLDDLSGLILTLLVAIASMILSFPLGVLLALGRQ 157

Query: 204 SNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAY 263
           S +P +R+  I +IEL RG+PL+ +LFMA +MLPL LP     ++++RA+ G + FA+AY
Sbjct: 158 SELPAIRWLSIGYIELLRGLPLLGILFMAQVMLPLILPAGTRPERVIRAIAGFTLFAAAY 217

Query: 264 IAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSL 323
           +AE +RGGLQ+I KGQ EAA +LGL  +  + LI++PQ +K VIP IV  FI LFKD+SL
Sbjct: 218 LAENVRGGLQAIPKGQIEAAKALGLKPIFVLLLIVLPQALKAVIPAIVGQFISLFKDTSL 277

Query: 324 ISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKT 379
           ++I+ + DLLG+     +   +I         +F+ F++WIFC+S+SL S  +E+ 
Sbjct: 278 LAIVGLVDLLGMAGSVLANPKFIGDY--PEVYLFLAFIYWIFCYSMSLASRRLEQR 331


>gi|126731933|ref|ZP_01747736.1| ABC transporter, membrane spanning protein (amino acid) [Sagittula
           stellata E-37]
 gi|126707465|gb|EBA06528.1| ABC transporter, membrane spanning protein (amino acid) [Sagittula
           stellata E-37]
          Length = 461

 Score =  188 bits (477), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 148/461 (32%), Positives = 218/461 (47%), Gaps = 77/461 (16%)

Query: 2   IDSCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKD-------------ILLTAL 48
           +   +   +VR         P  + G+  W+ +N F +  D             IL+T  
Sbjct: 1   MQEHETDHWVRTHEAPRLPAPPTEVGLRGWLWRNIFASMSDFTSPGKAVGSILMILITVF 60

Query: 49  IICLLLFSIPGIIH---------------------------WVFLDAVW----------- 70
               L++ I  ++                            W F+ A W           
Sbjct: 61  AAYSLVWMIWTLLDFAVFNATFADPEGLKRETCFLNPTGACWPFIQAKWYQFMFGFYPEE 120

Query: 71  ----IGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPM----------AQR 116
               +  +  +        I P        AF+   +    +                  
Sbjct: 121 DVWRVKLSMLILAVGIAWLIFPLPHRGKVAAFMLTGFPVIAYVLLNGMPVEDDGDLGHIF 180

Query: 117 WRPILVFLTGSILLTPMLIPSFPRKFLNSILL------------FGLFPIFSFFVLYGGL 164
                  +  ++      +    +                              V+   L
Sbjct: 181 AGAWFPLVLAAVFFAAWWLSDAGKLGDVGSAFAPALLIAAGGLALWGGLPLVTMVIDLAL 240

Query: 165 GLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVP 224
           G  +VET+ WGGL +TLV++ FGI+IS+P+G+LLALGR SN P+++Y+ + FIE+ RG+P
Sbjct: 241 GTEVVETNKWGGLTITLVVAIFGIVISLPVGMLLALGRRSNAPIIKYSSVIFIEVVRGIP 300

Query: 225 LVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAAN 284
           L++VLF AS MLP FL    D +KLLRA++GV  FASAY+AEV+RGGLQ+I KGQ+E   
Sbjct: 301 LISVLFFASAMLPYFLEPGVDFNKLLRAMIGVVLFASAYMAEVIRGGLQAIPKGQYEGGM 360

Query: 285 SLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSEST 344
           SLGLS+ Q+MRLIIMPQ +  VIPGIVNTFIGLFKD++L+ II++FDLLGI+     +  
Sbjct: 361 SLGLSFWQQMRLIIMPQALTTVIPGIVNTFIGLFKDTTLVLIISIFDLLGILNNTLKDPE 420

Query: 345 WISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSK 385
           W +  T  TG + I  ++WIFCF +S YSV +E+ L +  +
Sbjct: 421 WSTPTTAYTGYLTIALIYWIFCFGMSRYSVHMERKLDRSHR 461


>gi|75906961|ref|YP_321257.1| amino acid ABC transporter permease [Anabaena variabilis ATCC
           29413]
 gi|75700686|gb|ABA20362.1| neutral amino acid ABC transporter membrane protein / L-glutamate
           ABC transporter membrane protein / L-aspartate ABC
           transporter membrane protein [Anabaena variabilis ATCC
           29413]
          Length = 381

 Score =  188 bits (476), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 130/379 (34%), Positives = 208/379 (54%), Gaps = 28/379 (7%)

Query: 29  IAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQP 88
           + W+ KN F T  + LLT +   LLL+ + GI+ W    A W      +   +     Q 
Sbjct: 4   LTWLRKNLFSTWYNSLLTVICSALLLWLVQGIVIWATTKAQWAVVQVNLRLFLVGRFPQT 63

Query: 89  DGWNAACWAFIYDRYEQFIFGNYPMAQR--WRPILVFLTGSILLTPMLIPSFPRKF---- 142
           + W       I         G +   Q+  WR + +F     LL  +       +     
Sbjct: 64  EYWRVWIVLAIASTLGAVTAGVFFNQQKLTWRKVGLFAFIVGLLLVLFPLDLSSRLWLLL 123

Query: 143 --------------------LNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLV 182
                                   L++ L      +++ GG GL  V ++LW GLL+TL+
Sbjct: 124 TAILLIPGFILGSKLTNLVAPWLSLIWLLSFPIILWLIGGGFGLRPVSSNLWNGLLLTLL 183

Query: 183 ISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPD 242
           ++   I++S P+G+LLALGR SN+PV+R+  I +IE+ RGVPL+ +LF+A +MLPLF   
Sbjct: 184 MAAISIVLSFPIGVLLALGRTSNLPVVRWFSILYIEIIRGVPLIGILFLAQVMLPLFFAA 243

Query: 243 TWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQV 302
              +D++LRA+ G+  F++AY+AE +RGGLQ++S+GQ EAA +LGL+    + LI++PQ 
Sbjct: 244 DVRLDRVLRAIAGLVLFSAAYMAENVRGGLQAVSRGQVEAAKALGLNTFFVVLLIVLPQA 303

Query: 303 IKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVF 362
           ++ VIP +V  FIGLFKD+SL+S++ + +L GI R   ++  +I         +FIG ++
Sbjct: 304 LRAVIPAVVGQFIGLFKDTSLLSLVGLVELTGIARSILAQPQFIGRYA--EVYLFIGLIY 361

Query: 363 WIFCFSISLYSVFIEKTLH 381
           W+FC+S+SL S  +E+ L+
Sbjct: 362 WLFCYSMSLASRRLERQLN 380


>gi|326794956|ref|YP_004312776.1| polar amino acid ABC transporter inner membrane subunit
           [Marinomonas mediterranea MMB-1]
 gi|326545720|gb|ADZ90940.1| polar amino acid ABC transporter, inner membrane subunit
           [Marinomonas mediterranea MMB-1]
          Length = 456

 Score =  188 bits (476), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 130/436 (29%), Positives = 199/436 (45%), Gaps = 70/436 (16%)

Query: 17  QPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRT 76
               P     G I  I   +F T  + LLT   + +L +     ++W   +AV+    R 
Sbjct: 23  PARPPQTNSNGAIGKIRNRYFNTIGNSLLTIASLIVLFYLAKWGLNWALFEAVFDADTRR 82

Query: 77  VCTTVSQGGIQPDGWNAACWAFIYDRYEQ------------------------------- 105
            C  +S  G    G  +     IY R+                                 
Sbjct: 83  QCLDISPNGACWAGVMSWFNGLIYGRFPLQEQWRVNLGVIVGAFWLLPLLSKRIPLRNVI 142

Query: 106 ---------------FIFGNYPMAQRWRPILVFLTGSILLTPMLIPSF------------ 138
                          F+ G +     W   L+       L  + +               
Sbjct: 143 LLSWVGLFPFAAAYLFLGGRFGHELSWGHGLMTCLSLGFLALIYMNLIASMFSFKGVHLA 202

Query: 139 ----------PRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGI 188
                      R    S++L          ++ GG  L  V    WGGL +T +I+ F I
Sbjct: 203 FVPLLETYLKRRVASVSLILVWAALSMLVALVIGGFDLDPVPIERWGGLFLTFIIAGFSI 262

Query: 189 IISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDK 248
            +++P+G+LLALGR S +PV+ +  +  IEL R VPL+TVLFMA  +LP+FLP   + +K
Sbjct: 263 AMAIPVGVLLALGRRSKLPVIHWLSLVVIELVRSVPLITVLFMAVTLLPIFLPSDVEFNK 322

Query: 249 LLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIP 308
           L + L+ V  FA AY+AE +RGGLQ+I KGQFEAA +LG  Y Q M LI++PQ ++ +IP
Sbjct: 323 LSQVLVAVCLFAGAYMAENIRGGLQAIPKGQFEAATTLGFGYWQTMFLIVLPQALRMMIP 382

Query: 309 GIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFS 368
            I+ +FI L KD++L+SII +FD++ + R   ++  W+     T  L+ I  +F++ C+S
Sbjct: 383 NIMTSFISLLKDTTLVSIIGLFDIMLMARNIANDKDWVGLH--TEPLVLIAVLFFVLCYS 440

Query: 369 ISLYSVFIEKTLHKGS 384
           +S YS+ +EK L    
Sbjct: 441 MSQYSLNLEKRLKVDR 456


>gi|17231658|ref|NP_488206.1| permease protein of amino acid ABC transporter [Nostoc sp. PCC
           7120]
 gi|17133301|dbj|BAB75865.1| permease protein of amino acid ABC transporter [Nostoc sp. PCC
           7120]
          Length = 381

 Score =  187 bits (474), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 130/379 (34%), Positives = 207/379 (54%), Gaps = 28/379 (7%)

Query: 29  IAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQP 88
           + W+ KN F T  + LLT +   L L+ + GII W    A W      +   +     Q 
Sbjct: 4   LTWLRKNLFSTWYNSLLTVICSALSLWLVQGIIVWATTKAQWAVIQVNLRLFLVGRFPQT 63

Query: 89  DGWNAACWAFIYDRYEQFIFGNYPMAQR--WRPILVFLTGSILLTPMLIPSFPRKF---- 142
           + W       I         G +   Q+  WR + +F     LL  +       +     
Sbjct: 64  EYWRVWIVLAIASTLGAVTAGIFFNQQKLTWRKVGLFAFIVGLLLILFTLDLSSRLWLLL 123

Query: 143 --------------------LNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLV 182
                                   L++ L      +++ GG GL  V ++LW GLL+TL+
Sbjct: 124 TAVLLIPGFLLGSRLTNLVAPWLSLIWLLSFPIILWLIGGGFGLRPVSSNLWNGLLLTLL 183

Query: 183 ISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPD 242
           ++   I++S P+G+LLALGR SN+PV+R+  I +IE+ RGVPL+ +LF+A +MLPLF   
Sbjct: 184 MAAISIVLSFPIGVLLALGRTSNLPVVRWFSILYIEIVRGVPLIGILFLAQVMLPLFFAA 243

Query: 243 TWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQV 302
              +D++LRA+ G+  F++AY+AE +RGGLQ++S+GQ EAA +LGL+    + LI++PQ 
Sbjct: 244 DVRLDRVLRAIAGLVLFSAAYMAENVRGGLQAVSRGQVEAAKALGLNTFFVVLLIVLPQA 303

Query: 303 IKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVF 362
           ++ VIP +V  FIGLFKD+SL+S++ + +L GI R   ++  +I         +FIG ++
Sbjct: 304 LRAVIPALVGQFIGLFKDTSLLSLVGLVELTGIARSILAQPQFIGRYA--EVYLFIGLIY 361

Query: 363 WIFCFSISLYSVFIEKTLH 381
           W+FC+S+SL S  +E+ L+
Sbjct: 362 WLFCYSMSLASRRLERQLN 380


>gi|110347223|ref|YP_666041.1| polar amino acid ABC transporter, inner membrane subunit
           [Mesorhizobium sp. BNC1]
 gi|110283334|gb|ABG61394.1| amino acid ABC transporter membrane protein 2, PAAT family
           [Chelativorans sp. BNC1]
          Length = 362

 Score =  186 bits (473), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 136/343 (39%), Positives = 202/343 (58%), Gaps = 14/343 (4%)

Query: 36  FFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAAC 95
           FFGTP +  LT +++ L+      ++ W  L A    +    C           G   AC
Sbjct: 27  FFGTPLNAALTVVLLWLMARFGWLLLDWAVLKAAIFPAEPETC----------VGKTGAC 76

Query: 96  WAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIF 155
           W+F+  +  Q +FG YP  +RWR  LV +     L     PS  R  L  +  +    + 
Sbjct: 77  WSFVIAKSGQILFGIYPPTERWRAGLVCVLIITTLVASARPSAWRPSLGLV--WVAMMVV 134

Query: 156 SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACIT 215
             +++ GG GL+ V TS WGGL VTL+++ F I +  P  ILLALGR SN+PV+R   + 
Sbjct: 135 VLWLMGGGFGLAAVPTSSWGGLPVTLILTVFAIGLGFPAAILLALGRRSNLPVVRTLSVL 194

Query: 216 FIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSI 275
           FIE  RG+PL+++L +ASI+LPLFLP+    DK +RAL+ ++ FA+AY+AEVLRGGLQSI
Sbjct: 195 FIETIRGLPLLSLLLVASILLPLFLPEALLPDKFVRALIALTIFAAAYLAEVLRGGLQSI 254

Query: 276 SKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGI 335
             GQ EAA +LGL Y +  RLII+PQ I+ VIP + NT I + K++SL+ ++ +FDL+  
Sbjct: 255 PSGQSEAAEALGLGYWKTQRLIILPQAIRIVIPALTNTIIVMIKNTSLVLVVGLFDLISS 314

Query: 336 VRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEK 378
            +   S+  W +    T   +FIG +++   FS + ++ F+E+
Sbjct: 315 GKAALSDPAWPAP--STETFLFIGLIYFALAFSFARFADFLER 355


>gi|295689851|ref|YP_003593544.1| polar amino acid ABC transporter inner membrane subunit
           [Caulobacter segnis ATCC 21756]
 gi|295431754|gb|ADG10926.1| polar amino acid ABC transporter, inner membrane subunit
           [Caulobacter segnis ATCC 21756]
          Length = 342

 Score =  185 bits (470), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 109/327 (33%), Positives = 177/327 (54%), Gaps = 16/327 (4%)

Query: 59  GIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWR 118
             + W+ LDA W G +R  C               ACWA I  R  Q + G YP     R
Sbjct: 29  PALRWLILDATWTGDSRAAC-----------DPAGACWAMITARAPQILIGFYPPGHGGR 77

Query: 119 PILVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLL 178
            +L  L  +  L+P+ +P   R+    ++   L  +    ++ G   L  V ++ WGGL 
Sbjct: 78  VLLAVLALAAGLSPLALP---RRAGLVLVTAPLGAVVCLVLMGGARLLPSVPSAYWGGLA 134

Query: 179 VTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPL 238
           + L++     I ++PLG+LL L R S +P++R     ++E  R  PL+ VLF A+++ PL
Sbjct: 135 LNLIVGAVCAIFALPLGVLLGLARQSRLPLIRLLASAYVETARAAPLIVVLFAAAVLGPL 194

Query: 239 FLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLII 298
            LP    +DKL RA++ ++ F +AY+AE +RGGL ++ +GQ EAA +LGL  L+ +  ++
Sbjct: 195 LLPSALPLDKLGRAMVAITLFEAAYMAEAVRGGLMAVPQGQREAARALGLGPLRALVDVV 254

Query: 299 MPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFI 358
           +PQ ++   P +VN+FIGL KD+SL+ +I + D+ G++R   S+  W          IF+
Sbjct: 255 LPQALRTATPALVNSFIGLLKDTSLLYVIGVLDITGVLRNAVSDFAWQGL--EPEAYIFV 312

Query: 359 GFVFWIFCFSISLYSVFIEKTLHKGSK 385
           G  FW+ CF +S  +  +E+ L    +
Sbjct: 313 GLSFWLLCFGLSRAAAALERRLQTAPR 339


>gi|309791170|ref|ZP_07685702.1| polar amino acid ABC transporter, inner membrane subunit
           [Oscillochloris trichoides DG6]
 gi|308226732|gb|EFO80428.1| polar amino acid ABC transporter, inner membrane subunit
           [Oscillochloris trichoides DG6]
          Length = 393

 Score =  184 bits (468), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 136/391 (34%), Positives = 211/391 (53%), Gaps = 33/391 (8%)

Query: 28  IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQ 87
           I  W+ +N F T  + +++ LI+ LL   +   + W+     W+   + +          
Sbjct: 3   IWDWLRQNLFNTWYNSIISVLIVALLFQLLSTFLGWLLTTQGWVAVLKNLRLLFVGRYPA 62

Query: 88  PDGWNAACWAFIYDRYEQFIFGNY---------------------------PMAQRWRPI 120
              W       +         G +                                +   
Sbjct: 63  DQVWRIELVVAMIALLVGLSGGVWKGIVRNLATGFGLILSVLGLLAFTFPNDGLNPFITP 122

Query: 121 LVFLTGSILLTPMLIPSFPR----KFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGG 176
            +FL GS  L  + +    R      +  ++ + L    +  ++ GG+GL IVET+LWGG
Sbjct: 123 PIFLLGSAALVALGVWGGSRLAEAARIPLLISWVLLYPIAILIIRGGVGLPIVETNLWGG 182

Query: 177 LLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIML 236
           LL+T+++S  GII+S PLG+LLALGR SN+P+++  C+ +IEL RGVPLVTVLFMA +ML
Sbjct: 183 LLLTMILSSSGIILSFPLGVLLALGRRSNLPIIKGFCVAYIELIRGVPLVTVLFMAQLML 242

Query: 237 PLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRL 296
           PLFLPD   +D +LRA++ V+ F++AY+AE +RGGLQS+ +GQ EAA +LGL+ +Q   L
Sbjct: 243 PLFLPDQVRIDSVLRAMVAVTLFSAAYLAENVRGGLQSLPRGQTEAARALGLNPVQTTLL 302

Query: 297 IIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPT--TG 354
           I +PQ ++ VIP +V  FI LFKD+SL+ I+ + DLLGI R  +S++ W           
Sbjct: 303 ITLPQALRAVIPVLVGQFISLFKDTSLVVIVGLIDLLGIARTIYSQAEWKDFTGGVWRET 362

Query: 355 LIFIGFVFWIFCFSISLYSVFIEKTLHKGSK 385
           L+ +  ++WIF F++S  S  IE+ +  G +
Sbjct: 363 LLVVALIYWIFSFTMSRTSKKIEEKMSVGYR 393


>gi|160899041|ref|YP_001564623.1| polar amino acid ABC transporter inner membrane protein [Delftia
           acidovorans SPH-1]
 gi|160364625|gb|ABX36238.1| polar amino acid ABC transporter, inner membrane subunit [Delftia
           acidovorans SPH-1]
          Length = 360

 Score =  184 bits (467), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 123/375 (32%), Positives = 205/375 (54%), Gaps = 21/375 (5%)

Query: 9   PYVRKRLLQPSLP--PVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFL 66
             +R   L  + P  P+ QR     +  + F      L+TA ++   L++   ++ W  L
Sbjct: 3   AVLRAPALPVAPPRVPLAQR-----LRASLFPDALSGLITATLLLAALWAGWKLLAWGLL 57

Query: 67  DAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTG 126
           DA    +N   C   +           ACW  + D+Y     G YPMA++WRP+   L  
Sbjct: 58  DAE-TAANPNTCRAAA----------GACWGVVRDKYRLVFLGRYPMAEQWRPVAASLLL 106

Query: 127 SILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFF 186
              +    +P F  +   ++LL GL   F   +  G  GL+ V + LWGGL +TL ++  
Sbjct: 107 LGSVGVAALPRFFGRAGMAMLLAGLT-GFGVLMAGGVAGLAPVPSDLWGGLPLTLFLAVI 165

Query: 187 GIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDV 246
             +  +PLGILLALGR S++P++R  C  FIE  RGVPL+T+LF  + +LP+ +P  W V
Sbjct: 166 ACLAGVPLGILLALGRRSSLPLIRILCTGFIEAVRGVPLITLLFFGAFVLPMLVPAQWRV 225

Query: 247 DKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRV 306
           D ++R  + ++AF++AY+AEV RGGLQ++ +GQ  AA ++G + +Q +R +++PQ ++  
Sbjct: 226 DPMVRIAVCLAAFSAAYLAEVFRGGLQAVPQGQVMAAQAMGFTRVQVLRHVVLPQALRVT 285

Query: 307 IPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFC 366
           I   V+ FIG  KD+SL++I+N++D+ G +++  S+  WI+        + +  V+ +  
Sbjct: 286 IAPTVSNFIGAVKDTSLVAIVNIYDITGSLKMAMSDPHWIAYF--VEMYMVVCTVYLLIG 343

Query: 367 FSISLYSVFIEKTLH 381
             I+ Y  F+E    
Sbjct: 344 LGIARYGRFLESRYA 358


>gi|126659707|ref|ZP_01730836.1| Amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine [Cyanothece sp. CCY0110]
 gi|126619052|gb|EAZ89792.1| Amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine [Cyanothece sp. CCY0110]
          Length = 391

 Score =  184 bits (466), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 124/383 (32%), Positives = 195/383 (50%), Gaps = 33/383 (8%)

Query: 28  IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQ 87
            ++WI KN F +  + LLT + +  + +    +I WVF  A W      +          
Sbjct: 11  PVSWIKKNLFSSWFNSLLTIISLLFIYWLGHRLISWVFFQAQWQVITANLRLFFVGQYPA 70

Query: 88  PDGWNAACWAFIYDRYEQFIFGNY-PMAQRWRPILVFLTGSILLTPMLIP---------- 136
              W A     I      F  G        +  I + +   + L  +L+           
Sbjct: 71  NLLWRAWTSLAIIISLLGFSLGTLSNKNNLFNSINLIILALVALIIVLLAVPISLISSVK 130

Query: 137 --------------------SFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGG 176
                                FP       L++ L       +L G L L  V    + G
Sbjct: 131 LLGILFLFVVFLIIGQRISQKFPNVKSWLSLIWILSFFLLLGLLQGILFLGNVRLDDFSG 190

Query: 177 LLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIML 236
           L++T+ ++   II+S P G+LLALGR SN+P++R+  I++IEL RG+PL+ +LFMA +ML
Sbjct: 191 LILTVFVAIISIILSFPFGVLLALGRQSNLPIIRWLSISYIELIRGLPLIGILFMAQVML 250

Query: 237 PLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRL 296
           PL LP    + +++RA+ G + F++AY+AE +RGGLQS+ +GQ EAA +LGL+    + L
Sbjct: 251 PLILPQEMRIQRVIRAIAGFTLFSAAYLAENVRGGLQSVPQGQTEAAKALGLNTFFVLIL 310

Query: 297 IIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLI 356
           +++PQ ++ VIP IV  FI LFKD+SL++I+ + DLLGI +   +   +I         I
Sbjct: 311 VVLPQALRVVIPTIVGQFISLFKDTSLLAIVGLVDLLGISQSILANPKFIGRYG--EVYI 368

Query: 357 FIGFVFWIFCFSISLYSVFIEKT 379
           F+  ++WIFC+S+SL S  +EK 
Sbjct: 369 FVAAIYWIFCYSMSLISRQLEKK 391


>gi|254456396|ref|ZP_05069825.1| amino acid ABC transporter, permease protein [Candidatus
           Pelagibacter sp. HTCC7211]
 gi|207083398|gb|EDZ60824.1| amino acid ABC transporter, permease protein [Candidatus
           Pelagibacter sp. HTCC7211]
          Length = 480

 Score =  184 bits (466), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 129/413 (31%), Positives = 208/413 (50%), Gaps = 75/413 (18%)

Query: 34  KNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNA 93
           KN      +  L+ LI+ +++ S+P ++ W  LDA   G ++ VCT              
Sbjct: 81  KNINTNSFNAFLSLLIVFVVIKSLPPLLSWFILDASIAGDSKDVCTG-----------TG 129

Query: 94  ACWAFIYDRYEQFIFGNYPMAQRWR----------------------------------- 118
           ACW +I   + +F++G YP A++WR                                   
Sbjct: 130 ACWTYIKIWFNRFMYGMYPNAEQWRINLSFIALAFLGTIGFFATEKFKKYLTLYYVVVYP 189

Query: 119 ---------------PILVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGG 163
                              F  G I     +I  F       +  F + PI  + +L   
Sbjct: 190 VIAFFFIFFFISGGPIFFDFSYGIIASVLSIIIGFFIPPKFKMYYFIIVPITLYILLKYV 249

Query: 164 L------------GLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRY 211
                         L  VET  WGGL +T ++SFF +I   P+G+ L+LGR S+ P+++Y
Sbjct: 250 FFYEELIELGKLEALEWVETGAWGGLSLTFIVSFFCLIFCFPIGLFLSLGRRSDFPIIKY 309

Query: 212 ACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGG 271
             I  IE +RGVPL+TVLFM+S+M P+FLP+   +DKL+R ++ +S F +AY+AEV+RGG
Sbjct: 310 ISIGMIEFWRGVPLITVLFMSSVMFPMFLPEDMFIDKLVRVIIAISLFEAAYVAEVIRGG 369

Query: 272 LQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFD 331
           LQ++ +GQ++AA SLG+ Y +   L+I+PQ +K VIPGI NTF+ L KD+ LI ++ + +
Sbjct: 370 LQALPRGQYDAAKSLGMGYWKMHILVILPQALKLVIPGIANTFLALVKDTPLIFVVGLLE 429

Query: 332 LLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
           ++G++ +  +   W+       G +F   +F+I C+++S YS  +E+      
Sbjct: 430 IVGMLNLAKTNPEWLG--FAMEGYVFASVLFFIICYAMSKYSYNLEQKYKTER 480


>gi|39935696|ref|NP_947972.1| polar amino acid ABC transport system protein AapM-2
           [Rhodopseudomonas palustris CGA009]
 gi|39649549|emb|CAE28071.1| polar amino acid ABC transport system protein, aapM-2
           [Rhodopseudomonas palustris CGA009]
          Length = 360

 Score =  183 bits (465), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 112/351 (31%), Positives = 198/351 (56%), Gaps = 15/351 (4%)

Query: 36  FFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAAC 95
            FG  +  L+T  +  L+L+    ++ W+ LDA W GS+                   AC
Sbjct: 25  LFGGWRRALVTFAVWALILWLGVPLLRWLLLDATWQGSSAE-----------CAARGGAC 73

Query: 96  WAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIF 155
           WAF+  +   F+F  YP    WRP+ V      LL    +P         ++ + +    
Sbjct: 74  WAFVAAKLRFFLFAFYPAEWLWRPVAVCGLLIALLLASAMPRLWG--ARLVVAWPVVIGL 131

Query: 156 SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACIT 215
              ++ G  G ++V ++ WGGL +TL++       S+P+ +LL+L R S + ++R+  I 
Sbjct: 132 CLALMSGLPGGAVVSSNQWGGLPITLLVWVICFATSVPIAVLLSLARRSRMRIVRWLAIG 191

Query: 216 FIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSI 275
           +IEL R +P+V +L+ A+++LP+ LP +  +DKL RA++ ++ F +AY+AEV+RGGLQ++
Sbjct: 192 YIELMRAIPMVAILYFATLILPMALPGSVPLDKLPRAIVMLALFWTAYVAEVVRGGLQAV 251

Query: 276 SKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGI 335
            +GQ EAA +LGL Y + MRLI++PQ ++ V+PG+VN  IG    +SL+++I + D+LG 
Sbjct: 252 PRGQEEAALALGLGYWRSMRLIVLPQALRAVVPGLVNLGIGFLLATSLLAVIGIMDILGA 311

Query: 336 VRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
            +   ++  W+         + +  V+++ C+S S YS+++E+ L   + +
Sbjct: 312 AKAAAADPEWLGYYK--EAFLVVALVYFVMCYSGSRYSLWLERRLGTFNGR 360


>gi|330945316|gb|EGH46938.1| amino acid ABC transporter permease [Pseudomonas syringae pv. pisi
           str. 1704B]
          Length = 252

 Score =  183 bits (465), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 138/254 (54%), Positives = 186/254 (73%), Gaps = 3/254 (1%)

Query: 134 LIPSFPRKFLNSILLFGLFPIFSF-FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISM 192
            I  FPRK +  I    ++P+ +F  +  G  GL+ V TS WGGL++TLVI+  GI+ ++
Sbjct: 1   FISKFPRKAVYGITFLVIYPVVAFYLLHGGAFGLTNVPTSQWGGLMLTLVIATVGIVGAL 60

Query: 193 PLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRA 252
           PLGILLALGR SN+P +R  C+TFIE +RGVPL+TVLFM+S+MLPLF+P+  + DKLLRA
Sbjct: 61  PLGILLALGRRSNMPAVRVVCVTFIEFWRGVPLITVLFMSSVMLPLFMPEGMNFDKLLRA 120

Query: 253 LLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVN 312
           L+GV  F SAYIAEV+RGG+Q+I KGQ+EAA+++GL Y + M L+I+PQ +K VIPGIVN
Sbjct: 121 LIGVILFQSAYIAEVVRGGMQAIPKGQYEAASAMGLGYWRSMGLVILPQALKMVIPGIVN 180

Query: 313 TFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLY 372
           TFI LFKD+SL+ II +FDLL  V+   ++  W+     T G +F   VFWIFCF +S Y
Sbjct: 181 TFIALFKDTSLVIIIGLFDLLNSVKQATADPAWLG--MATEGYVFAALVFWIFCFGMSRY 238

Query: 373 SVFIEKTLHKGSKK 386
           S+ +E+ L  G K+
Sbjct: 239 SMHLERKLDTGHKR 252


>gi|83592120|ref|YP_425872.1| amino acid ABC transporter permease [Rhodospirillum rubrum ATCC
           11170]
 gi|83575034|gb|ABC21585.1| Amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine [Rhodospirillum rubrum ATCC 11170]
          Length = 367

 Score =  181 bits (460), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 123/372 (33%), Positives = 200/372 (53%), Gaps = 15/372 (4%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
                P   P       A   +  FG+  + LLT L++ +L + +P ++ W  +DAVW G
Sbjct: 9   DSPAPPRRAPDTSLSGWARWREGLFGSLGNTLLTLLVLAVLAWVVPPLVRWAVIDAVWSG 68

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
                              + ACWAF+ ++    +FG YP A +  P L  L    LL  
Sbjct: 69  P-----------AEACAARSGACWAFLAEKTRFILFGLYPAAAQGAPALASLLLGALLVA 117

Query: 133 MLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISM 192
             +P    +  N ++ + L P+ +  V+ G      V T  WGGL +TL+++   +  + 
Sbjct: 118 SGLPRLWGR--NLLVAWILVPLLAVLVMAGVFSGLRVGTDQWGGLPLTLLLTTVAMGGAF 175

Query: 193 PLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRA 252
           PL ++LAL R S   + R   +  IE  RGVPL+TVL+ A +++PL LP    +DKLLRA
Sbjct: 176 PLAVVLALARRSRFRLFRLMAVCVIEGVRGVPLITVLYGAILLVPLMLPAGTAIDKLLRA 235

Query: 253 LLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVN 312
              +  F ++Y+AE++R GLQ+I  GQ+EAA SLGL Y   MRL+++PQ ++ VIP IV 
Sbjct: 236 QGAILLFTASYLAEIIRAGLQAIPPGQYEAARSLGLGYGLTMRLVVLPQALRLVIPSIVT 295

Query: 313 TFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLY 372
             IG+ +D++L+++I + DLL   ++  ++  W+     T G   +  +++  CF+ S Y
Sbjct: 296 LAIGILQDTTLVAVIGIHDLLSASKLAATDPDWLGFY--TEGFCLVATLYFALCFAASRY 353

Query: 373 SVFIEKTLHKGS 384
           S+++E+ L +G 
Sbjct: 354 SLWLERYLARGQ 365


>gi|114706426|ref|ZP_01439328.1| polar amino acid ABC transport permease protein aapM-1 [Fulvimarina
           pelagi HTCC2506]
 gi|114538287|gb|EAU41409.1| polar amino acid ABC transport permease protein aapM-1 [Fulvimarina
           pelagi HTCC2506]
          Length = 497

 Score =  181 bits (458), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 138/266 (51%), Positives = 190/266 (71%)

Query: 121 LVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVT 180
            V   G+I L+ M+     +  + S++   +      F +     L  V T+LWGGL++T
Sbjct: 232 FVATLGAIGLSMMVGFGSGQTTIKSMVAPLVIAALFIFAMTADFDLRYVPTNLWGGLMLT 291

Query: 181 LVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFL 240
           LV++  GI  S+P G+LLALGR S++P +R  C+ FIE +RGVPL+TVLFMA+ MLPLF+
Sbjct: 292 LVVALSGIAASLPFGVLLALGRRSHMPAVRLICVIFIEFWRGVPLITVLFMATFMLPLFM 351

Query: 241 PDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMP 300
           P+  + + LLRAL+GV+ FASAY+AEV+RGGLQ+I KGQ+E A+++ LSY QK RLII+P
Sbjct: 352 PEGVNFNSLLRALVGVALFASAYMAEVVRGGLQAIPKGQYEGADAMALSYWQKTRLIILP 411

Query: 301 QVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGF 360
           Q +K VIPGIVNTFIGLFKD+SL+ II + DLLG V+  F++  WI+  TP TGL+F  F
Sbjct: 412 QALKIVIPGIVNTFIGLFKDTSLVYIIGLADLLGTVKRGFADPNWITPTTPATGLLFAAF 471

Query: 361 VFWIFCFSISLYSVFIEKTLHKGSKK 386
           V+W FCF +S YS+F+E+ L  G K+
Sbjct: 472 VYWCFCFGMSRYSIFVERRLDTGHKR 497



 Score =  109 bits (271), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 64/231 (27%), Positives = 109/231 (47%), Gaps = 7/231 (3%)

Query: 9   PYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDA 68
            YV  + L     P    G IA + KN F TP D +LT +    ++++I  +  +V+LDA
Sbjct: 7   AYVSTKELPQLPAPRNDAGPIAVLRKNLFATPVDTILTLVCGLFIVWAIWNLFSFVWLDA 66

Query: 69  VWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSI 128
           V+ G++R  C     G         ACWAF+  +  QF++G YP A+RWR   VFL  ++
Sbjct: 67  VFEGADREACLVEGGG------HGGACWAFVEAKLGQFVYGTYPSAERWRVDTVFLLLAL 120

Query: 129 LLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGI 188
           L   +LIP+ P K +N+ILLF +FP+ +  VL  G    +   ++    ++    +   +
Sbjct: 121 LTAGLLIPNVPYKRINAILLFAVFPVVT-LVLLTGGEFELAGGAIALVFVLAAAATLSAV 179

Query: 189 IISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLF 239
                + +     R +   +L    +  I +    P   +L  +  +L + 
Sbjct: 180 GSVPRISLSRLEMRIATWLLLGAIALMLIAIVLDTPTFEILGFSFSLLTML 230


>gi|90419551|ref|ZP_01227461.1| amino acid ABC transporter, permease protein [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90336488|gb|EAS50229.1| amino acid ABC transporter, permease protein [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 499

 Score =  181 bits (458), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 138/268 (51%), Positives = 188/268 (70%), Gaps = 4/268 (1%)

Query: 122 VFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIF----SFFVLYGGLGLSIVETSLWGGL 177
            F+     +   +   F      + +   L P         ++ G  GL  V T+LWGGL
Sbjct: 231 AFVASLAAIALAVWAGFHAGSEGAGVFGLLVPTLAALAFIVLMTGDFGLRPVPTNLWGGL 290

Query: 178 LVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLP 237
           +VTLV++  GI  S+PLGILLALGR S++P +R  CI FIE +RGVPL+TVLFMA+ MLP
Sbjct: 291 MVTLVVAVSGIAASLPLGILLALGRRSSMPAVRLFCIVFIEFWRGVPLITVLFMANFMLP 350

Query: 238 LFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLI 297
           LFLP+    ++LLRAL+GV+ F++AY+AEV+RGGLQ+I KGQ+E A+++ L+Y QKMR+I
Sbjct: 351 LFLPEGVTFNQLLRALVGVALFSAAYMAEVIRGGLQAIPKGQYEGADAMALTYWQKMRMI 410

Query: 298 IMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIF 357
           I+PQ +  VIPGIVNTFIGLFKD+SL+ II + DLLG VR  F++  WI+  TP TGL+F
Sbjct: 411 ILPQALTLVIPGIVNTFIGLFKDTSLVYIIGLADLLGTVRRGFNDPDWITPTTPATGLVF 470

Query: 358 IGFVFWIFCFSISLYSVFIEKTLHKGSK 385
             F++W+FCFS+S YS++ E+ L  G K
Sbjct: 471 AAFIYWLFCFSMSRYSIYTERRLDTGHK 498



 Score = 95.2 bits (235), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 50/150 (33%), Positives = 81/150 (54%), Gaps = 6/150 (4%)

Query: 10  YVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAV 69
           +V      P  PP  + G I  + +N F TP D +L+ +    ++++   I +W +LDAV
Sbjct: 8   FVSTEEKLPLPPPPSEVGFIGNVRRNLFATPLDSVLSVIAGAFIVWAAMNIFNWAWLDAV 67

Query: 70  WIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSIL 129
           + GS+RT C     G         ACWAF+  ++ QF++G YP  +RWR  +  +  ++L
Sbjct: 68  FTGSDRTACLVEDGG------HGGACWAFVSAKFGQFMYGVYPFGERWRIDVTVVLLALL 121

Query: 130 LTPMLIPSFPRKFLNSILLFGLFPIFSFFV 159
           +  + IP  P K LN+ILLF +FP  +  +
Sbjct: 122 VAGLAIPRMPHKRLNAILLFAVFPFVALVL 151


>gi|313902270|ref|ZP_07835675.1| polar amino acid ABC transporter, inner membrane subunit
           [Thermaerobacter subterraneus DSM 13965]
 gi|313467421|gb|EFR62930.1| polar amino acid ABC transporter, inner membrane subunit
           [Thermaerobacter subterraneus DSM 13965]
          Length = 375

 Score =  179 bits (454), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 117/376 (31%), Positives = 184/376 (48%), Gaps = 32/376 (8%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
              + P   P  QR   AW  +N   +    LLT + + +L  +   ++ W F       
Sbjct: 29  TVAVPPPQAPWPQRAA-AWARQNLLASWYHGLLTLVALAILALAGRAVLSWAF------- 80

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
                                A W  + D     + G YP  Q WR +   +  ++L+  
Sbjct: 81  -------------------GRARWDVVTDNLLLLLVGAYPRDQLWRVVAALVLLAVLVVV 121

Query: 133 MLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLW---GGLLVTLVISFFGII 189
             +            +  +            L LS+          GL++TLV++  GI 
Sbjct: 122 SGLAWAGPARWRRAQMPVVAAWVVLVPAAMVLVLSVPRQGGAGTGYGLILTLVLAVAGIT 181

Query: 190 ISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKL 249
           +S PLG+LLALGR S++PV+R   I +IEL RG PL+ VLF +   LPLFLP +   D +
Sbjct: 182 LSFPLGVLLALGRVSSLPVVRALSIAYIELVRGTPLMVVLFFSMTALPLFLPPSVRPDLV 241

Query: 250 LRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPG 309
            RA  G+  F +AY+AE +RGGLQ + +GQ EAA +LGL+  Q + LII+PQ ++ VIP 
Sbjct: 242 TRAAAGLVLFTAAYVAEAVRGGLQGVPRGQVEAAQALGLTGTQAVLLIILPQALRAVIPA 301

Query: 310 IVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSI 369
           +V  FI LFKD+SL+++  + + +G+ +   S  +++          F+  V+W+FC+ +
Sbjct: 302 LVGQFISLFKDTSLVAVWGLLEFVGVAQSVLSNPSYLG--RHVEMYAFVAAVYWVFCYGM 359

Query: 370 SLYSVFIEKTLHKGSK 385
           SL S  +E+ L  G +
Sbjct: 360 SLASRRLERRLGVGER 375


>gi|222151827|ref|YP_002560987.1| glutamine-binding periplasmic protein homolog [Macrococcus
           caseolyticus JCSC5402]
 gi|222120956|dbj|BAH18291.1| glutamine-binding periplasmic protein homolog [Macrococcus
           caseolyticus JCSC5402]
          Length = 483

 Score =  179 bits (454), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 66/214 (30%), Positives = 110/214 (51%), Gaps = 7/214 (3%)

Query: 171 TSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLF 230
           T    G+  T+VIS  G+++    G +LA  + S   + R     +IE  RG PL+  +F
Sbjct: 277 TFFIQGIGGTIVISLIGVLLGSLFGGILAFMKLSKNIIARTISWIYIEFIRGTPLLVQVF 336

Query: 231 MASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSY 290
           +             D+   +   + +    +AYIAE++R G++++ KGQ EAA SLGLS+
Sbjct: 337 LVY--FGTTAVLGIDLSAFICGAIALVINCAAYIAEIIRAGIKAVDKGQMEAARSLGLSH 394

Query: 291 LQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVT 350
            Q M  +IMPQ IK+++P + N FI + K+SS++S+I + +L+   +V    S       
Sbjct: 395 SQAMNKVIMPQAIKKILPALGNEFITVIKESSIVSVIGVSELMFNAQVVQGAS-----FD 449

Query: 351 PTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
           P T L+    V++I  F +S      E+ +    
Sbjct: 450 PFTPLLIAAVVYFILTFGLSRVMNVFERRMSVSD 483


>gi|113475661|ref|YP_721722.1| polar amino acid ABC transporter inner membrane subunit
           [Trichodesmium erythraeum IMS101]
 gi|110166709|gb|ABG51249.1| polar amino acid ABC transporter, inner membrane subunit
           [Trichodesmium erythraeum IMS101]
          Length = 403

 Score =  178 bits (452), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 126/393 (32%), Positives = 205/393 (52%), Gaps = 32/393 (8%)

Query: 20  LPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCT 79
            PP  +   I W+ +NFF T  + LL+ ++  L+L+ +   I W   +A W      +  
Sbjct: 11  APPFPENNAIKWLRENFFSTWYNTLLSLILFSLILWGVINFISWAKTEAEWQVIKVNLPL 70

Query: 80  TVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIP--- 136
            +     +   W       I      F +G           L  L G   L  +++    
Sbjct: 71  LMVGRYPRDQYWRIWVIVGIISSLFGFSWGVIARNSAQLFTLPVLIGIAFLPVIILIIPV 130

Query: 137 ---------------------------SFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIV 169
                                         +        + +  I   +++ GGLGL  V
Sbjct: 131 NVFFKLLLLGMVILVVATAWSGKKLSIKNSKLGKYLSFYWLIAFILIVWLIGGGLGLKSV 190

Query: 170 ETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVL 229
            T+ WGGL++T++++   I +S PLG+LLALGR S +PV+R   I +IE+ RG+PL+++L
Sbjct: 191 STNDWGGLMLTVLMAVVSIFLSFPLGVLLALGRQSTLPVIRIFSIGYIEIIRGLPLISIL 250

Query: 230 FMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLS 289
           FM  I++PLFLPD    D++ RA+LG++ F++AY+AE +RGGLQS+ +GQ EAA +LGL+
Sbjct: 251 FMGQILIPLFLPDGMRPDRIFRAILGLTLFSAAYLAENVRGGLQSVLRGQSEAAKALGLN 310

Query: 290 YLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSV 349
               + LI++PQ +K  IP IV  FI LF+D++L+SI+ + +LLGI R   ++  ++   
Sbjct: 311 TPLSLGLIVLPQALKVAIPSIVGQFISLFQDTTLLSIVGLVELLGISRSILAQPEFLGDY 370

Query: 350 TPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHK 382
                 +F G +FWI C+++S+ S  +EK L+ 
Sbjct: 371 A--EVYLFDGIIFWIVCYAMSVGSRQLEKKLNT 401


>gi|282851008|ref|ZP_06260382.1| ABC transporter, permease protein [Lactobacillus gasseri 224-1]
 gi|311111018|ref|ZP_07712415.1| amino acid ABC transporter, permease/substrate-binding protein
           [Lactobacillus gasseri MV-22]
 gi|282557960|gb|EFB63548.1| ABC transporter, permease protein [Lactobacillus gasseri 224-1]
 gi|311066172|gb|EFQ46512.1| amino acid ABC transporter, permease/substrate-binding protein
           [Lactobacillus gasseri MV-22]
          Length = 498

 Score =  178 bits (450), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 66/210 (31%), Positives = 113/210 (53%), Gaps = 8/210 (3%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
            + G+  T+VI+ F +II + LGI+LAL R S  P+L +  + +IE  RG P +  +   
Sbjct: 292 FFKGIWYTIVITVFSVIIGIVLGIILALMRLSKNPILHWLAVCYIEFIRGTPQMVQILFV 351

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
              +   +    ++  L+  ++ +   + AY+AE +R G+ S+ KGQ EAA SLGLS  +
Sbjct: 352 YFGIGYLIS---NLSALVAGIIAIGLNSGAYVAEDIRSGIDSLPKGQMEAARSLGLSRQK 408

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPT 352
             R +I+PQ IK + P + N FI L KDSSL+S+I + +L+   ++  + +         
Sbjct: 409 AFRYVIIPQAIKNIWPALGNEFITLLKDSSLVSVIGVAELMYQTQLVQTST-----YKGV 463

Query: 353 TGLIFIGFVFWIFCFSISLYSVFIEKTLHK 382
             L     +++I  FS++      EK + +
Sbjct: 464 LPLFIAMIIYFIMTFSLTRLLNHFEKRMKR 493


>gi|238853899|ref|ZP_04644262.1| ABC-type amino acid transport system, permease and periplasmic
           component [Lactobacillus gasseri 202-4]
 gi|238833485|gb|EEQ25759.1| ABC-type amino acid transport system, permease and periplasmic
           component [Lactobacillus gasseri 202-4]
          Length = 498

 Score =  178 bits (450), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 66/210 (31%), Positives = 113/210 (53%), Gaps = 8/210 (3%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
            + G+  T+VI+ F +II + LGI+LAL R S  P+L +  + +IE  RG P +  +   
Sbjct: 292 FFKGIWYTIVITVFSVIIGIVLGIILALMRLSKNPILHWLAVCYIEFIRGTPQMVQILFV 351

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
              +   +    ++  L+  ++ +   + AY+AE +R G+ S+ KGQ EAA SLGLS  +
Sbjct: 352 YFGIGYLIS---NLSALVAGIIAIGLNSGAYVAEDIRSGIDSLPKGQMEAARSLGLSRQK 408

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPT 352
             R +I+PQ IK + P + N FI L KDSSL+S+I + +L+   ++  + +         
Sbjct: 409 AFRYVIIPQAIKNIWPALGNEFITLLKDSSLVSVIGVAELMYQTQLVQTST-----YKGV 463

Query: 353 TGLIFIGFVFWIFCFSISLYSVFIEKTLHK 382
             L     +++I  FS++      EK + +
Sbjct: 464 LPLFIAMIIYFIMTFSLTRLLNHFEKRMKR 493


>gi|116629207|ref|YP_814379.1| ABC-type amino acid transport system, permease and periplasmic
           component [Lactobacillus gasseri ATCC 33323]
 gi|116094789|gb|ABJ59941.1| amino acid ABC transporter membrane protein, PAAT family / amino
           acid ABC transporter substrate-binding protein, PAAT
           family [Lactobacillus gasseri ATCC 33323]
          Length = 501

 Score =  178 bits (450), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 66/210 (31%), Positives = 113/210 (53%), Gaps = 8/210 (3%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
            + G+  T+VI+ F +II + LGI+LAL R S  P+L +  + +IE  RG P +  +   
Sbjct: 295 FFKGIWYTIVITVFSVIIGIVLGIILALMRLSKNPILHWLAVCYIEFIRGTPQMVQILFV 354

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
              +   +    ++  L+  ++ +   + AY+AE +R G+ S+ KGQ EAA SLGLS  +
Sbjct: 355 YFGIGYLIS---NLSALVAGIIAIGLNSGAYVAEDIRSGIDSLPKGQMEAARSLGLSRQK 411

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPT 352
             R +I+PQ IK + P + N FI L KDSSL+S+I + +L+   ++  + +         
Sbjct: 412 AFRYVIIPQAIKNIWPALGNEFITLLKDSSLVSVIGVAELMYQTQLVQTST-----YKGV 466

Query: 353 TGLIFIGFVFWIFCFSISLYSVFIEKTLHK 382
             L     +++I  FS++      EK + +
Sbjct: 467 LPLFIAMIIYFIMTFSLTRLLNHFEKRMKR 496


>gi|209885183|ref|YP_002289040.1| general L-amino acid transport system permease protein AapM
           [Oligotropha carboxidovorans OM5]
 gi|209873379|gb|ACI93175.1| general L-amino acid transport system permease protein AapM
           [Oligotropha carboxidovorans OM5]
          Length = 454

 Score =  177 bits (449), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 131/459 (28%), Positives = 206/459 (44%), Gaps = 80/459 (17%)

Query: 2   IDSCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGII 61
           + +  +  +VR  L     PPV   GII  +    F +P +ILLT +   +L   +   I
Sbjct: 1   MSNGTDTNFVRGALAPERQPPVVTTGIIGLMRTRLFNSPTNILLTLISAVVLWLLLVPTI 60

Query: 62  HWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPIL 121
            ++F+DAVW GS+RT C   + G         ACW FI  ++ Q I+G YP  QRWR  L
Sbjct: 61  RFLFIDAVWQGSDRTACLAENAGHPV-----GACWPFIQAKFTQLIYGFYPEDQRWRANL 115

Query: 122 VFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLY-------------GGLGLSI 168
            F    +LL P+L+P  P K LN+ L F  FP  +FF+L+                G + 
Sbjct: 116 TFALAVLLLAPLLVPKIPHKALNAALFFIAFPFLAFFLLHGGGLDGFAFYWIAELFGAAW 175

Query: 169 VETSLWGGLLVTLVISFFGIIISMPLGILLALGR-------------------------- 202
             +        ++  +F  + +    G      R                          
Sbjct: 176 TPSLTRFWFDFSMTAAFVTMAMLWFGGGWPNGRRAALSSALTFAGIAVVIVALRLDQGGL 235

Query: 203 -----NSNIPVLRYACITFIELFRGVPL-VTVLFMASIMLPLFLPDTWDVDKLLRAL-LG 255
                     +L    ++   +   +P+ + +    +  +PL    +    +  R + L 
Sbjct: 236 PIVDTRQWGGLLVTLVVSVTGIVASMPVGIALALGRTSRIPLLRAFSVMFIEFWRGVPLI 295

Query: 256 VSAFASAYI-----------------------------AEVLRGGLQSISKGQFEAANSL 286
              F + Y+                             AEV+RGGL +I +GQ EAAN+L
Sbjct: 296 TVLFFATYMLPLFLPGDFTIDALVRVLVGIALFAGAYNAEVIRGGLLAIPRGQREAANAL 355

Query: 287 GLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWI 346
           GLSY +   LI++PQ ++ VIP +VN+FI LFKD++L+ I+ +FDLLG +R  F++  W 
Sbjct: 356 GLSYWKTTGLIVLPQALRHVIPSLVNSFIALFKDTTLVLIVALFDLLGQLRATFADPVWA 415

Query: 347 SSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSK 385
           +  T  TG  F G ++WI CF++S YS+F+E+ L    +
Sbjct: 416 TPTTLFTGFAFTGIIYWIGCFAMSRYSLFVERRLDPHRR 454


>gi|323441690|gb|EGA99335.1| substrate-binding glutamine ABC transporter [Staphylococcus aureus
           O46]
          Length = 467

 Score =  176 bits (445), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 66/226 (29%), Positives = 119/226 (52%), Gaps = 7/226 (3%)

Query: 159 VLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIE 218
           +      +S   +    G+ +T++IS  G+ +   LG  +AL + S I V+ +    +IE
Sbjct: 249 MNDDSGFISKYGSFFLKGIKITILISLIGVALGSILGAFVALMKLSKIKVISWIASIYIE 308

Query: 219 LFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKG 278
           + RG P++  +F+      +      D+  L+   + +   +SAYIAE++R G+ ++ KG
Sbjct: 309 ILRGTPMLVQVFIVF--FGITAALGLDISALVCGTIALVINSSAYIAEIIRAGINAVDKG 366

Query: 279 QFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRV 338
           Q EAA SLGL+Y Q M+ +IMPQ IK ++P + N F+ L K+SS++S I + +++   +V
Sbjct: 367 QMEAARSLGLNYRQTMKSVIMPQAIKNILPALGNEFVTLIKESSIVSTIGVGEIMFNAQV 426

Query: 339 NFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
               S       P T L+    ++++  F ++     IE  L+   
Sbjct: 427 VQGIS-----FDPFTPLLVAAALYFVLTFVLTRIMNMIEGRLNASD 467


>gi|224476916|ref|YP_002634522.1| hypothetical protein Sca_1432 [Staphylococcus carnosus subsp.
           carnosus TM300]
 gi|222421523|emb|CAL28337.1| conserved hypothetical protein [Staphylococcus carnosus subsp.
           carnosus TM300]
          Length = 491

 Score =  176 bits (445), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 63/215 (29%), Positives = 113/215 (52%), Gaps = 7/215 (3%)

Query: 170 ETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVL 229
            +    G+  T++IS  G+++    G +LAL + S+   L++    +IE  RG PL+  +
Sbjct: 284 SSFFITGIKNTILISIIGVVLGAVFGAILALMKLSSFKPLKWLATVYIEFIRGTPLLVQV 343

Query: 230 FMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLS 289
           F+             D+  ++  ++ +    +AYIAE++R G+ ++ KGQ EAA SLGL 
Sbjct: 344 FLVF--FGTTAALGLDISAMICGMIAMVINCAAYIAEIIRAGINAVDKGQTEAARSLGLG 401

Query: 290 YLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSV 349
           Y Q M+ II+PQ IK ++P + N F+ + K+SS++S+I + +++   +V    S      
Sbjct: 402 YGQTMKTIILPQAIKNILPALGNEFVTVIKESSIVSVIGVSEIMFNAQVVQGAS-----F 456

Query: 350 TPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
            P T L+    +++I  F +S    F E  +    
Sbjct: 457 DPFTPLLVAAILYFILTFVLSRVMYFFEGRMKVSD 491


>gi|300362096|ref|ZP_07058273.1| amino acid ABC superfamily ATP binding cassette transporter,
           membrane protein [Lactobacillus gasseri JV-V03]
 gi|300354715|gb|EFJ70586.1| amino acid ABC superfamily ATP binding cassette transporter,
           membrane protein [Lactobacillus gasseri JV-V03]
          Length = 544

 Score =  175 bits (444), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 65/210 (30%), Positives = 113/210 (53%), Gaps = 8/210 (3%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
            + G+  T+VI+ F +II + LGI+LAL R S  P+L +  + +IE  RG P +  +   
Sbjct: 338 FFKGIWYTIVITVFSVIIGIVLGIILALMRLSKNPILHWLAVCYIEFIRGTPQMVQILFV 397

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
              +   +    ++  L+  ++ +   + AY+AE +R G+ S+ KGQ EAA SLGLS  +
Sbjct: 398 YFGIGYLIS---NLSALVAGIIAIGLNSGAYVAEDIRSGIDSLPKGQMEAARSLGLSRQK 454

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPT 352
             R +I+PQ IK + P + N FI L KDSSL+S+I + +L+   ++  + +         
Sbjct: 455 AFRYVIIPQAIKNIWPALGNEFITLLKDSSLVSVIGVAELMYQTQLVQTST-----YKGV 509

Query: 353 TGLIFIGFVFWIFCFSISLYSVFIEKTLHK 382
             L     ++++  FS++      EK + +
Sbjct: 510 LPLFIAMIIYFVMTFSLTRLLNHFEKRMKR 539


>gi|39935628|ref|NP_947904.1| polar amino acid ABC transport permease AapM-1 [Rhodopseudomonas
           palustris CGA009]
 gi|39649481|emb|CAE28003.1| polar amino acid ABC transport permease protein aapM-1
           [Rhodopseudomonas palustris CGA009]
          Length = 501

 Score =  175 bits (444), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 120/265 (45%), Positives = 179/265 (67%)

Query: 121 LVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVT 180
              +  +++     + +  R    ++ +F    +    +     GL +V+T +WGGLLVT
Sbjct: 236 TAVVVTALVFVLTGVRNGWRALATTVGMFAGIAVMVAALRLDRGGLPVVDTRMWGGLLVT 295

Query: 181 LVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFL 240
           LV+S  GI+ SMP+GI LALGR S IP++R   + FIE +RGVPL+TV+F A+ MLPLFL
Sbjct: 296 LVVSVTGIVASMPIGIALALGRRSTIPLIRIFSVAFIEFWRGVPLITVMFFATYMLPLFL 355

Query: 241 PDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMP 300
           P  + +D L+R L+G++ FA AY AEV+RGGL +I +GQ EAA++LGLSY +   LI++P
Sbjct: 356 PGNFTIDNLMRVLIGIALFAGAYNAEVIRGGLNAIPRGQAEAASALGLSYWKITGLIVLP 415

Query: 301 QVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGF 360
           Q ++ VIPG+VN+FI LFKD+SL+SI+ +FDLLG +R  F++ TW +  T  TG  F G 
Sbjct: 416 QALRHVIPGLVNSFIALFKDTSLVSIVALFDLLGQLRAAFADPTWSTPTTLFTGFAFTGL 475

Query: 361 VFWIFCFSISLYSVFIEKTLHKGSK 385
           ++++FCF +S YS+ +E  L+   +
Sbjct: 476 IYFVFCFGMSRYSLSVEHRLNAHRR 500



 Score = 91.3 bits (225), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 59/155 (38%), Positives = 90/155 (58%), Gaps = 5/155 (3%)

Query: 7   EFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFL 66
              +VR  ++    PPV+  G++  + +    +P +ILLT + + LL F++   + ++ +
Sbjct: 8   TPVFVRGEMVPQRPPPVHTPGVLGLVRQRLLNSPTNILLTIVGLLLLYFTVVPTVKFLLV 67

Query: 67  DAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTG 126
           DAVW GSNRT C     G         ACW F+  ++ QFI+G YP  +RWR  LVF  G
Sbjct: 68  DAVWSGSNRTDCLADKAGHPV-----GACWPFVQAKFSQFIYGFYPTPERWRVDLVFALG 122

Query: 127 SILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLY 161
           ++LL P+LIP  P K LN+ L F  FP+ +FF+L+
Sbjct: 123 ALLLLPLLIPRAPAKTLNAGLFFIAFPVLAFFLLH 157


>gi|320143581|gb|EFW35361.1| ABC transporter, permease protein [Staphylococcus aureus subsp.
           aureus MRSA177]
          Length = 467

 Score =  175 bits (444), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 66/226 (29%), Positives = 119/226 (52%), Gaps = 7/226 (3%)

Query: 159 VLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIE 218
           +      +S   +    G+ +T++IS  G+ +   LG  +AL + S I ++ +    +IE
Sbjct: 249 MNDDSGFISKYGSFFLKGIKITILISLIGVALGSILGAFVALMKLSKIKIISWIASIYIE 308

Query: 219 LFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKG 278
           + RG P++  +F+      +      D+  L+   + +   +SAYIAE++R G+ ++ KG
Sbjct: 309 ILRGTPMLVQVFIVF--FGITAALGLDISALVCGTIALVINSSAYIAEIIRAGINAVDKG 366

Query: 279 QFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRV 338
           Q EAA SLGL+Y Q M+ +IMPQ IK ++P + N F+ L K+SS++S I + +++   +V
Sbjct: 367 QMEAARSLGLNYRQTMKSVIMPQAIKNILPALGNEFVTLIKESSIVSTIGVGEIMFNAQV 426

Query: 339 NFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
               S       P T LI    ++++  F ++     IE  L+   
Sbjct: 427 VQGIS-----FDPFTPLIVAAALYFVLTFVLTRIMNMIEGRLNASD 467


>gi|315173030|gb|EFU17047.1| ABC transporter, permease protein [Enterococcus faecalis TX1346]
          Length = 722

 Score =  175 bits (444), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 59/209 (28%), Positives = 118/209 (56%), Gaps = 7/209 (3%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
           L  GL +T++++    ++++ +G++  L   S I  LR     +++L RG+PL+ + F  
Sbjct: 521 LLHGLWMTILLTLICFVLALIVGVIFGLFSVSPIKALRVLSTIYVDLIRGIPLMVLAFFI 580

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
              LP      +++   +  ++ ++  ASAYI+E++RGG++++  GQ EA+ SLGLSY +
Sbjct: 581 YFGLP--GVLGFNIPVFIAGIITLTLNASAYISEIVRGGIKAVPVGQMEASRSLGLSYNR 638

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPT 352
            M+ II+PQ I+ +IP  +N F+   KD++++S I + +LL   ++  + +        T
Sbjct: 639 TMQKIILPQAIRIMIPSFINQFVISLKDTTILSAIGLIELLQTGKIIVARTL-----QST 693

Query: 353 TGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
                I  ++ I   S++  +  +EK ++
Sbjct: 694 MVYFVIALIYLILITSLTKLAKNLEKKVN 722


>gi|86608410|ref|YP_477172.1| polar amino acid ABC transporter permease [Synechococcus sp.
           JA-2-3B'a(2-13)]
 gi|86556952|gb|ABD01909.1| polar amino amino acid ABC transporter (PAAT) family, permease
           protein [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 402

 Score =  175 bits (444), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 116/390 (29%), Positives = 180/390 (46%), Gaps = 27/390 (6%)

Query: 20  LPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG------- 72
           LPP  ++  +AW+ +N F +    LLT +   +L ++I    +W F  A W         
Sbjct: 16  LPPTEKQSPLAWVRRNLFDSWLSTLLTLVSALVLAWAISLFWNWAFTQARWEVIPANLKI 75

Query: 73  --------SNRTVCTTVSQGGIQPDGWNAACWA--------FIYDRYEQFIFGNYPMAQR 116
                   S       V    +   G     W          +        F       +
Sbjct: 76  FASGTYPSSQLWRVWAVLGIVLATLGVAGGTWGGVLLHYLILLGAAMGLAAFLPLGTQSQ 135

Query: 117 WRPILVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGG 176
               +        +         R     +    L       +   G     V T    G
Sbjct: 136 GWLAVCSGATFAAIALSRGRESWRLASIWVWALILPLCLELLLGNLGPNWPAVRTEQLSG 195

Query: 177 LLVTLVISFFGIIISMPLGILLALGRNSN-IPVLRYACITFIELFRGVPLVTVLFMASIM 235
           LL+TL+++   +II  P+G+LLALGR +  +PV+R  C   IEL RGVPL T+LF A ++
Sbjct: 196 LLLTLILAAAAMIIGFPIGVLLALGRANRALPVIRIFCTLVIELVRGVPLTTILFAAWLL 255

Query: 236 LPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMR 295
           +P FL     V+ ++RA +    F + Y+AE +RGGLQSI  GQ EAA +LGL+  Q   
Sbjct: 256 VPFFLG-GISVNLIIRAEVAFILFTAVYVAEDVRGGLQSIPLGQLEAARALGLNPFQVTA 314

Query: 296 LIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGL 355
           L+I+PQ ++  +P +VN F+ LFKD+SL+ I+ + DLL   RV F+   W+ +      L
Sbjct: 315 LVILPQALRAAVPALVNEFLTLFKDTSLVFIVGLIDLLQAGRVVFTNPNWLGTQR--EVL 372

Query: 356 IFIGFVFWIFCFSISLYSVFIEKTLHKGSK 385
            FIG +++I CF+++  +  +EK L  G +
Sbjct: 373 FFIGLIYFICCFAMAYAAQQVEKALGLGKR 402


>gi|315166947|gb|EFU10964.1| ABC transporter, permease protein [Enterococcus faecalis TX1341]
          Length = 722

 Score =  175 bits (443), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 59/209 (28%), Positives = 118/209 (56%), Gaps = 7/209 (3%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
           L  GL +T++++    ++++ +G++  L   S I  LR     +++L RG+PL+ + F  
Sbjct: 521 LLHGLWMTILLTLISFVLALIVGVIFGLFSVSPIKALRVLSTIYVDLIRGIPLMVLAFFI 580

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
              LP      +++   +  ++ ++  ASAYI+E++RGG++++  GQ EA+ SLGLSY +
Sbjct: 581 YFGLP--GVLGFNIPVFIAGIITLTLNASAYISEIVRGGIKAVPVGQMEASRSLGLSYNR 638

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPT 352
            M+ II+PQ I+ +IP  +N F+   KD++++S I + +LL   ++  + +        T
Sbjct: 639 TMQKIILPQAIRIMIPSFINQFVISLKDTTILSAIGLIELLQTGKIIVARTL-----QST 693

Query: 353 TGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
                I  ++ I   S++  +  +EK ++
Sbjct: 694 MVYFVIALIYLILITSLTKLAKNLEKKVN 722


>gi|315029877|gb|EFT41809.1| ABC transporter, permease protein [Enterococcus faecalis TX4000]
          Length = 722

 Score =  175 bits (443), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 59/209 (28%), Positives = 118/209 (56%), Gaps = 7/209 (3%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
           L  GL +T++++    ++++ +G++  L   S I  LR     +++L RG+PL+ + F  
Sbjct: 521 LLHGLWMTILLTLISFVLALIVGVIFGLFSVSPIKALRVLSTIYVDLIRGIPLMVLAFFI 580

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
              LP      +++   +  ++ ++  ASAYI+E++RGG++++  GQ EA+ SLGLSY +
Sbjct: 581 YFGLP--GVLGFNIPVFIAGIITLTLNASAYISEIVRGGIKAVPVGQMEASRSLGLSYNR 638

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPT 352
            M+ II+PQ I+ +IP  +N F+   KD++++S I + +LL   ++  + +        T
Sbjct: 639 TMQKIILPQAIRIMIPSFINQFVISLKDTTILSAIGLIELLQTGKIIVARTL-----QST 693

Query: 353 TGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
                I  ++ I   S++  +  +EK ++
Sbjct: 694 MVYFVIALIYLILITSLTKLAKNLEKKVN 722


>gi|307296217|ref|ZP_07576045.1| ABC transporter, permease protein [Enterococcus faecalis TX0411]
 gi|306496091|gb|EFM65673.1| ABC transporter, permease protein [Enterococcus faecalis TX0411]
 gi|315159996|gb|EFU04013.1| ABC transporter, permease protein [Enterococcus faecalis TX0312]
          Length = 722

 Score =  175 bits (443), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 59/209 (28%), Positives = 118/209 (56%), Gaps = 7/209 (3%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
           L  GL +T++++    ++++ +G++  L   S I  LR     +++L RG+PL+ + F  
Sbjct: 521 LLHGLWMTILLTLISFVLALIVGVIFGLFSVSPIKALRVLSTIYVDLIRGIPLMVLAFFI 580

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
              LP      +++   +  ++ ++  ASAYI+E++RGG++++  GQ EA+ SLGLSY +
Sbjct: 581 YFGLP--GVLGFNIPVFIAGIITLTLNASAYISEIVRGGIKAVPVGQMEASRSLGLSYNR 638

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPT 352
            M+ II+PQ I+ +IP  +N F+   KD++++S I + +LL   ++  + +        T
Sbjct: 639 TMQKIILPQAIRIMIPSFINQFVISLKDTTILSAIGLIELLQTGKIIVARTL-----QST 693

Query: 353 TGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
                I  ++ I   S++  +  +EK ++
Sbjct: 694 MVYFVIALIYLILITSLTKLAKNLEKKVN 722


>gi|256964404|ref|ZP_05568575.1| ABC-type amino acid transport/signal transduction system
           [Enterococcus faecalis HIP11704]
 gi|307272573|ref|ZP_07553826.1| ABC transporter, permease protein [Enterococcus faecalis TX0855]
 gi|256954900|gb|EEU71532.1| ABC-type amino acid transport/signal transduction system
           [Enterococcus faecalis HIP11704]
 gi|306510858|gb|EFM79875.1| ABC transporter, permease protein [Enterococcus faecalis TX0855]
          Length = 722

 Score =  175 bits (443), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 59/209 (28%), Positives = 118/209 (56%), Gaps = 7/209 (3%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
           L  GL +T++++    ++++ +G++  L   S I  LR     +++L RG+PL+ + F  
Sbjct: 521 LLHGLWMTILLTLISFVLALIVGVIFGLFSVSPIKALRVLSTIYVDLIRGIPLMVLAFFI 580

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
              LP      +++   +  ++ ++  ASAYI+E++RGG++++  GQ EA+ SLGLSY +
Sbjct: 581 YFGLP--GVLGFNIPVFIAGIITLTLNASAYISEIVRGGIKAVPVGQMEASRSLGLSYNR 638

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPT 352
            M+ II+PQ I+ +IP  +N F+   KD++++S I + +LL   ++  + +        T
Sbjct: 639 TMQKIILPQAIRIMIPSFINQFVISLKDTTILSAIGLIELLQTGKIIVARTL-----QST 693

Query: 353 TGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
                I  ++ I   S++  +  +EK ++
Sbjct: 694 MVYFVIALIYLILITSLTKLAKNLEKKVN 722


>gi|227517724|ref|ZP_03947773.1| amino acid ABC superfamily ATP binding cassette transporter, amino
           acid-binding/permease protein [Enterococcus faecalis
           TX0104]
 gi|229546597|ref|ZP_04435322.1| amino acid ABC superfamily ATP binding cassette transporter, amino
           acid-binding/permease protein [Enterococcus faecalis
           TX1322]
 gi|229548704|ref|ZP_04437429.1| amino acid ABC superfamily ATP binding cassette transporter, amino
           acid-binding/permease protein [Enterococcus faecalis
           ATCC 29200]
 gi|255971218|ref|ZP_05421804.1| amino acid ABC transporter [Enterococcus faecalis T1]
 gi|255973841|ref|ZP_05424427.1| aminoacid ABC transporter [Enterococcus faecalis T2]
 gi|256617647|ref|ZP_05474493.1| ABC-type amino acid transport/signal transduction system
           [Enterococcus faecalis ATCC 4200]
 gi|256854374|ref|ZP_05559738.1| amino acid ABC transporter [Enterococcus faecalis T8]
 gi|256957372|ref|ZP_05561543.1| ABC-type amino acid transport/signal transduction system
           [Enterococcus faecalis DS5]
 gi|256959892|ref|ZP_05564063.1| ABC-type amino acid transport/signal transduction system
           [Enterococcus faecalis Merz96]
 gi|257086118|ref|ZP_05580479.1| ABC-type amino acid transport/signal transduction system
           [Enterococcus faecalis D6]
 gi|257089189|ref|ZP_05583550.1| ABC amino acid transporter [Enterococcus faecalis CH188]
 gi|257415331|ref|ZP_05592325.1| ABC-type amino acid transport/signal transduction system
           [Enterococcus faecalis AR01/DG]
 gi|257421017|ref|ZP_05598007.1| ABC amino acid transporter [Enterococcus faecalis X98]
 gi|293384723|ref|ZP_06630577.1| glutamine ABC transporter, glutamine-binding protein/permease
           protein [Enterococcus faecalis R712]
 gi|293387465|ref|ZP_06632017.1| glutamine ABC transporter, glutamine-binding protein/permease
           protein [Enterococcus faecalis S613]
 gi|294781574|ref|ZP_06746911.1| ABC transporter, permease protein [Enterococcus faecalis PC1.1]
 gi|300862075|ref|ZP_07108155.1| ABC transporter, permease protein [Enterococcus faecalis TUSoD
           Ef11]
 gi|307269814|ref|ZP_07551144.1| ABC transporter, permease protein [Enterococcus faecalis TX4248]
 gi|307276261|ref|ZP_07557389.1| ABC transporter, permease protein [Enterococcus faecalis TX2134]
 gi|307284476|ref|ZP_07564638.1| ABC transporter, permease protein [Enterococcus faecalis TX0860]
 gi|307289545|ref|ZP_07569490.1| ABC transporter, permease protein [Enterococcus faecalis TX0109]
 gi|312900356|ref|ZP_07759667.1| ABC transporter, permease protein [Enterococcus faecalis TX0470]
 gi|312904217|ref|ZP_07763379.1| ABC transporter, permease protein [Enterococcus faecalis TX0635]
 gi|312908578|ref|ZP_07767521.1| ABC transporter, permease protein [Enterococcus faecalis DAPTO 512]
 gi|312910503|ref|ZP_07769348.1| ABC transporter, permease protein [Enterococcus faecalis DAPTO 516]
 gi|312951870|ref|ZP_07770759.1| ABC transporter, permease protein [Enterococcus faecalis TX0102]
 gi|227074829|gb|EEI12792.1| amino acid ABC superfamily ATP binding cassette transporter, amino
           acid-binding/permease protein [Enterococcus faecalis
           TX0104]
 gi|229306170|gb|EEN72166.1| amino acid ABC superfamily ATP binding cassette transporter, amino
           acid-binding/permease protein [Enterococcus faecalis
           ATCC 29200]
 gi|229308287|gb|EEN74274.1| amino acid ABC superfamily ATP binding cassette transporter, amino
           acid-binding/permease protein [Enterococcus faecalis
           TX1322]
 gi|255962236|gb|EET94712.1| amino acid ABC transporter [Enterococcus faecalis T1]
 gi|255966713|gb|EET97335.1| aminoacid ABC transporter [Enterococcus faecalis T2]
 gi|256597174|gb|EEU16350.1| ABC-type amino acid transport/signal transduction system
           [Enterococcus faecalis ATCC 4200]
 gi|256709934|gb|EEU24978.1| amino acid ABC transporter [Enterococcus faecalis T8]
 gi|256947868|gb|EEU64500.1| ABC-type amino acid transport/signal transduction system
           [Enterococcus faecalis DS5]
 gi|256950388|gb|EEU67020.1| ABC-type amino acid transport/signal transduction system
           [Enterococcus faecalis Merz96]
 gi|256994148|gb|EEU81450.1| ABC-type amino acid transport/signal transduction system
           [Enterococcus faecalis D6]
 gi|256998001|gb|EEU84521.1| ABC amino acid transporter [Enterococcus faecalis CH188]
 gi|257157159|gb|EEU87119.1| ABC-type amino acid transport/signal transduction system
           [Enterococcus faecalis ARO1/DG]
 gi|257162841|gb|EEU92801.1| ABC amino acid transporter [Enterococcus faecalis X98]
 gi|291077973|gb|EFE15337.1| glutamine ABC transporter, glutamine-binding protein/permease
           protein [Enterococcus faecalis R712]
 gi|291083116|gb|EFE20079.1| glutamine ABC transporter, glutamine-binding protein/permease
           protein [Enterococcus faecalis S613]
 gi|294451352|gb|EFG19817.1| ABC transporter, permease protein [Enterococcus faecalis PC1.1]
 gi|295114022|emb|CBL32659.1| amino acid ABC transporter substrate-binding protein, PAAT family
           (TC 3.A.1.3.-)/amino acid ABC transporter membrane
           protein, PAAT family (TC 3.A.1.3.-) [Enterococcus sp.
           7L76]
 gi|300848600|gb|EFK76357.1| ABC transporter, permease protein [Enterococcus faecalis TUSoD
           Ef11]
 gi|306499506|gb|EFM68878.1| ABC transporter, permease protein [Enterococcus faecalis TX0109]
 gi|306503153|gb|EFM72407.1| ABC transporter, permease protein [Enterococcus faecalis TX0860]
 gi|306507061|gb|EFM76203.1| ABC transporter, permease protein [Enterococcus faecalis TX2134]
 gi|306513924|gb|EFM82526.1| ABC transporter, permease protein [Enterococcus faecalis TX4248]
 gi|310625464|gb|EFQ08747.1| ABC transporter, permease protein [Enterococcus faecalis DAPTO 512]
 gi|310630168|gb|EFQ13451.1| ABC transporter, permease protein [Enterococcus faecalis TX0102]
 gi|310632313|gb|EFQ15596.1| ABC transporter, permease protein [Enterococcus faecalis TX0635]
 gi|311289199|gb|EFQ67755.1| ABC transporter, permease protein [Enterococcus faecalis DAPTO 516]
 gi|311292544|gb|EFQ71100.1| ABC transporter, permease protein [Enterococcus faecalis TX0470]
 gi|315025741|gb|EFT37673.1| ABC transporter, permease protein [Enterococcus faecalis TX2137]
 gi|315031474|gb|EFT43406.1| ABC transporter, permease protein [Enterococcus faecalis TX0017]
 gi|315036139|gb|EFT48071.1| ABC transporter, permease protein [Enterococcus faecalis TX0027]
 gi|315145263|gb|EFT89279.1| ABC transporter, permease protein [Enterococcus faecalis TX2141]
 gi|315148141|gb|EFT92157.1| ABC transporter, permease protein [Enterococcus faecalis TX4244]
 gi|315151540|gb|EFT95556.1| ABC transporter, permease protein [Enterococcus faecalis TX0012]
 gi|315153184|gb|EFT97200.1| ABC transporter, permease protein [Enterococcus faecalis TX0031]
 gi|315154902|gb|EFT98918.1| ABC transporter, permease protein [Enterococcus faecalis TX0043]
 gi|315161961|gb|EFU05978.1| ABC transporter, permease protein [Enterococcus faecalis TX0645]
 gi|315164648|gb|EFU08665.1| ABC transporter, permease protein [Enterococcus faecalis TX1302]
 gi|315170674|gb|EFU14691.1| ABC transporter, permease protein [Enterococcus faecalis TX1342]
 gi|315578044|gb|EFU90235.1| ABC transporter, permease protein [Enterococcus faecalis TX0630]
 gi|323479955|gb|ADX79394.1| ABC-type amino acid transport/signal transduction system
           [Enterococcus faecalis 62]
 gi|327534349|gb|AEA93183.1| amino acid ABC superfamily ATP binding cassette transporter,
           binding/permease protein [Enterococcus faecalis OG1RF]
 gi|329577603|gb|EGG59036.1| ABC transporter, permease protein [Enterococcus faecalis TX1467]
          Length = 722

 Score =  175 bits (443), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 59/209 (28%), Positives = 118/209 (56%), Gaps = 7/209 (3%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
           L  GL +T++++    ++++ +G++  L   S I  LR     +++L RG+PL+ + F  
Sbjct: 521 LLHGLWMTILLTLISFVLALIVGVIFGLFSVSPIKALRVLSTIYVDLIRGIPLMVLAFFI 580

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
              LP      +++   +  ++ ++  ASAYI+E++RGG++++  GQ EA+ SLGLSY +
Sbjct: 581 YFGLP--GVLGFNIPVFIAGIITLTLNASAYISEIVRGGIKAVPVGQMEASRSLGLSYNR 638

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPT 352
            M+ II+PQ I+ +IP  +N F+   KD++++S I + +LL   ++  + +        T
Sbjct: 639 TMQKIILPQAIRIMIPSFINQFVISLKDTTILSAIGLIELLQTGKIIVARTL-----QST 693

Query: 353 TGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
                I  ++ I   S++  +  +EK ++
Sbjct: 694 MVYFVIALIYLILITSLTKLAKNLEKKVN 722


>gi|29375354|ref|NP_814508.1| amino acid ABC transporter, amino acid-binding/permease protein
           [Enterococcus faecalis V583]
 gi|227554876|ref|ZP_03984923.1| amino acid ABC superfamily ATP binding cassette transporter protein
           [Enterococcus faecalis HH22]
 gi|256761528|ref|ZP_05502108.1| amino acid ABC transporter [Enterococcus faecalis T3]
 gi|257081023|ref|ZP_05575384.1| ABC-type amino acid transport/signal transduction protein system
           [Enterococcus faecalis E1Sol]
 gi|257083683|ref|ZP_05578044.1| ABC-type amino acid transport/signal transduction system
           [Enterococcus faecalis Fly1]
 gi|257418368|ref|ZP_05595362.1| ABC amino acid transporter [Enterococcus faecalis T11]
 gi|29342814|gb|AAO80578.1| amino acid ABC transporter, amino acid-binding/permease protein
           [Enterococcus faecalis V583]
 gi|227175989|gb|EEI56961.1| amino acid ABC superfamily ATP binding cassette transporter protein
           [Enterococcus faecalis HH22]
 gi|256682779|gb|EEU22474.1| amino acid ABC transporter [Enterococcus faecalis T3]
 gi|256989053|gb|EEU76355.1| ABC-type amino acid transport/signal transduction protein system
           [Enterococcus faecalis E1Sol]
 gi|256991713|gb|EEU79015.1| ABC-type amino acid transport/signal transduction system
           [Enterococcus faecalis Fly1]
 gi|257160196|gb|EEU90156.1| ABC amino acid transporter [Enterococcus faecalis T11]
 gi|315573457|gb|EFU85648.1| ABC transporter, permease protein [Enterococcus faecalis TX0309B]
 gi|315581418|gb|EFU93609.1| ABC transporter, permease protein [Enterococcus faecalis TX0309A]
          Length = 722

 Score =  175 bits (443), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 59/209 (28%), Positives = 118/209 (56%), Gaps = 7/209 (3%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
           L  GL +T++++    ++++ +G++  L   S I  LR     +++L RG+PL+ + F  
Sbjct: 521 LLHGLWMTILLTLISFVLALIVGVIFGLFSVSPIKALRVLSTIYVDLIRGIPLMVLAFFI 580

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
              LP      +++   +  ++ ++  ASAYI+E++RGG++++  GQ EA+ SLGLSY +
Sbjct: 581 YFGLP--GVLGFNIPVFIAGIITLTLNASAYISEIVRGGIKAVPVGQMEASRSLGLSYNR 638

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPT 352
            M+ II+PQ I+ +IP  +N F+   KD++++S I + +LL   ++  + +        T
Sbjct: 639 TMQKIILPQAIRIMIPSFINQFVISLKDTTILSAIGLIELLQTGKIIVARTL-----QST 693

Query: 353 TGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
                I  ++ I   S++  +  +EK ++
Sbjct: 694 MVYFVIALIYLILITSLTKLAKNLEKKVN 722


>gi|192291212|ref|YP_001991817.1| polar amino acid ABC transporter inner membrane subunit
           [Rhodopseudomonas palustris TIE-1]
 gi|192284961|gb|ACF01342.1| polar amino acid ABC transporter, inner membrane subunit
           [Rhodopseudomonas palustris TIE-1]
          Length = 501

 Score =  175 bits (443), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 120/265 (45%), Positives = 179/265 (67%)

Query: 121 LVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVT 180
              +  +++     + +  R    ++ +F    +    +     GL +V+T +WGGLLVT
Sbjct: 236 TAIVVTALVFVLTGVRNGWRALATTVGMFAGIAVMVAALRLDRGGLPVVDTRMWGGLLVT 295

Query: 181 LVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFL 240
           LV+S  GI+ SMP+GI LALGR S IP++R   + FIE +RGVPL+TV+F A+ MLPLFL
Sbjct: 296 LVVSVTGIVASMPIGIALALGRRSTIPLIRIFSVAFIEFWRGVPLITVMFFATYMLPLFL 355

Query: 241 PDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMP 300
           P  + +D L+R L+G++ FA AY AEV+RGGL +I +GQ EAA++LGLSY +   LI++P
Sbjct: 356 PGNFTIDNLMRVLIGIALFAGAYNAEVIRGGLNAIPRGQAEAASALGLSYWKITGLIVLP 415

Query: 301 QVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGF 360
           Q ++ VIPG+VN+FI LFKD+SL+SI+ +FDLLG +R  F++ TW +  T  TG  F G 
Sbjct: 416 QALRHVIPGLVNSFIALFKDTSLVSIVALFDLLGQLRAAFADPTWSTPTTLFTGFAFTGL 475

Query: 361 VFWIFCFSISLYSVFIEKTLHKGSK 385
           ++++FCF +S YS+ +E  L+   +
Sbjct: 476 IYFVFCFGMSRYSLSVEHRLNAHRR 500



 Score = 91.3 bits (225), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 59/155 (38%), Positives = 90/155 (58%), Gaps = 5/155 (3%)

Query: 7   EFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFL 66
              +VR  ++    PPV+  G++  + +    +P +ILLT + + LL F++   + ++ +
Sbjct: 8   TPVFVRGEMVPQRPPPVHTPGVLGLVRQRLLNSPTNILLTIVGLLLLYFTVVPTVKFLLV 67

Query: 67  DAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTG 126
           DAVW GSNRT C     G         ACW F+  ++ QFI+G YP  +RWR  LVF  G
Sbjct: 68  DAVWSGSNRTDCLADKAGHPV-----GACWPFVQAKFSQFIYGFYPTPERWRVDLVFALG 122

Query: 127 SILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLY 161
           ++LL P+LIP  P K LN+ L F  FP+ +FF+L+
Sbjct: 123 ALLLLPLLIPRAPAKTLNAGLFFIAFPVLAFFLLH 157


>gi|110633468|ref|YP_673676.1| polar amino acid ABC transporter, inner membrane subunit
           [Mesorhizobium sp. BNC1]
 gi|110284452|gb|ABG62511.1| general L-amino acid ABC transporter membrane protein
           [Chelativorans sp. BNC1]
          Length = 498

 Score =  175 bits (443), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 140/289 (48%), Positives = 188/289 (65%)

Query: 98  FIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSF 157
               R     F    ++     + +    + +L+ +            +L   L      
Sbjct: 210 VSSGRVTLLDFRFSTLSLLAFLLAIGSIAASILSALRAGEPRHASPLRVLAPPLLSAVLI 269

Query: 158 FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFI 217
            VL    GL  V TS WGGL++TLV++  GI  S+PLGILLALGR S++P +R   I FI
Sbjct: 270 AVLAADFGLQHVPTSQWGGLMLTLVVALTGIAASLPLGILLALGRRSHLPAVRLFSIIFI 329

Query: 218 ELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISK 277
           E +RGVPL+TVLFM++ M+PL LP+    ++LLRAL+GV+ F++AY+AEV+RGGLQ+I K
Sbjct: 330 EFWRGVPLITVLFMSAFMIPLLLPEGVTFNQLLRALIGVAIFSAAYMAEVIRGGLQAIPK 389

Query: 278 GQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVR 337
           GQ+E A +LGL Y Q MRL+IMPQ IK VIPGIVNTFIGLFKD+SL+ II + DLLG VR
Sbjct: 390 GQYEGAEALGLGYWQMMRLVIMPQAIKLVIPGIVNTFIGLFKDTSLVYIIGLADLLGTVR 449

Query: 338 VNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
             FS+  WI+  T  TGL+F GFV+W+FCF +S YS+F+E+    G K+
Sbjct: 450 RGFSDPNWITPTTAATGLVFAGFVYWLFCFGMSRYSMFMERRFDTGHKR 498



 Score =  102 bits (253), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 48/137 (35%), Positives = 71/137 (51%), Gaps = 6/137 (4%)

Query: 6   KEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVF 65
           +   YV +   QP  PP  + GI+A   KN F TP D ++T ++     ++   +I W  
Sbjct: 4   QVAAYVAREQKQPLPPPPSEFGIVATFRKNLFATPLDSVITIVLGLFTAWAAWRLIQWGI 63

Query: 66  LDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLT 125
             AV+ G NR  C     G +       ACWAF+  +  QF++G YP++QRWR  LVF+ 
Sbjct: 64  SAAVFTGGNREACLATEGGEV------GACWAFVRAKLGQFLYGIYPLSQRWRVDLVFIL 117

Query: 126 GSILLTPMLIPSFPRKF 142
              L+ P+ IP+ P K 
Sbjct: 118 LVALMLPLAIPTAPFKR 134


>gi|317122273|ref|YP_004102276.1| polar amino acid ABC transporter inner membrane subunit
           [Thermaerobacter marianensis DSM 12885]
 gi|315592253|gb|ADU51549.1| polar amino acid ABC transporter, inner membrane subunit
           [Thermaerobacter marianensis DSM 12885]
          Length = 370

 Score =  175 bits (443), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 115/359 (32%), Positives = 176/359 (49%), Gaps = 31/359 (8%)

Query: 30  AWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPD 89
           AWI  N  GT    LLT + + +L+ +   ++ W F  A W                   
Sbjct: 40  AWIRANLLGTWYHGLLTLVCLTVLVRAGRAVVEWAFTRAQW------------------- 80

Query: 90  GWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLF 149
                  A + D     + G YP  Q WR         +L+    +            L 
Sbjct: 81  -------AVVRDNLLLLLVGAYPRDQLWRVGAALGVLVLLVLAGGLAWAGSARWRRFQLP 133

Query: 150 GLFPIFSFFVLYGGLGLSIVETSLW---GGLLVTLVISFFGIIISMPLGILLALGRNSNI 206
            +            L LS+          GL++TLV++  GI +S PLG+ LALGR S++
Sbjct: 134 VVAAWVVLVPAAMALVLSVPRVGGAGTGYGLVLTLVLAVAGITLSFPLGVALALGRVSSL 193

Query: 207 PVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAE 266
           PV+R   I +IEL RG PL+ VLF +   LPLFLP     D + RA  G+  F +AY+AE
Sbjct: 194 PVVRALSIAYIELVRGTPLMVVLFFSMTALPLFLPPAVRPDLVTRAAAGLVLFTAAYVAE 253

Query: 267 VLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISI 326
            +RGGLQ + +GQ EAA +LGL+  Q + L+++PQ ++ VIP +V  FI LFKD+SL+++
Sbjct: 254 AVRGGLQGVPRGQIEAAQALGLTGTQAVFLVVLPQALRAVIPALVGQFISLFKDTSLVAV 313

Query: 327 INMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSK 385
             + + +G+ +   S   ++          F+  V+W+FC+ +SL S  +E+ L  G +
Sbjct: 314 WGLLEFVGVAQSVLSNPAYLG--RHVEVYAFVAAVYWVFCYGMSLASRRLERRLGVGER 370


>gi|91977032|ref|YP_569691.1| amino acid ABC transporter permease [Rhodopseudomonas palustris
           BisB5]
 gi|91683488|gb|ABE39790.1| Amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine [Rhodopseudomonas palustris BisB5]
          Length = 502

 Score =  175 bits (443), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 133/264 (50%), Positives = 182/264 (68%)

Query: 122 VFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTL 181
           V +T  +LL    + +  R  L S+ LF    +    +     GL IV T  WGGLLVTL
Sbjct: 238 VIVTALVLLIGGGLRNGARAPLMSLALFAGIALVIAVLRLDRGGLPIVGTRQWGGLLVTL 297

Query: 182 VISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLP 241
           V+S  GI+ SMP+GI LALGR S IP++R  CI FIE +RGVPL+TVLF A+ MLPLFLP
Sbjct: 298 VVSVTGIVGSMPIGIALALGRRSTIPLIRLFCIGFIEFWRGVPLITVLFFATYMLPLFLP 357

Query: 242 DTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQ 301
             + +D LLR L+G++ FA AY AEV+RGGL +I +GQ EAA++LGLSY +   LI++PQ
Sbjct: 358 GNFTIDGLLRVLIGIALFAGAYNAEVVRGGLNAIPRGQGEAASALGLSYAKTTGLIVLPQ 417

Query: 302 VIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFV 361
            ++ VIPG+VN+FI LFKD+SL+SI+ +FDLLG +R  F++ TW +  T  TG  F G +
Sbjct: 418 ALRHVIPGLVNSFIALFKDTSLVSIVALFDLLGQLRAAFADPTWSTPNTLFTGFAFTGLI 477

Query: 362 FWIFCFSISLYSVFIEKTLHKGSK 385
           +++FCF +S YS+F+E  L+   +
Sbjct: 478 YFVFCFGMSRYSLFVEHRLNAHRR 501



 Score =  104 bits (258), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 55/157 (35%), Positives = 83/157 (52%), Gaps = 5/157 (3%)

Query: 5   CKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWV 64
                +VR  ++     PV   G +  +    F +P +ILLT +   LL  +I   + ++
Sbjct: 6   STTPAFVRSEMVPERAAPVRTTGFVGLVGGRLFSSPTNILLTIVGALLLYLTIVPSVKFL 65

Query: 65  FLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFL 124
            +DAVW GSNRT C   +           ACW F+  ++ QF++G YP  +RWR  L F 
Sbjct: 66  LVDAVWTGSNRTDCLAETLHRDV-----GACWPFVQAKFSQFVYGFYPQPERWRVDLTFA 120

Query: 125 TGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLY 161
             ++LL P+LIP  P K LN+ L F  FP+ +FF+L+
Sbjct: 121 LAAVLLLPLLIPRAPAKTLNAGLFFIAFPVVAFFLLH 157


>gi|15924848|ref|NP_372382.1| glutamine-binding periplasmic protein [Staphylococcus aureus subsp.
           aureus Mu50]
 gi|15927432|ref|NP_374965.1| hypothetical protein SA1675 [Staphylococcus aureus subsp. aureus
           N315]
 gi|156980174|ref|YP_001442433.1| hypothetical protein SAHV_1843 [Staphylococcus aureus subsp. aureus
           Mu3]
 gi|13701651|dbj|BAB42944.1| SA1675 [Staphylococcus aureus subsp. aureus N315]
 gi|14247630|dbj|BAB58020.1| similar to glutamine-binding periplasmic protein [Staphylococcus
           aureus subsp. aureus Mu50]
 gi|156722309|dbj|BAF78726.1| hypothetical protein [Staphylococcus aureus subsp. aureus Mu3]
 gi|285817538|gb|ADC38025.1| Glutamate ABC transporter, periplasmic glutamine-binding protein
           [Staphylococcus aureus 04-02981]
          Length = 441

 Score =  174 bits (442), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 65/226 (28%), Positives = 119/226 (52%), Gaps = 7/226 (3%)

Query: 159 VLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIE 218
           +      +S   +    G+ +T++IS  G+ +   LG  +AL + S I ++ +    +IE
Sbjct: 223 MNDDSGFISKYGSFFLKGIKITILISLIGVALGSILGAFVALMKLSKIKIISWIASIYIE 282

Query: 219 LFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKG 278
           + RG P++  +F+      +      D+  L+   + +   +SAYIAE++R G+ ++ KG
Sbjct: 283 ILRGTPMLVQVFIVF--FGITAALGLDISALVCGTIALVINSSAYIAEIIRAGINAVDKG 340

Query: 279 QFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRV 338
           Q EAA SLGL+Y Q M+ +IMPQ IK ++P + N F+ L K+SS++S I + +++   +V
Sbjct: 341 QMEAARSLGLNYRQTMKSVIMPQAIKNILPALGNEFVTLIKESSIVSTIGVGEIMFNAQV 400

Query: 339 NFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
               S       P T L+    ++++  F ++     IE  L+   
Sbjct: 401 VQGIS-----FDPFTPLLVAAALYFVLTFVLTRIMNMIEGRLNASD 441


>gi|42518711|ref|NP_964641.1| ABC transporter permease component [Lactobacillus johnsonii NCC
           533]
 gi|41582997|gb|AAS08607.1| ABC transporter permease component [Lactobacillus johnsonii NCC
           533]
          Length = 497

 Score =  174 bits (442), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 66/210 (31%), Positives = 113/210 (53%), Gaps = 8/210 (3%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
            + G+  T+VI+ F +II + LGI+LAL R S  P+L +  + +IE  RG P +  +   
Sbjct: 292 FFKGIWYTIVITIFSVIIGIVLGIILALMRLSKNPILHWLAVCYIEFIRGTPQMVQILFV 351

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
              +   +    ++  L+  ++ +   + AY+AE +R G+ S+ KGQ EAA SLGLS  +
Sbjct: 352 YFGIGYLIS---NLSALVAGIIAIGLNSGAYVAEDIRSGIDSLPKGQMEAARSLGLSRQK 408

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPT 352
             R +I+PQ IK + P + N FI L KDSSL+S+I + +L+   ++  + +         
Sbjct: 409 AFRYVIIPQAIKNIWPALGNEFITLLKDSSLVSVIGVAELMYQTQLVQTST-----YKGV 463

Query: 353 TGLIFIGFVFWIFCFSISLYSVFIEKTLHK 382
             L     +++I  FS++      EK + +
Sbjct: 464 LPLFIAMIIYFIMTFSLTRLLNHFEKRMKR 493


>gi|262050150|ref|ZP_06023004.1| hypothetical protein SAD30_1114 [Staphylococcus aureus D30]
 gi|262052687|ref|ZP_06024879.1| hypothetical protein SA930_0823 [Staphylococcus aureus 930918-3]
 gi|259159436|gb|EEW44488.1| hypothetical protein SA930_0823 [Staphylococcus aureus 930918-3]
 gi|259161775|gb|EEW46363.1| hypothetical protein SAD30_1114 [Staphylococcus aureus D30]
          Length = 441

 Score =  174 bits (442), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 66/226 (29%), Positives = 119/226 (52%), Gaps = 7/226 (3%)

Query: 159 VLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIE 218
           +      +S   +    G+ +T++IS  G+ +   LG  +AL + S I ++ +    +IE
Sbjct: 223 MNDDSGFISKYGSFFLKGIKITILISLIGVALGSILGAFVALMKLSKIKIISWIASIYIE 282

Query: 219 LFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKG 278
           + RG P++  +F+      +      D+  L+   + +   +SAYIAE++R G+ ++ KG
Sbjct: 283 ILRGTPMLVQVFIVF--FGITAALGLDISALVCGTIALVINSSAYIAEIIRAGINAVDKG 340

Query: 279 QFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRV 338
           Q EAA SLGL+Y Q M+ +IMPQ IK ++P + N F+ L K+SS++S I + +++   +V
Sbjct: 341 QMEAARSLGLNYRQTMKSVIMPQAIKNILPALGNEFVTLIKESSIVSTIGVGEIMFNAQV 400

Query: 339 NFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
               S       P T LI    ++++  F ++     IE  L+   
Sbjct: 401 VQGIS-----FDPFTPLIVAAALYFVLTFVLTRIMNMIEGRLNASD 441


>gi|316934240|ref|YP_004109222.1| polar amino acid ABC transporter inner membrane subunit
           [Rhodopseudomonas palustris DX-1]
 gi|315601954|gb|ADU44489.1| polar amino acid ABC transporter, inner membrane subunit
           [Rhodopseudomonas palustris DX-1]
          Length = 501

 Score =  174 bits (442), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 122/265 (46%), Positives = 178/265 (67%)

Query: 121 LVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVT 180
               T +++     + +  R    ++  F    +    +     GL IV+T +WGGLLVT
Sbjct: 236 TAIATTALVFVLTGVRNGWRALATTVGAFVGIAVVIAALRLDRGGLPIVDTRMWGGLLVT 295

Query: 181 LVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFL 240
           LV+S  GI+ SMP+GI LALGR S IP++R   + FIE +RGVPL+TV+F A+ MLPLFL
Sbjct: 296 LVVSVTGIVASMPVGIALALGRRSTIPLIRIFSVAFIEFWRGVPLITVMFFATYMLPLFL 355

Query: 241 PDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMP 300
           P  + +D L+R L+G++ FA AY AEV+RGGL +I +GQ EAA++LGLSY +   LI++P
Sbjct: 356 PGNFTIDNLVRVLIGIALFAGAYNAEVIRGGLNAIPRGQAEAASALGLSYWKTTGLIVLP 415

Query: 301 QVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGF 360
           Q ++ VIPG+VN+FI LFKD+SL+SI+ +FDLLG +R  F++ TW +  T  TG  F G 
Sbjct: 416 QALRHVIPGLVNSFIALFKDTSLVSIVALFDLLGQLRAAFADPTWSTPTTLFTGFAFTGL 475

Query: 361 VFWIFCFSISLYSVFIEKTLHKGSK 385
           ++++FCF +S YS+ +E  L+   +
Sbjct: 476 IYFVFCFGMSRYSLSVEHRLNAHRR 500



 Score =  106 bits (264), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 59/157 (37%), Positives = 90/157 (57%), Gaps = 5/157 (3%)

Query: 5   CKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWV 64
                +VR  ++    PPVY+ G++    +  F +P +ILLT +   LL F++   + ++
Sbjct: 6   AVTPVFVRGEMVPQRPPPVYRSGLVGMARQRLFNSPTNILLTVVGALLLYFTVVPTVKFL 65

Query: 65  FLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFL 124
            +DAVW G+NRT C   + G         ACW F+  ++ QF++G YP  +RWR  L F 
Sbjct: 66  LIDAVWTGANRTDCLAETVGHPV-----GACWPFVQAKFSQFVYGFYPTPERWRVDLTFA 120

Query: 125 TGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLY 161
            G++LL P+LIP  P K LN+ L F  FP+ +FF+LY
Sbjct: 121 LGALLLLPLLIPRAPAKTLNAGLFFVAFPVLAFFLLY 157


>gi|315657916|ref|ZP_07910790.1| amino acid ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus lugdunensis M23590]
 gi|315496952|gb|EFU85273.1| amino acid ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus lugdunensis M23590]
          Length = 497

 Score =  174 bits (441), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 66/214 (30%), Positives = 116/214 (54%), Gaps = 7/214 (3%)

Query: 171 TSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLF 230
           +    G++ T+++S  G+II   LG L+AL + S I ++ +    +IE+ RG PL+  +F
Sbjct: 291 SFFVKGIVNTIILSAIGVIIGAVLGTLIALAKLSKIKIISWIAAAYIEIIRGTPLLVQVF 350

Query: 231 MASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSY 290
           +             D+   +  ++ +   +SAYIAE++R G+ ++ KGQ EAA  LGL+Y
Sbjct: 351 IVF--FGTTAALGLDISAFICGIIALIINSSAYIAEIIRAGINAVDKGQTEAAQCLGLNY 408

Query: 291 LQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVT 350
            Q M+ +IMPQ IK ++P + N F+ L K+SS++S I + +++   +V    S       
Sbjct: 409 NQTMKNVIMPQAIKNILPALGNEFVTLIKESSIVSTIGVSEVMFNSQVVQGIS-----FD 463

Query: 351 PTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
           P T L+    ++++  FS+S     IE  +    
Sbjct: 464 PFTPLLLAAGLYFVLTFSLSRIMTLIEGRMKASD 497


>gi|119510483|ref|ZP_01629616.1| Amino acid ABC transporter, permease protein, 3-TM
           region,His/Glu/Gln/Arg/opine [Nodularia spumigena
           CCY9414]
 gi|119464905|gb|EAW45809.1| Amino acid ABC transporter, permease protein, 3-TM
           region,His/Glu/Gln/Arg/opine [Nodularia spumigena
           CCY9414]
          Length = 383

 Score =  174 bits (441), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 131/382 (34%), Positives = 206/382 (53%), Gaps = 28/382 (7%)

Query: 29  IAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQP 88
           + W+ KN F +  + LLT + + +L + + G+++W    A W      +   +     Q 
Sbjct: 4   LTWLRKNLFSSWYNSLLTVVCLLVLFWMVWGLLNWAITQAQWTVIWVNLRLFLVGRFPQT 63

Query: 89  DGWNAACWAFIYDRYEQFIF-GNYPMAQRWRPILVFLTGSILLTPMLIPS---------- 137
             W       I   +        +   Q  +P++V          +++P           
Sbjct: 64  LYWRVWIVVAIASTFSAITVSVFFGKQQLTKPLVVGYALISGFLLVILPWDLTSRLWLLL 123

Query: 138 -----------FPRKFLNSILLFGLFPIFSFFV----LYGGLGLSIVETSLWGGLLVTLV 182
                        R          L  + SF V    L GG GL  V T+LW GLL+TL+
Sbjct: 124 IAVLLLAGFWLGSRFDQIIAPWLSLAWLLSFPVILWLLGGGFGLQAVSTNLWNGLLLTLL 183

Query: 183 ISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPD 242
           ++   I++S P+G+LLALGR S +PV+R+ CI +IE+ RG+PL+ +LF+A +MLPLFLP 
Sbjct: 184 MASVSIVLSFPIGVLLALGRTSYLPVVRWFCIFYIEIVRGLPLIGILFLAQVMLPLFLPT 243

Query: 243 TWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQV 302
              +D+LLR + G+  F++AY+AE LRGGLQ+I +GQ EAA +LGL+    + LII+PQ 
Sbjct: 244 ELRLDRLLRGVAGLVLFSAAYMAENLRGGLQAIPRGQVEAAKALGLNTPLVVILIILPQA 303

Query: 303 IKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVF 362
           ++ VIP IV  FIGLFKD+SL+S++ + +L GI R   ++  ++         +FIG ++
Sbjct: 304 LRAVIPAIVGQFIGLFKDTSLLSLVGLVELTGISRSILAQPQFLGRYA--EVYLFIGLIY 361

Query: 363 WIFCFSISLYSVFIEKTLHKGS 384
           WIFC+ +SL S  +E+ L+   
Sbjct: 362 WIFCYLMSLASRRLERQLNISQ 383


>gi|257875562|ref|ZP_05655215.1| amino acid ABC transporter [Enterococcus casseliflavus EC20]
 gi|257809728|gb|EEV38548.1| amino acid ABC transporter [Enterococcus casseliflavus EC20]
          Length = 712

 Score =  174 bits (441), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 58/209 (27%), Positives = 113/209 (54%), Gaps = 7/209 (3%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
           L  GL  TL+++     +++ +GI+  L   + I  LR     ++++ RG+P++ + F  
Sbjct: 511 LLKGLWNTLLLALISFALALVIGIIFGLFSVAPIKALRVFAGIYVDIIRGIPMMVLAFFI 570

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
              L         +      ++ ++  ASAYIAE++RGG+ ++ KGQ EA+ SLG++Y +
Sbjct: 571 FFGLS--DAIGITIPDFAAGVITLTLNASAYIAEIVRGGINAVPKGQMEASRSLGMTYTR 628

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPT 352
            M+ II+PQ IK +IP  VN F+   KD+++IS+I + +LL   ++  + +        T
Sbjct: 629 TMQKIILPQAIKIMIPSFVNQFVISLKDTTIISVIGVVELLQTGKIIVART-----TQST 683

Query: 353 TGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
              + I  ++ +   +++  +  +EK + 
Sbjct: 684 YVYLIIAIIYLVVITALTKLAKVLEKKVK 712


>gi|257865935|ref|ZP_05645588.1| amino acid ABC transporter [Enterococcus casseliflavus EC30]
 gi|257872268|ref|ZP_05651921.1| amino acid ABC transporter [Enterococcus casseliflavus EC10]
 gi|257799869|gb|EEV28921.1| amino acid ABC transporter [Enterococcus casseliflavus EC30]
 gi|257806432|gb|EEV35254.1| amino acid ABC transporter [Enterococcus casseliflavus EC10]
          Length = 717

 Score =  174 bits (441), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 58/209 (27%), Positives = 113/209 (54%), Gaps = 7/209 (3%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
           L  GL  TL+++     +++ +GI+  L   + I  LR     ++++ RG+P++ + F  
Sbjct: 516 LLKGLWNTLLLALISFALALVIGIIFGLFSVAPIKALRVFAGIYVDIIRGIPMMVLAFFI 575

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
              L         +      ++ ++  ASAYIAE++RGG+ ++ KGQ EA+ SLG++Y +
Sbjct: 576 FFGLS--DAIGITIPDFAAGVITLTLNASAYIAEIVRGGINAVPKGQMEASRSLGMTYTR 633

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPT 352
            M+ II+PQ IK +IP  VN F+   KD+++IS+I + +LL   ++  + +        T
Sbjct: 634 TMQKIILPQAIKIMIPSFVNQFVISLKDTTIISVIGVVELLQTGKIIVART-----TQST 688

Query: 353 TGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
              + I  ++ +   +++  +  +EK + 
Sbjct: 689 YVYLIIAIIYLVVITALTKLAKVLEKKVK 717


>gi|115524737|ref|YP_781648.1| polar amino acid ABC transporter, inner membrane subunit
           [Rhodopseudomonas palustris BisA53]
 gi|115518684|gb|ABJ06668.1| polar amino acid ABC transporter, inner membrane subunit
           [Rhodopseudomonas palustris BisA53]
          Length = 500

 Score =  174 bits (441), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 124/264 (46%), Positives = 179/264 (67%)

Query: 122 VFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTL 181
             ++  +      + +  R  L+S+ +F         +     GL IV+T +WGGLLVTL
Sbjct: 236 AIVSLLLFFLSGGLRNGWRVLLSSLAMFAGIAAVILILRLDRGGLPIVDTRMWGGLLVTL 295

Query: 182 VISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLP 241
           V+S  GI+ SMP+GI LALGR S IP++R   + FIE +RGVPL+TVLF A+ MLPLFLP
Sbjct: 296 VVSVTGIVASMPIGIALALGRRSTIPLIRIFSVMFIEFWRGVPLITVLFFATYMLPLFLP 355

Query: 242 DTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQ 301
             + VD ++R L+G++ FA AY AEV+RGGLQ+I +GQ EA+++LGLSY +   LI++PQ
Sbjct: 356 GNFTVDGMVRVLIGIALFAGAYNAEVVRGGLQAIPRGQAEASSALGLSYWKTTGLIVLPQ 415

Query: 302 VIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFV 361
            ++ VIPG+VN+FI LFKD+SL+SI+ +FDLLG +R  FS+  W +  T  TG  F G +
Sbjct: 416 ALRHVIPGLVNSFIALFKDTSLVSIVALFDLLGQLRAAFSDPVWSTPTTLFTGFAFTGII 475

Query: 362 FWIFCFSISLYSVFIEKTLHKGSK 385
           +++FCF +S YS+ +E  L+   +
Sbjct: 476 YFVFCFGMSRYSLSVEHRLNAHQR 499



 Score = 99.8 bits (247), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 56/160 (35%), Positives = 89/160 (55%), Gaps = 5/160 (3%)

Query: 2   IDSCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGII 61
           ++  +   +V + L+ P   P+   G++  +    F +P +ILLT L + LL F+I   +
Sbjct: 1   MNETRTEAFVSQELVPPRPAPLKTTGLVGLMRTRLFNSPTNILLTLLGVSLLYFTIVPSV 60

Query: 62  HWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPIL 121
            ++ +DAVW G +RT C   + G         ACW F+  ++ QF++G YP   RWR  L
Sbjct: 61  KFLLIDAVWQGESRTDCLAETAGHPV-----GACWPFVQAKFSQFVYGFYPEPDRWRVNL 115

Query: 122 VFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLY 161
            F   ++LL P+LIP  P K LN+ L F  FP+ +FF+L+
Sbjct: 116 TFALAALLLLPLLIPRVPAKALNAGLFFIAFPVVAFFLLH 155


>gi|325570015|ref|ZP_08145940.1| glutamine ABC superfamily ATP binding cassette transporter,
           membrane protein [Enterococcus casseliflavus ATCC 12755]
 gi|325156843|gb|EGC69014.1| glutamine ABC superfamily ATP binding cassette transporter,
           membrane protein [Enterococcus casseliflavus ATCC 12755]
          Length = 760

 Score =  174 bits (441), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 58/209 (27%), Positives = 113/209 (54%), Gaps = 7/209 (3%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
           L  GL  TL+++     +++ +GI+  L   + I  LR     ++++ RG+P++ + F  
Sbjct: 559 LLKGLWNTLLLALISFALALVIGIIFGLFSVAPIKALRVFAGIYVDIIRGIPMMVLAFFI 618

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
              L         +      ++ ++  ASAYIAE++RGG+ ++ KGQ EA+ SLG++Y +
Sbjct: 619 FFGLS--DAIGITIPDFAAGVITLTLNASAYIAEIVRGGINAVPKGQMEASRSLGMTYTR 676

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPT 352
            M+ II+PQ IK +IP  VN F+   KD+++IS+I + +LL   ++  + +        T
Sbjct: 677 TMQKIILPQAIKIMIPSFVNQFVISLKDTTIISVIGVVELLQTGKIIVART-----TQST 731

Query: 353 TGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
              + I  ++ +   +++  +  +EK + 
Sbjct: 732 YVYLIIAIIYLVVITALTKLAKVLEKKVK 760


>gi|326204746|ref|ZP_08194601.1| polar amino acid ABC transporter, inner membrane subunit
           [Clostridium papyrosolvens DSM 2782]
 gi|325985117|gb|EGD45958.1| polar amino acid ABC transporter, inner membrane subunit
           [Clostridium papyrosolvens DSM 2782]
          Length = 387

 Score =  174 bits (440), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 113/372 (30%), Positives = 194/372 (52%), Gaps = 24/372 (6%)

Query: 28  IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQ 87
           II W+ KN FG+    ++T L   + +F    ++ ++F+ A W      +   +      
Sbjct: 10  IIDWLKKNLFGSWISGIVTCLFAIITIFIAKAVLKFIFVTAKWDVIPANLKILMVGQYTA 69

Query: 88  PDGWNAACWAFIYDRYEQFIFGNY----------------------PMAQRWRPILVFLT 125
            + W       +       ++G                         ++   R       
Sbjct: 70  SEVWRVWLSLSVVVFLLGVLWGIKRGIIKAVSFSIIAIFAITLLLPFVSIATRVWAFTQI 129

Query: 126 GSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISF 185
              L    +   F        L + L       +L G   +  V T+LWGG L+T++I+ 
Sbjct: 130 LLTLAGFWIGHKFKFIKKYYFLGWLLSVPIILILLNGVGNMKDVNTNLWGGFLLTVLIAV 189

Query: 186 FGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWD 245
             I++S P+G+LLALGR S + V+R+ CI +IE+ RGVPL+TVLF A ++LPLFL +  +
Sbjct: 190 VDIVLSFPIGVLLALGRRSKLVVIRWFCIIYIEVIRGVPLITVLFGAQLLLPLFLGNGLE 249

Query: 246 VDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKR 305
           ++ +LR ++G + F +AY+AE +RGG+Q I +GQ+EAA +LGL+Y+Q++  +IMPQ ++ 
Sbjct: 250 LNNVLRVMIGFTLFNAAYVAETVRGGMQIIPQGQYEAAQALGLNYVQRITFVIMPQALRS 309

Query: 306 VIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIF 365
           V+P +V + I +FKD+SL++I+++ DLLGI +   +   ++         +F+  VF++ 
Sbjct: 310 VVPALVGSVIEVFKDTSLVAIVSLMDLLGIAKRVVANPQFLG--RQMEVFLFVAAVFFVI 367

Query: 366 CFSISLYSVFIE 377
           C  IS  S  +E
Sbjct: 368 CTVISKISKRME 379


>gi|254438844|ref|ZP_05052338.1| ABC transporter, permease protein [Octadecabacter antarcticus 307]
 gi|198254290|gb|EDY78604.1| ABC transporter, permease protein [Octadecabacter antarcticus 307]
          Length = 790

 Score =  174 bits (440), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 105/223 (47%), Positives = 156/223 (69%), Gaps = 2/223 (0%)

Query: 163 GLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRG 222
            +GL  V++   GG ++ L+I   GI++S+PLGILLALGR SN+ +++  C+TFIE+ RG
Sbjct: 570 RVGLRPVDSRQIGGFMLALIIGIAGIVLSLPLGILLALGRQSNLFIVKKICVTFIEVIRG 629

Query: 223 VPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEA 282
           VPL+  LF  S++L  FLP   + D LLR ++ V+ FA+AYIAEV+RGGL +++ GQ+E 
Sbjct: 630 VPLIVWLFTGSLLLNYFLPPGTNFDLLLRVIIMVTLFAAAYIAEVIRGGLAALATGQYEG 689

Query: 283 ANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSE 342
           A+SLGLSY Q M+LI++PQ +K  IPGIVNTFIGLFKD+ L+  I + D +G   +  ++
Sbjct: 690 ADSLGLSYWQSMQLIVLPQAMKISIPGIVNTFIGLFKDTVLVVFIGLSDPIGFSNLIRAD 749

Query: 343 STWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSK 385
           + W          +FIG +F++FCFS+  YS+++EK L +  +
Sbjct: 750 TDWNGIYW--ELFVFIGALFFLFCFSMGRYSLYLEKKLQREHR 790



 Score =  139 bits (350), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 52/253 (20%), Positives = 97/253 (38%), Gaps = 4/253 (1%)

Query: 5   CKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWV 64
            +   YVR +++    PP+ + G+I W+ +N F    +ILLT L + ++  ++  ++ W 
Sbjct: 6   AQTVSYVRDKMIDEQAPPIAETGVIKWVRENLFSGWLNILLTVLSLFVVYLALSLVLPWA 65

Query: 65  FLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFL 124
           F   VW   + T C  V            ACWA I DR+ Q +FG YP    WRP+L F 
Sbjct: 66  F-GGVWNAGSLTECREVL-FSFYKSSHGGACWAVIEDRWLQIMFGFYPPELYWRPVLAFA 123

Query: 125 TGSILLTPMLIPSFPRKFLNSILLF--GLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLV 182
              + L P+L        +         +     +   +    L+ +   +       L 
Sbjct: 124 LFFVALAPVLFAEKVPGQMIWFSFAYPFIATWLIWGGSFWAPFLAAMGFIVGVLAHKALG 183

Query: 183 ISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPD 242
                I+ ++   +   L   + +  +       I   R    +  L  A++ LP  +  
Sbjct: 184 KITGPIVANLGAVVAALLWWAAIMGPINDGLNKMIGSGRLESAIATLQEAAVRLPAEVAA 243

Query: 243 TWDVDKLLRALLG 255
              + +   + + 
Sbjct: 244 MEAISEEQASGIA 256


>gi|312830230|emb|CBX35072.1| amino ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine family domain protein
           [Staphylococcus aureus subsp. aureus ECT-R 2]
          Length = 485

 Score =  174 bits (440), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 65/226 (28%), Positives = 120/226 (53%), Gaps = 7/226 (3%)

Query: 159 VLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIE 218
           +      +S   +    G+ +T++IS  G+ +   LG+ +AL + S I ++ +    +IE
Sbjct: 267 MNDDSGFISKYGSFFLKGIKITILISLIGVALGSILGVFVALMKLSKIKIISWIASIYIE 326

Query: 219 LFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKG 278
           + RG P++  +F+      +      D+  L+   + +   +SAYIAE++R G+ ++ KG
Sbjct: 327 ILRGTPMLVQVFIVF--FGITAALGLDISALVCGTIALVINSSAYIAEIIRAGINAVDKG 384

Query: 279 QFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRV 338
           Q EAA SLGL+Y Q M+ +IMPQ IK ++P + N F+ L K+SS++S I + +++   +V
Sbjct: 385 QMEAARSLGLNYRQTMKSVIMPQAIKNILPALGNEFVTLIKESSIVSTIGVGEIMFNAQV 444

Query: 339 NFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
               S       P T L+    ++++  F ++     IE  L+   
Sbjct: 445 VQGIS-----FDPFTPLLVAAALYFVLTFVLTRIMNMIEGRLNASD 485


>gi|323438846|gb|EGA96583.1| substrate-binding glutamine ABC transporter [Staphylococcus aureus
           O11]
          Length = 467

 Score =  174 bits (440), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 65/226 (28%), Positives = 118/226 (52%), Gaps = 7/226 (3%)

Query: 159 VLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIE 218
           +      +S   +    G+ +T++IS  G+ +   LG  +AL + S I V+ +    +IE
Sbjct: 249 MNDDSGFISKYGSFFLKGIKITILISLIGVALGSILGAFVALMKLSKIKVISWIASIYIE 308

Query: 219 LFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKG 278
           + RG P++  +F+      +      D+  L+   + +   +SAYIAE++R G+ ++ KG
Sbjct: 309 ILRGTPMLVQVFIVF--FGITAALGLDISALVCGTIALVINSSAYIAEIIRAGINAVDKG 366

Query: 279 QFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRV 338
           Q EAA S GL+Y Q M+ +IMPQ IK ++P + N F+ L K+SS++S I + +++   +V
Sbjct: 367 QMEAARSFGLNYRQTMKSVIMPQAIKNILPALGNEFVTLIKESSIVSTIGVGEIMFNAQV 426

Query: 339 NFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
               S       P T L+    ++++  F ++     IE  L+   
Sbjct: 427 VQGIS-----FDPFTPLLVAAALYFVLTFVLTRIMNMIEGRLNASD 467


>gi|289550425|ref|YP_003471329.1| Glutamate ABC transporter, periplasmic glutamine-binding protein
           [Staphylococcus lugdunensis HKU09-01]
 gi|289179957|gb|ADC87202.1| Glutamate ABC transporter, periplasmic glutamine-binding protein
           [Staphylococcus lugdunensis HKU09-01]
          Length = 485

 Score =  173 bits (439), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 66/214 (30%), Positives = 116/214 (54%), Gaps = 7/214 (3%)

Query: 171 TSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLF 230
           +    G++ T+++S  G+II   LG L+AL + S I ++ +    +IE+ RG PL+  +F
Sbjct: 279 SFFVKGIVNTIILSAIGVIIGAVLGTLIALAKLSKIKIISWIAAAYIEIIRGTPLLVQVF 338

Query: 231 MASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSY 290
           +             D+   +  ++ +   +SAYIAE++R G+ ++ KGQ EAA  LGL+Y
Sbjct: 339 IVF--FGTTAALGLDISAFICGIIALIINSSAYIAEIIRAGINAVDKGQTEAAQCLGLNY 396

Query: 291 LQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVT 350
            Q M+ +IMPQ IK ++P + N F+ L K+SS++S I + +++   +V    S       
Sbjct: 397 NQTMKNVIMPQAIKNILPALGNEFVTLIKESSIVSTIGVSEVMFNSQVVQGIS-----FD 451

Query: 351 PTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
           P T L+    ++++  FS+S     IE  +    
Sbjct: 452 PFTPLLLAAGLYFVLTFSLSRIMTLIEGRMKASD 485


>gi|148268330|ref|YP_001247273.1| polar amino acid ABC transporter, inner membrane subunit
           [Staphylococcus aureus subsp. aureus JH9]
 gi|150394392|ref|YP_001317067.1| polar amino acid ABC transporter, inner membrane subunit
           [Staphylococcus aureus subsp. aureus JH1]
 gi|253315189|ref|ZP_04838402.1| polar amino acid ABC transporter, inner membrane subunit
           [Staphylococcus aureus subsp. aureus str. CF-Marseille]
 gi|255006646|ref|ZP_05145247.2| polar amino acid ABC transporter, inner membrane subunit
           [Staphylococcus aureus subsp. aureus Mu50-omega]
 gi|257793783|ref|ZP_05642762.1| polar amino acid ABC transporter [Staphylococcus aureus A9781]
 gi|258413720|ref|ZP_05681993.1| polar amino acid ABC transporter [Staphylococcus aureus A9763]
 gi|258420773|ref|ZP_05683712.1| polar amino acid ABC transporter [Staphylococcus aureus A9719]
 gi|258438434|ref|ZP_05689718.1| polar amino acid ABC transporter [Staphylococcus aureus A9299]
 gi|258443879|ref|ZP_05692218.1| polar amino acid ABC transporter [Staphylococcus aureus A8115]
 gi|258447334|ref|ZP_05695481.1| polar amino acid ABC transporter [Staphylococcus aureus A6300]
 gi|258448183|ref|ZP_05696310.1| polar amino acid ABC transporter [Staphylococcus aureus A6224]
 gi|258453384|ref|ZP_05701367.1| polar amino acid ABC transporter [Staphylococcus aureus A5937]
 gi|269203495|ref|YP_003282764.1| amino acid ABC transporter, permease [Staphylococcus aureus subsp.
           aureus ED98]
 gi|282895157|ref|ZP_06303376.1| polar amino acid ABC transporter, inner membrane subunit
           [Staphylococcus aureus A8117]
 gi|282928597|ref|ZP_06336196.1| polar amino acid ABC transporter, inner membrane subunit
           [Staphylococcus aureus A10102]
 gi|295406165|ref|ZP_06815973.1| polar amino acid ABC transporter [Staphylococcus aureus A8819]
 gi|297244912|ref|ZP_06928789.1| polar amino acid ABC transporter [Staphylococcus aureus A8796]
 gi|147741399|gb|ABQ49697.1| polar amino acid ABC transporter, inner membrane subunit
           [Staphylococcus aureus subsp. aureus JH9]
 gi|149946844|gb|ABR52780.1| polar amino acid ABC transporter, inner membrane subunit
           [Staphylococcus aureus subsp. aureus JH1]
 gi|257787755|gb|EEV26095.1| polar amino acid ABC transporter [Staphylococcus aureus A9781]
 gi|257839507|gb|EEV63978.1| polar amino acid ABC transporter [Staphylococcus aureus A9763]
 gi|257843377|gb|EEV67787.1| polar amino acid ABC transporter [Staphylococcus aureus A9719]
 gi|257848478|gb|EEV72469.1| polar amino acid ABC transporter [Staphylococcus aureus A9299]
 gi|257851285|gb|EEV75228.1| polar amino acid ABC transporter [Staphylococcus aureus A8115]
 gi|257853921|gb|EEV76877.1| polar amino acid ABC transporter [Staphylococcus aureus A6300]
 gi|257858422|gb|EEV81298.1| polar amino acid ABC transporter [Staphylococcus aureus A6224]
 gi|257864476|gb|EEV87221.1| polar amino acid ABC transporter [Staphylococcus aureus A5937]
 gi|262075785|gb|ACY11758.1| amino acid ABC transporter, permease [Staphylococcus aureus subsp.
           aureus ED98]
 gi|282589806|gb|EFB94891.1| polar amino acid ABC transporter, inner membrane subunit
           [Staphylococcus aureus A10102]
 gi|282762501|gb|EFC02642.1| polar amino acid ABC transporter, inner membrane subunit
           [Staphylococcus aureus A8117]
 gi|283471129|emb|CAQ50340.1| polar amino acid ABC transporter, inner membrane subunit
           [Staphylococcus aureus subsp. aureus ST398]
 gi|294969162|gb|EFG45183.1| polar amino acid ABC transporter [Staphylococcus aureus A8819]
 gi|297177992|gb|EFH37240.1| polar amino acid ABC transporter [Staphylococcus aureus A8796]
 gi|315130497|gb|EFT86483.1| polar amino acid ABC transporter, inner membrane subunit
           [Staphylococcus aureus subsp. aureus CGS03]
 gi|329732960|gb|EGG69304.1| ABC transporter, permease protein [Staphylococcus aureus subsp.
           aureus 21193]
          Length = 485

 Score =  173 bits (439), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 65/226 (28%), Positives = 119/226 (52%), Gaps = 7/226 (3%)

Query: 159 VLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIE 218
           +      +S   +    G+ +T++IS  G+ +   LG  +AL + S I ++ +    +IE
Sbjct: 267 MNDDSGFISKYGSFFLKGIKITILISLIGVALGSILGAFVALMKLSKIKIISWIASIYIE 326

Query: 219 LFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKG 278
           + RG P++  +F+      +      D+  L+   + +   +SAYIAE++R G+ ++ KG
Sbjct: 327 ILRGTPMLVQVFIVF--FGITAALGLDISALVCGTIALVINSSAYIAEIIRAGINAVDKG 384

Query: 279 QFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRV 338
           Q EAA SLGL+Y Q M+ +IMPQ IK ++P + N F+ L K+SS++S I + +++   +V
Sbjct: 385 QMEAARSLGLNYRQTMKSVIMPQAIKNILPALGNEFVTLIKESSIVSTIGVGEIMFNAQV 444

Query: 339 NFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
               S       P T L+    ++++  F ++     IE  L+   
Sbjct: 445 VQGIS-----FDPFTPLLVAAALYFVLTFVLTRIMNMIEGRLNASD 485


>gi|227890364|ref|ZP_04008169.1| amino acid ABC superfamily ATP binding cassette transporter,
           membrane protein [Lactobacillus johnsonii ATCC 33200]
 gi|227849178|gb|EEJ59264.1| amino acid ABC superfamily ATP binding cassette transporter,
           membrane protein [Lactobacillus johnsonii ATCC 33200]
          Length = 500

 Score =  173 bits (439), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 66/210 (31%), Positives = 113/210 (53%), Gaps = 8/210 (3%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
            + G+  T+VI+ F +II + LGI+LAL R S  P+L +  + +IE  RG P +  +   
Sbjct: 295 FFKGIWYTIVITIFSVIIGIVLGIILALMRLSKNPILHWLAVCYIEFIRGTPQMVQILFV 354

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
              +   +    ++  L+  ++ +   + AY+AE +R G+ S+ KGQ EAA SLGLS  +
Sbjct: 355 YFGIGYLIS---NLSALVAGIIAIGLNSGAYVAEDIRSGIDSLPKGQMEAARSLGLSRQK 411

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPT 352
             R +I+PQ IK + P + N FI L KDSSL+S+I + +L+   ++  + +         
Sbjct: 412 AFRYVIIPQAIKNIWPALGNEFITLLKDSSLVSVIGVAELMYQTQLVQTST-----YKGV 466

Query: 353 TGLIFIGFVFWIFCFSISLYSVFIEKTLHK 382
             L     +++I  FS++      EK + +
Sbjct: 467 LPLFIAMIIYFIMTFSLTRLLNHFEKRMKR 496


>gi|329727185|gb|EGG63641.1| ABC transporter, permease protein [Staphylococcus aureus subsp.
           aureus 21172]
          Length = 485

 Score =  173 bits (439), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 65/226 (28%), Positives = 119/226 (52%), Gaps = 7/226 (3%)

Query: 159 VLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIE 218
           +      +S   +    G+ +T++IS  G+ +   LG  +AL + S I ++ +    +IE
Sbjct: 267 MNDDSGFISKYGSFFLKGIKITILISLIGVALGSILGAFVALMKLSKIKIISWIASIYIE 326

Query: 219 LFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKG 278
           + RG P++  +F+      +      D+  L+   + +   +SAYIAE++R G+ ++ KG
Sbjct: 327 ILRGTPMLVQVFIVF--FGITAALGLDISALVCGTIALVINSSAYIAEIIRAGINAVDKG 384

Query: 279 QFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRV 338
           Q EAA SLGL+Y Q M+ +IMPQ IK ++P + N F+ L K+SS++S I + +++   +V
Sbjct: 385 QMEAARSLGLNYRQTMKSVIMPQAIKNILPALGNEFVTLIKESSIVSTIGVGEIMFNAQV 444

Query: 339 NFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
               S       P T L+    ++++  F ++     IE  L+   
Sbjct: 445 VQGIS-----FDPFTPLLVAAALYFVLTFVLTRIMNMIEGRLNASD 485


>gi|282917128|ref|ZP_06324886.1| polar amino acid ABC transporter, inner membrane subunit
           [Staphylococcus aureus subsp. aureus D139]
 gi|282319615|gb|EFB49967.1| polar amino acid ABC transporter, inner membrane subunit
           [Staphylococcus aureus subsp. aureus D139]
          Length = 485

 Score =  173 bits (439), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 65/226 (28%), Positives = 119/226 (52%), Gaps = 7/226 (3%)

Query: 159 VLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIE 218
           +      +S   +    G+ +T++IS  G+ +   LG  +AL + S I ++ +    +IE
Sbjct: 267 MNDDSGFISKYGSFFLKGIKITILISLIGVALGSILGAFVALMKLSKIKIISWIASIYIE 326

Query: 219 LFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKG 278
           + RG P++  +F+      +      D+  L+   + +   +SAYIAE++R G+ ++ KG
Sbjct: 327 ILRGTPMLVQVFIVF--FGITAALGLDISALVCGTIALVINSSAYIAEIIRAGINAVDKG 384

Query: 279 QFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRV 338
           Q EAA SLGL+Y Q M+ +IMPQ IK ++P + N F+ L K+SS++S I + +++   +V
Sbjct: 385 QMEAARSLGLNYRQTMKSVIMPQAIKNILPALGNEFVTLIKESSIVSTIGVGEIMFNAQV 444

Query: 339 NFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
               S       P T L+    ++++  F ++     IE  L+   
Sbjct: 445 VQGIS-----FDPFTPLLVAAALYFVLTFVLTRIMNMIEGRLNASD 485


>gi|21283528|ref|NP_646616.1| hypothetical protein MW1799 [Staphylococcus aureus subsp. aureus
           MW2]
 gi|49486677|ref|YP_043898.1| putative extracellular glutamine-binding protein [Staphylococcus
           aureus subsp. aureus MSSA476]
 gi|57650648|ref|YP_186741.1| amino acid ABC transporter, permease/substrate-binding protein
           [Staphylococcus aureus subsp. aureus COL]
 gi|87161641|ref|YP_494491.1| amino acid ABC transporter, permease/substrate-binding protein
           [Staphylococcus aureus subsp. aureus USA300_FPR3757]
 gi|88195682|ref|YP_500488.1| ABC transporter permease [Staphylococcus aureus subsp. aureus NCTC
           8325]
 gi|151221962|ref|YP_001332784.1| extracellular glutamine-binding protein [Staphylococcus aureus
           subsp. aureus str. Newman]
 gi|161510076|ref|YP_001575735.1| amino acid ABC transporter ATP-binding protein [Staphylococcus
           aureus subsp. aureus USA300_TCH1516]
 gi|221142158|ref|ZP_03566651.1| amino acid ABC transporter ATP-binding protein [Staphylococcus
           aureus subsp. aureus str. JKD6009]
 gi|253732516|ref|ZP_04866681.1| amino acid ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|258452651|ref|ZP_05700650.1| amino acid ABC transporter [Staphylococcus aureus A5948]
 gi|282924191|ref|ZP_06331866.1| extracellular glutamine-binding protein [Staphylococcus aureus
           A9765]
 gi|284024905|ref|ZP_06379303.1| amino acid ABC transporter, permease/substrate-binding protein
           [Staphylococcus aureus subsp. aureus 132]
 gi|294850288|ref|ZP_06791023.1| extracellular glutamine-binding protein [Staphylococcus aureus
           A9754]
 gi|297207424|ref|ZP_06923861.1| amino acid ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus aureus subsp. aureus
           ATCC 51811]
 gi|300911508|ref|ZP_07128953.1| amino acid ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus aureus subsp. aureus
           TCH70]
 gi|304380538|ref|ZP_07363213.1| amino acid ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus aureus subsp. aureus
           ATCC BAA-39]
 gi|21204969|dbj|BAB95664.1| MW1799 [Staphylococcus aureus subsp. aureus MW2]
 gi|49245120|emb|CAG43586.1| putative extracellular glutamine-binding protein [Staphylococcus
           aureus subsp. aureus MSSA476]
 gi|57284834|gb|AAW36928.1| amino acid ABC transporter, permease/substrate-binding protein
           [Staphylococcus aureus subsp. aureus COL]
 gi|87127615|gb|ABD22129.1| amino acid ABC transporter, permease/substrate-binding protein
           [Staphylococcus aureus subsp. aureus USA300_FPR3757]
 gi|87203240|gb|ABD31050.1| ABC transporter, permease protein, putative [Staphylococcus aureus
           subsp. aureus NCTC 8325]
 gi|150374762|dbj|BAF68022.1| extracellular glutamine-binding protein [Staphylococcus aureus
           subsp. aureus str. Newman]
 gi|160368885|gb|ABX29856.1| amino acid ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus aureus subsp. aureus
           USA300_TCH1516]
 gi|253723797|gb|EES92526.1| amino acid ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|257859626|gb|EEV82475.1| amino acid ABC transporter [Staphylococcus aureus A5948]
 gi|269941329|emb|CBI49726.1| putative extracellular glutamine-bindingprotein [Staphylococcus
           aureus subsp. aureus TW20]
 gi|282592986|gb|EFB97988.1| extracellular glutamine-binding protein [Staphylococcus aureus
           A9765]
 gi|294822904|gb|EFG39338.1| extracellular glutamine-binding protein [Staphylococcus aureus
           A9754]
 gi|296887887|gb|EFH26783.1| amino acid ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus aureus subsp. aureus
           ATCC 51811]
 gi|300887140|gb|EFK82340.1| amino acid ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus aureus subsp. aureus
           TCH70]
 gi|302751667|gb|ADL65844.1| polar amino acid ABC transporter, inner membrane subunit
           [Staphylococcus aureus subsp. aureus str. JKD6008]
 gi|304340867|gb|EFM06792.1| amino acid ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus aureus subsp. aureus
           ATCC BAA-39]
 gi|315196792|gb|EFU27136.1| amino acid ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus aureus subsp. aureus
           CGS01]
 gi|320141291|gb|EFW33136.1| ABC transporter, permease protein [Staphylococcus aureus subsp.
           aureus MRSA131]
 gi|329314534|gb|AEB88947.1| Polar amino acid ABC transporter, inner membrane subunit
           [Staphylococcus aureus subsp. aureus T0131]
 gi|329729517|gb|EGG65919.1| ABC transporter, permease protein [Staphylococcus aureus subsp.
           aureus 21189]
          Length = 485

 Score =  173 bits (439), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 66/226 (29%), Positives = 119/226 (52%), Gaps = 7/226 (3%)

Query: 159 VLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIE 218
           +      +S   +    G+ +T++IS  G+ +   LG  +AL + S I ++ +    +IE
Sbjct: 267 MNDDSGFISKYGSFFLKGIKITILISLIGVALGSILGAFVALMKLSKIKIISWIASIYIE 326

Query: 219 LFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKG 278
           + RG P++  +F+      +      D+  L+   + +   +SAYIAE++R G+ ++ KG
Sbjct: 327 ILRGTPMLVQVFIVF--FGITAALGLDISALVCGTIALVINSSAYIAEIIRAGINAVDKG 384

Query: 279 QFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRV 338
           Q EAA SLGL+Y Q M+ +IMPQ IK ++P + N F+ L K+SS++S I + +++   +V
Sbjct: 385 QMEAARSLGLNYRQTMKSVIMPQAIKNILPALGNEFVTLIKESSIVSTIGVGEIMFNAQV 444

Query: 339 NFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
               S       P T LI    ++++  F ++     IE  L+   
Sbjct: 445 VQGIS-----FDPFTPLIVAAALYFVLTFVLTRIMNMIEGRLNASD 485


>gi|49484100|ref|YP_041324.1| extracellular glutamine-binding protein [Staphylococcus aureus
           subsp. aureus MRSA252]
 gi|257425970|ref|ZP_05602394.1| polar amino acid ABC transporter [Staphylococcus aureus subsp.
           aureus 55/2053]
 gi|282904433|ref|ZP_06312321.1| amino acid ABC transporter, permease/substrate-binding protein
           [Staphylococcus aureus subsp. aureus C160]
 gi|282906256|ref|ZP_06314111.1| polar amino acid ABC transporter [Staphylococcus aureus subsp.
           aureus Btn1260]
 gi|282909175|ref|ZP_06316993.1| polar amino acid ABC transporter [Staphylococcus aureus subsp.
           aureus WW2703/97]
 gi|282911481|ref|ZP_06319283.1| polar amino acid ABC transporter [Staphylococcus aureus subsp.
           aureus WBG10049]
 gi|282919619|ref|ZP_06327354.1| extracellular glutamine-binding protein [Staphylococcus aureus
           subsp. aureus C427]
 gi|283958611|ref|ZP_06376062.1| amino acid ABC transporter, permease/substrate-binding protein
           [Staphylococcus aureus subsp. aureus A017934/97]
 gi|295428436|ref|ZP_06821065.1| extracellular glutamine-binding protein [Staphylococcus aureus
           subsp. aureus EMRSA16]
 gi|49242229|emb|CAG40936.1| putative extracellular glutamine-binding protein [Staphylococcus
           aureus subsp. aureus MRSA252]
 gi|257271664|gb|EEV03810.1| polar amino acid ABC transporter [Staphylococcus aureus subsp.
           aureus 55/2053]
 gi|282317429|gb|EFB47803.1| extracellular glutamine-binding protein [Staphylococcus aureus
           subsp. aureus C427]
 gi|282325176|gb|EFB55486.1| polar amino acid ABC transporter [Staphylococcus aureus subsp.
           aureus WBG10049]
 gi|282327439|gb|EFB57734.1| polar amino acid ABC transporter [Staphylococcus aureus subsp.
           aureus WW2703/97]
 gi|282331548|gb|EFB61062.1| polar amino acid ABC transporter [Staphylococcus aureus subsp.
           aureus Btn1260]
 gi|282596051|gb|EFC01015.1| amino acid ABC transporter, permease/substrate-binding protein
           [Staphylococcus aureus subsp. aureus C160]
 gi|283790760|gb|EFC29577.1| amino acid ABC transporter, permease/substrate-binding protein
           [Staphylococcus aureus subsp. aureus A017934/97]
 gi|295127836|gb|EFG57473.1| extracellular glutamine-binding protein [Staphylococcus aureus
           subsp. aureus EMRSA16]
 gi|312437677|gb|ADQ76748.1| amino acid ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus aureus subsp. aureus
           TCH60]
 gi|315195770|gb|EFU26157.1| putative extracellular glutamine-binding protein [Staphylococcus
           aureus subsp. aureus CGS00]
          Length = 485

 Score =  173 bits (438), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 65/226 (28%), Positives = 119/226 (52%), Gaps = 7/226 (3%)

Query: 159 VLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIE 218
           +      +S   +    G+ +T++IS  G+ +   LG  +AL + S I ++ +    +IE
Sbjct: 267 MNDDSGFISKYGSFFLKGIKITILISLIGVALGSILGAFVALMKLSKIKIISWIASIYIE 326

Query: 219 LFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKG 278
           + RG P++  +F+      +      D+  L+   + +   +SAYIAE++R G+ ++ KG
Sbjct: 327 ILRGTPMLVQVFIVF--FGITAALGLDISALVCGTIALVINSSAYIAEIIRAGINAVDKG 384

Query: 279 QFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRV 338
           Q EAA SLGL+Y Q M+ +IMPQ IK ++P + N F+ L K+SS++S I + +++   +V
Sbjct: 385 QMEAARSLGLNYRQTMKSVIMPQAIKNILPALGNEFVTLIKESSIVSTIGVGEIMFNAQV 444

Query: 339 NFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
               S       P T L+    ++++  F ++     IE  L+   
Sbjct: 445 VQGIS-----FDPFTPLLVAAALYFVLTFVLTRIMNMIEGRLNASD 485


>gi|302333524|gb|ADL23717.1| amino acid ABC transporter protein [Staphylococcus aureus subsp.
           aureus JKD6159]
          Length = 485

 Score =  173 bits (438), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 64/226 (28%), Positives = 119/226 (52%), Gaps = 7/226 (3%)

Query: 159 VLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIE 218
           +      +S   +    G+ +T++IS  G+ +   LG  +AL + S I ++ +    +IE
Sbjct: 267 MNDDSGFISKYGSFFLKGIKITILISLIGVALGSILGAFVALMKLSKIKIISWIASIYIE 326

Query: 219 LFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKG 278
           + RG P++  +F+      +      D+  L+   + +   +SAYIAE++R G+ ++ KG
Sbjct: 327 ILRGTPMLVQVFIVF--FGITAALGLDISALVCGTIALVINSSAYIAEIIRAGINAVDKG 384

Query: 279 QFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRV 338
           Q EAA SLGL+Y Q M+ +IMPQ IK ++P + N F+ L K+SS++S I + +++   +V
Sbjct: 385 QMEAARSLGLNYRQTMKSVIMPQAIKNILPALGNEFVTLIKESSIVSTIGVGEIMFNAQV 444

Query: 339 NFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
               S       P T L+    ++++  F ++     IE  ++   
Sbjct: 445 VQGIS-----FDPFTPLLVAAALYFVLTFVLTRIMNMIEGRMNASD 485


>gi|268319123|ref|YP_003292779.1| ABC transporter permease component [Lactobacillus johnsonii FI9785]
 gi|262397498|emb|CAX66512.1| ABC transporter permease component [Lactobacillus johnsonii FI9785]
          Length = 497

 Score =  173 bits (438), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 66/210 (31%), Positives = 113/210 (53%), Gaps = 8/210 (3%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
            + G+  T+VI+ F +II + LGI+LAL R S  P+L +  + +IE  RG P +  +   
Sbjct: 292 FFKGIWYTIVITIFSVIIGIVLGIILALMRLSKNPILHWFAVCYIEFIRGTPQMVQILFV 351

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
              +   +    ++  L+  ++ +   + AY+AE +R G+ S+ KGQ EAA SLGLS  +
Sbjct: 352 YFGIGYLIS---NLSALVAGIIAIGLNSGAYVAEDIRSGIDSLPKGQMEAARSLGLSRQK 408

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPT 352
             R +I+PQ IK + P + N FI L KDSSL+S+I + +L+   ++  + +         
Sbjct: 409 AFRYVIIPQAIKNIWPALGNEFITLLKDSSLVSVIGVAELMYQTQLVQTST-----YKGV 463

Query: 353 TGLIFIGFVFWIFCFSISLYSVFIEKTLHK 382
             L     +++I  FS++      EK + +
Sbjct: 464 LPLFIAMIIYFIMTFSLTRLLNHFEKRMKR 493


>gi|253735261|ref|ZP_04869426.1| amino acid ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus aureus subsp. aureus
           TCH130]
 gi|253726668|gb|EES95397.1| amino acid ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus aureus subsp. aureus
           TCH130]
          Length = 485

 Score =  173 bits (438), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 66/226 (29%), Positives = 119/226 (52%), Gaps = 7/226 (3%)

Query: 159 VLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIE 218
           +      +S   +    G+ +T++IS  G+ +   LG  +AL + S I ++ +    +IE
Sbjct: 267 MNDDSGFISKYGSFFLKGIKITILISLIGVALGSILGAFVALMKLSKIKIISWIASIYIE 326

Query: 219 LFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKG 278
           + RG P++  +F+      +      D+  L+   + +   +SAYIAE++R G+ ++ KG
Sbjct: 327 ILRGTPMLVQVFIVF--FGITAALGLDISALVCGTIALVINSSAYIAEIIRAGINAVDKG 384

Query: 279 QFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRV 338
           Q EAA SLGL+Y Q M+ +IMPQ IK ++P + N F+ L K+SS++S I + +++   +V
Sbjct: 385 QMEAARSLGLNYRQTMKSVIMPQAIKNILPALGNEFVTLIKESSIVSTIGVGEIMFNAQV 444

Query: 339 NFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
               S       P T LI    ++++  F ++     IE  L+   
Sbjct: 445 VQGIS-----FDPFTPLIVAAALYFVLTFVLTRIMNMIEGRLNASD 485


>gi|330684749|gb|EGG96444.1| ABC transporter, permease protein [Staphylococcus epidermidis
           VCU121]
          Length = 486

 Score =  173 bits (438), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 72/215 (33%), Positives = 114/215 (53%), Gaps = 7/215 (3%)

Query: 170 ETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVL 229
           ++    GL  T++ISF G+++   LG  +AL + S    L +    +IE  RG PL+  +
Sbjct: 279 KSFFIKGLENTILISFIGVVLGAILGAFIALMKLSKFKPLSWIASIYIEFLRGTPLLVQV 338

Query: 230 FMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLS 289
           F+             D+  L+   + +   +SAYIAE+ R G+ SI KGQ EAA SLGLS
Sbjct: 339 FIVF--FGTTAALGLDISALICGTIALVINSSAYIAEIFRAGINSIDKGQTEAARSLGLS 396

Query: 290 YLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSV 349
           Y Q M+ +IMPQ IK ++P + N F+ L K+SS++S I + +++   +V    S      
Sbjct: 397 YNQTMKSVIMPQAIKNILPALGNEFVTLIKESSIVSTIGVGEIMFNAQVVQGIS-----F 451

Query: 350 TPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
            P T L+    +++I  F++S    FIE  +    
Sbjct: 452 DPFTPLLVAAGMYFILTFALSRIMNFIEGRMKASD 486


>gi|298695127|gb|ADI98349.1| substrate-binding glutamine ABC transporter [Staphylococcus aureus
           subsp. aureus ED133]
          Length = 485

 Score =  173 bits (438), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 65/226 (28%), Positives = 119/226 (52%), Gaps = 7/226 (3%)

Query: 159 VLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIE 218
           +      +S   +    G+ +T++IS  G+ +   LG  +AL + S I ++ +    +IE
Sbjct: 267 MNDDSGFISKYGSFFLKGIKITILISLIGVALGSILGAFVALMKLSKIKIISWIASIYIE 326

Query: 219 LFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKG 278
           + RG P++  +F+      +      D+  L+   + +   +SAYIAE++R G+ ++ KG
Sbjct: 327 ILRGTPMLVQVFIVF--FGITAALGLDISALVCGTIALVINSSAYIAEIIRAGINAVDKG 384

Query: 279 QFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRV 338
           Q EAA SLGL+Y Q M+ +IMPQ IK ++P + N F+ L K+SS++S I + +++   +V
Sbjct: 385 QMEAARSLGLNYRQTMKSVIMPQAIKNILPALGNEFVTLIKESSIVSTIGVGEIMFNAQV 444

Query: 339 NFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
               S       P T L+    ++++  F ++     IE  L+   
Sbjct: 445 VQGIS-----FDPFTPLLVAAALYFVLTFVLTRIMNMIEGRLNASD 485


>gi|297590597|ref|ZP_06949235.1| amino acid ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus aureus subsp. aureus
           MN8]
 gi|297575483|gb|EFH94199.1| amino acid ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus aureus subsp. aureus
           MN8]
          Length = 485

 Score =  173 bits (438), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 65/226 (28%), Positives = 119/226 (52%), Gaps = 7/226 (3%)

Query: 159 VLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIE 218
           +      +S   +    G+ +T++IS  G+ +   LG  +AL + S I ++ +    +IE
Sbjct: 267 MNDDSGFISKYGSFFLKGIKITILISLIGVALGSILGAFVALMKLSKIKIISWIASIYIE 326

Query: 219 LFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKG 278
           + RG P++  +F+      +      D+  L+   + +   +SAYIAE++R G+ ++ KG
Sbjct: 327 ILRGTPMLVQVFIVF--FGITAALGLDISALVCGTIALVINSSAYIAEIIRAGINAVDKG 384

Query: 279 QFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRV 338
           Q EAA SLGL+Y Q M+ +IMPQ IK ++P + N F+ L K+SS++S I + +++   +V
Sbjct: 385 QMEAARSLGLNYRQTMKSVIMPQAIKNILPALGNEFVTLIKESSIVSTIGVGEIMFNAQV 444

Query: 339 NFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
               S       P T L+    ++++  F ++     IE  L+   
Sbjct: 445 VQGIS-----FDPFTPLLVAAALYFVLTFVLTRIMNMIEGRLNASD 485


>gi|82751513|ref|YP_417254.1| substrate-binding glutamine ABC transporter [Staphylococcus aureus
           RF122]
 gi|82657044|emb|CAI81481.1| substrate-binding glutamine ABC transporter [Staphylococcus aureus
           RF122]
          Length = 485

 Score =  173 bits (438), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 65/226 (28%), Positives = 119/226 (52%), Gaps = 7/226 (3%)

Query: 159 VLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIE 218
           +      +S   +    G+ +T++IS  G+ +   LG  +AL + S I ++ +    +IE
Sbjct: 267 MNDDSGFISKYGSFFLKGIKITILISLIGVALGSILGAFVALMKLSKIKIISWIASIYIE 326

Query: 219 LFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKG 278
           + RG P++  +F+      +      D+  L+   + +   +SAYIAE++R G+ ++ KG
Sbjct: 327 ILRGTPMLVQVFIVF--FGITAALGLDISALVCGTIALVINSSAYIAEIIRAGINAVDKG 384

Query: 279 QFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRV 338
           Q EAA SLGL+Y Q M+ +IMPQ IK ++P + N F+ L K+SS++S I + +++   +V
Sbjct: 385 QMEAARSLGLNYRQTMKSVIMPQAIKNILPALGNEFVTLIKESSIVSTIGVGEIMFNAQV 444

Query: 339 NFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
               S       P T L+    ++++  F ++     IE  L+   
Sbjct: 445 VQGIS-----FDPFTPLLVAAALYFVLTFVLTRIMNMIEGRLNASD 485


>gi|145223751|ref|YP_001134429.1| polar amino acid ABC transporter, inner membrane subunit
           [Mycobacterium gilvum PYR-GCK]
 gi|315444078|ref|YP_004076957.1| amino acid ABC transporter membrane protein, PAAT family ;amino
           acid ABC transporter substrate-binding protein, PAAT
           family [Mycobacterium sp. Spyr1]
 gi|145216237|gb|ABP45641.1| amino acid ABC transporter membrane protein, PAAT family / amino
           acid ABC transporter substrate-binding protein, PAAT
           family [Mycobacterium gilvum PYR-GCK]
 gi|315262381|gb|ADT99122.1| amino acid ABC transporter membrane protein, PAAT family ;amino
           acid ABC transporter substrate-binding protein, PAAT
           family [Mycobacterium sp. Spyr1]
          Length = 493

 Score =  173 bits (438), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 62/215 (28%), Positives = 115/215 (53%), Gaps = 7/215 (3%)

Query: 166 LSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPL 225
           +      L  GL +T++++   I  ++ LG++  L R S    LR    TF+++FRG PL
Sbjct: 284 IKSTSPMLLAGLKMTIILTVVSIFFALILGVIFGLARVSRSIWLRAIGTTFVDIFRGTPL 343

Query: 226 VTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANS 285
           +   F     +P      + +  +   ++ +S  A AY+ E++RGG+ S+ KGQ EAA S
Sbjct: 344 LVQAFFIYFGIP--ATMGFQMSAVTAGIITLSLNAGAYMTEIVRGGILSVDKGQMEAARS 401

Query: 286 LGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTW 345
           LG+ YL  MR +I+PQ I+ +IP  +N F+   KD+S++S++ + +L    R+  +    
Sbjct: 402 LGIGYLPTMRKVILPQAIRTMIPSYINQFVITLKDTSILSVLGIAELTQSGRIIIA---- 457

Query: 346 ISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTL 380
             +       + +G +++I   +++  S  +E+ L
Sbjct: 458 -GNYKAFEMWLIVGVIYFIVIMALTKLSDRLERRL 491


>gi|239637861|ref|ZP_04678822.1| glutamine-binding periplasmic protein [Staphylococcus warneri
           L37603]
 gi|239596424|gb|EEQ78960.1| glutamine-binding periplasmic protein [Staphylococcus warneri
           L37603]
          Length = 486

 Score =  173 bits (438), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 71/215 (33%), Positives = 113/215 (52%), Gaps = 7/215 (3%)

Query: 170 ETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVL 229
           ++    GL  T++ISF G++    LG  +AL + S    L +    +IE  RG PL+  +
Sbjct: 279 KSFFIKGLQNTILISFVGVVFGAILGAFIALMKLSKFKPLSWIASIYIEFLRGTPLLVQV 338

Query: 230 FMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLS 289
           F+             D+  L+   + +   +SAYIAE+ R G+ SI KGQ EAA SLGLS
Sbjct: 339 FIVF--FGTTAALGLDISALICGTIALVINSSAYIAEIFRAGINSIDKGQTEAARSLGLS 396

Query: 290 YLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSV 349
           Y Q M+ ++MPQ IK ++P + N F+ L K+SS++S I + +++   +V    S      
Sbjct: 397 YNQTMKSVVMPQAIKNILPALGNEFVTLIKESSIVSTIGVGEIMFNAQVVQGIS-----F 451

Query: 350 TPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
            P T L+    +++I  F++S    FIE  +    
Sbjct: 452 DPFTPLLVAAGMYFILTFALSRIMNFIEGRMKASD 486


>gi|254454563|ref|ZP_05068000.1| polar amino acid ABC transport permease protein AapM-1
           [Octadecabacter antarcticus 238]
 gi|198268969|gb|EDY93239.1| polar amino acid ABC transport permease protein AapM-1
           [Octadecabacter antarcticus 238]
          Length = 775

 Score =  173 bits (438), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 105/223 (47%), Positives = 155/223 (69%), Gaps = 2/223 (0%)

Query: 163 GLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRG 222
            +GL  +++   GG ++ L+I   GI++S+PLGILLALGR S++ ++   C+TFIE+ RG
Sbjct: 555 RVGLRPIDSRDIGGFMLALIIGIAGIVLSLPLGILLALGRQSHLFIVNKICVTFIEVIRG 614

Query: 223 VPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEA 282
           VPL+  LF  S++L  FLP   + D LLR ++ V+ FA+AYIAEV+RGGL +++ GQ+E 
Sbjct: 615 VPLIVWLFTGSLLLNYFLPPGTNFDLLLRVIIMVTLFAAAYIAEVIRGGLAALATGQYEG 674

Query: 283 ANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSE 342
           A+SLGLSY Q MRLI++PQ +K  IPGIVNTFIGLFKD++L+  I + D +G   +  ++
Sbjct: 675 ADSLGLSYWQSMRLIVLPQAMKISIPGIVNTFIGLFKDTTLVVFIGLSDPIGFSNLIRAD 734

Query: 343 STWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSK 385
           + W          +FIG +F+IFCFS+  YS+ +EK L +  +
Sbjct: 735 TDWNGIYW--ELFVFIGALFFIFCFSMGRYSLHLEKKLQREHR 775



 Score =  124 bits (310), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 53/243 (21%), Positives = 93/243 (38%), Gaps = 4/243 (1%)

Query: 15  LLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSN 74
           ++   +PPV + G I WI  N F    +ILLT + + ++  ++  ++ W F   VW   +
Sbjct: 1   MIDEQVPPVAEAGAIKWIRTNLFSGWLNILLTVVSLYVVYLALSLVLPWAF-GGVWNAGS 59

Query: 75  RTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPML 134
            T C  V            ACWA I DR+ Q +FG YP    WRPIL F    + L P+L
Sbjct: 60  LTECREVLS-SFYKSSHGGACWAVIEDRWLQIMFGFYPPELYWRPILAFALFFVALAPVL 118

Query: 135 IPSFPRKFLNSILLF--GLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISM 192
                   L    L    +     +   +    L+ +   +   +L  L      I+ ++
Sbjct: 119 FADKVPGQLIWFSLAYPFIATWLIWGGAFWAPVLAAMGFVVGVLVLKVLGKITGPIVANL 178

Query: 193 PLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRA 252
              +   L   + +  +       +   R    +  L   +  LP  + +   + +   A
Sbjct: 179 GAVVAALLWWGAIMGPINDGLNKMVGGARLESTIATLQEEADRLPREVAEMEIISEEQAA 238

Query: 253 LLG 255
            + 
Sbjct: 239 GIA 241


>gi|257428635|ref|ZP_05605033.1| polar amino acid ABC transporter [Staphylococcus aureus subsp.
           aureus 65-1322]
 gi|257431272|ref|ZP_05607649.1| polar amino acid ABC transporter [Staphylococcus aureus subsp.
           aureus 68-397]
 gi|257433952|ref|ZP_05610310.1| polar amino acid ABC transporter [Staphylococcus aureus subsp.
           aureus E1410]
 gi|257436868|ref|ZP_05612912.1| polar amino acid ABC transporter [Staphylococcus aureus subsp.
           aureus M876]
 gi|282914654|ref|ZP_06322440.1| amino acid ABC transporter, permease/substrate-binding protein
           [Staphylococcus aureus subsp. aureus M899]
 gi|282924999|ref|ZP_06332665.1| extracellular glutamine-binding protein [Staphylococcus aureus
           subsp. aureus C101]
 gi|293503725|ref|ZP_06667572.1| extracellular glutamine-binding protein [Staphylococcus aureus
           subsp. aureus 58-424]
 gi|293510746|ref|ZP_06669451.1| extracellular glutamine-binding protein [Staphylococcus aureus
           subsp. aureus M809]
 gi|293537288|ref|ZP_06671968.1| amino acid ABC transporter, permease/substrate-binding protein
           [Staphylococcus aureus subsp. aureus M1015]
 gi|257275476|gb|EEV06963.1| polar amino acid ABC transporter [Staphylococcus aureus subsp.
           aureus 65-1322]
 gi|257278220|gb|EEV08868.1| polar amino acid ABC transporter [Staphylococcus aureus subsp.
           aureus 68-397]
 gi|257282045|gb|EEV12182.1| polar amino acid ABC transporter [Staphylococcus aureus subsp.
           aureus E1410]
 gi|257284219|gb|EEV14342.1| polar amino acid ABC transporter [Staphylococcus aureus subsp.
           aureus M876]
 gi|282313365|gb|EFB43761.1| extracellular glutamine-binding protein [Staphylococcus aureus
           subsp. aureus C101]
 gi|282321835|gb|EFB52160.1| amino acid ABC transporter, permease/substrate-binding protein
           [Staphylococcus aureus subsp. aureus M899]
 gi|290920133|gb|EFD97201.1| amino acid ABC transporter, permease/substrate-binding protein
           [Staphylococcus aureus subsp. aureus M1015]
 gi|291095391|gb|EFE25656.1| extracellular glutamine-binding protein [Staphylococcus aureus
           subsp. aureus 58-424]
 gi|291466637|gb|EFF09158.1| extracellular glutamine-binding protein [Staphylococcus aureus
           subsp. aureus M809]
          Length = 485

 Score =  173 bits (437), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 65/226 (28%), Positives = 119/226 (52%), Gaps = 7/226 (3%)

Query: 159 VLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIE 218
           +      +S   +    G+ +T++IS  G+ +   LG  +AL + S I ++ +    +IE
Sbjct: 267 MNDDSGFISKYGSFFLKGIKITILISLIGVALGSILGAFVALMKLSKIKIISWIASIYIE 326

Query: 219 LFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKG 278
           + RG P++  +F+      +      D+  L+   + +   +SAYIAE++R G+ ++ KG
Sbjct: 327 ILRGTPMLVQVFIVF--FGITAALGLDISALVCGTIALVINSSAYIAEIIRAGINAVDKG 384

Query: 279 QFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRV 338
           Q EAA SLGL+Y Q M+ +IMPQ IK ++P + N F+ L K+SS++S I + +++   +V
Sbjct: 385 QMEAARSLGLNYRQTMKSVIMPQAIKNILPALGNEFVTLIKESSIVSTIGVGEIMFNAQV 444

Query: 339 NFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
               S       P T L+    ++++  F ++     IE  L+   
Sbjct: 445 VQGIS-----FDPFTPLLVAAALYFVLTFVLTRIMNMIEGRLNASD 485


>gi|296276990|ref|ZP_06859497.1| amino acid ABC transporter, permease [Staphylococcus aureus subsp.
           aureus MR1]
          Length = 485

 Score =  173 bits (437), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 65/226 (28%), Positives = 119/226 (52%), Gaps = 7/226 (3%)

Query: 159 VLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIE 218
           +      +S   +    G+ +T++IS  G+ +   LG  +AL + S I ++ +    +IE
Sbjct: 267 MNDDSGFISKYGSFFLKGIKITILISLIGVALGSILGAFVALMKLSKIKIISWIASIYIE 326

Query: 219 LFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKG 278
           + RG P++  +F+      +      D+  L+   + +   +SAYIAE++R G+ ++ KG
Sbjct: 327 ILRGTPMLVQVFIVF--FGITAALGLDISTLVCGTIALVINSSAYIAEIIRAGINAVDKG 384

Query: 279 QFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRV 338
           Q EAA SLGL+Y Q M+ +IMPQ IK ++P + N F+ L K+SS++S I + +++   +V
Sbjct: 385 QMEAARSLGLNYRQTMKSVIMPQAIKNILPALGNEFVTLIKESSIVSTIGVGEIMFNAQV 444

Query: 339 NFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
               S       P T L+    ++++  F ++     IE  L+   
Sbjct: 445 VQGIS-----FDPFTPLLVAAALYFVLTFVLTRIMNMIEGRLNASD 485


>gi|319892895|ref|YP_004149770.1| Glutamate ABC transporter, periplasmic glutamine- binding protein
           [Staphylococcus pseudintermedius HKU10-03]
 gi|317162591|gb|ADV06134.1| Glutamate ABC transporter, periplasmic glutamine- binding protein
           [Staphylococcus pseudintermedius HKU10-03]
          Length = 486

 Score =  173 bits (437), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 67/209 (32%), Positives = 113/209 (54%), Gaps = 7/209 (3%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
              G+  T+VIS  G+++    G + AL + S I  L++    +IE  RG PL+  +F+ 
Sbjct: 282 FLTGIKSTIVISLIGVVLGAVFGSMFALMKISTIRPLKWFASAYIEFLRGTPLLVQVFLV 341

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
                       D+   +   + +    SAYIAE++R G+ ++ KGQ EAA SLGLSY Q
Sbjct: 342 F--FGTTAVLGLDISAFICGAIALVINCSAYIAEIIRAGINAVDKGQMEAARSLGLSYSQ 399

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPT 352
            M+ +IMPQ IK+++P + N F+ + K+SS++S+I + +++   +V    S       P 
Sbjct: 400 TMKSVIMPQAIKKILPALGNEFVTVIKESSIVSVIGVSEIMFNAQVVQGAS-----FDPF 454

Query: 353 TGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
           T L+    +F+I  F++S    F+E  + 
Sbjct: 455 TPLLIAAVLFFILTFTLSRLMSFLEGRMS 483


>gi|258423136|ref|ZP_05686030.1| polar amino acid ABC transporter [Staphylococcus aureus A9635]
 gi|257846700|gb|EEV70720.1| polar amino acid ABC transporter [Staphylococcus aureus A9635]
          Length = 485

 Score =  173 bits (437), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 65/226 (28%), Positives = 119/226 (52%), Gaps = 7/226 (3%)

Query: 159 VLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIE 218
           +      +S   +    G+ +T++IS  G+ +   LG  +AL + S I ++ +    +IE
Sbjct: 267 MNDDSGFISKYGSFFLKGIKITILISLIGVALGSILGAFVALMKLSKIKIISWIASIYIE 326

Query: 219 LFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKG 278
           + RG P++  +F+      +      D+  L+   + +   +SAYIAE++R G+ ++ KG
Sbjct: 327 ILRGTPMLVQVFIVF--FGITAALGLDISALVCGTIALVINSSAYIAEIIRAGINAVDKG 384

Query: 279 QFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRV 338
           Q EAA SLGL+Y Q M+ +IMPQ IK ++P + N F+ L K+SS++S I + +++   +V
Sbjct: 385 QMEAARSLGLNYRQTMKSVIMPQAIKNILPSLGNEFVTLIKESSIVSTIGVGEIMFNAQV 444

Query: 339 NFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
               S       P T L+    ++++  F ++     IE  L+   
Sbjct: 445 VQGIS-----FDPFTPLLVAAALYFVLTFVLTRIMNMIEGRLNASD 485


>gi|148255316|ref|YP_001239901.1| putative amino acid ABC transporter permease [Bradyrhizobium sp.
           BTAi1]
 gi|146407489|gb|ABQ35995.1| amino acid ABC transporter membrane protein 2, PAAT family
           [Bradyrhizobium sp. BTAi1]
          Length = 506

 Score =  173 bits (437), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 123/265 (46%), Positives = 178/265 (67%)

Query: 121 LVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVT 180
              +  +++          R  + +   F    +    +     GL IV+T LWGG+LVT
Sbjct: 241 TAIVVTALVFVIGGGSRALRSVVATAATFAGIALVIAIMGLDRGGLPIVDTRLWGGMLVT 300

Query: 181 LVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFL 240
           LV+S  GI+ SMP+GI LALGR S IP++R   I FIEL RGVPL+TVLF A+ MLPLFL
Sbjct: 301 LVVSVIGIVASMPIGIALALGRRSTIPLIRLFSIAFIELVRGVPLITVLFFATYMLPLFL 360

Query: 241 PDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMP 300
           P    +D L+RAL+GV+ F+ AY+AEV+RGGLQ+I +GQ EAA++LGLS+ +    I++P
Sbjct: 361 PGNMRIDGLVRALVGVALFSGAYMAEVIRGGLQAIPRGQAEAASALGLSWWKTTSFIVLP 420

Query: 301 QVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGF 360
           Q ++ VIPGIVN+FI LFKD+SL+SI+ +FDLLG ++ +F++  W +  T  TG  F G 
Sbjct: 421 QALRHVIPGIVNSFISLFKDTSLVSIVALFDLLGSLKASFADPVWATPTTAFTGFAFTGL 480

Query: 361 VFWIFCFSISLYSVFIEKTLHKGSK 385
           ++++FCF +S YS+ +E+ L+   +
Sbjct: 481 IYFVFCFGMSRYSLLVERRLNAHRR 505



 Score =  103 bits (256), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 68/275 (24%), Positives = 112/275 (40%), Gaps = 9/275 (3%)

Query: 1   MIDSCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGI 60
           M D      ++R+ +      PV   G   ++      +P +ILLT +   L+ F++   
Sbjct: 1   MTDITAS-TFIRQDMAGERPAPVKTTGFTGFVRTRLLNSPTNILLTLVSALLIWFTVIPA 59

Query: 61  IHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPI 120
           + ++ +DAVW+G +R  C   + G         ACW ++  ++ QF++G YP A+RWR  
Sbjct: 60  LKFLLVDAVWVGKDREACLEQNVGHAV-----GACWPYVTAKFGQFMYGFYPDAERWRVN 114

Query: 121 LVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVT 180
           L +    +LL P+LIP  P K LN+ L F   P+ +FF+L  G GLS    S     L  
Sbjct: 115 LTYGLAVVLLVPLLIPRLPAKGLNAGLFFFALPVVAFFLL-YGGGLSGFGVSWTAATLQL 173

Query: 181 LVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFL 240
              S      ++  G          + +L    +    L     L+  L      L    
Sbjct: 174 FAESVDTAGNALVRGGANLPVVGMLMWLLGKLVVLIGML--ASLLIWPLVWVRDQLQASH 231

Query: 241 PDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSI 275
              W    L   ++    F     +  LR  + + 
Sbjct: 232 QPVWTDLALTAIVVTALVFVIGGGSRALRSVVATA 266


>gi|312865954|ref|ZP_07726175.1| lysine-arginine-ornithine-binding periplasmic protein
           [Streptococcus downei F0415]
 gi|311098358|gb|EFQ56581.1| lysine-arginine-ornithine-binding periplasmic protein
           [Streptococcus downei F0415]
          Length = 731

 Score =  173 bits (437), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 51/213 (23%), Positives = 111/213 (52%), Gaps = 9/213 (4%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPL-VTVLFM 231
           L  GL +T+ ++     I+M +GI+  +   +   +L+     F+++ RG+PL +   F+
Sbjct: 524 LLQGLWITVALTLLSFAIAMVIGIIFGMMAVAPNKILQGIAKVFVDVVRGIPLMIVAAFI 583

Query: 232 ASIMLPLFLP---DTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGL 288
              +  L          ++  + A + +S  A+AYIAE++RGG++++ KGQ EA+ SLG+
Sbjct: 584 YWGIPNLIESITGHQSPINDFVAATIALSLNAAAYIAEIVRGGIEAVPKGQMEASRSLGI 643

Query: 289 SYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISS 348
            Y + MR +I+PQ ++ ++P  +N F+   KD++++S I + +L    ++  +      +
Sbjct: 644 PYGKTMRKVILPQAVRVMLPNFINQFVISLKDTTIVSAIGLVELFQTGKIIIA-----RN 698

Query: 349 VTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
                    +  ++ +    ++  +  +E+ L 
Sbjct: 699 YQSFRMYAILAIIYLVIITLLTRLAKRLERKLK 731


>gi|159904018|ref|YP_001551362.1| ABC-type amino acid transport system, permease component
           [Prochlorococcus marinus str. MIT 9211]
 gi|159889194|gb|ABX09408.1| ABC-type amino acid transport system, permease component
           [Prochlorococcus marinus str. MIT 9211]
          Length = 339

 Score =  172 bits (436), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 104/349 (29%), Positives = 176/349 (50%), Gaps = 29/349 (8%)

Query: 37  FGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACW 96
           F    D L+T   I  + F +  ++ W+F  A W                          
Sbjct: 16  FSNVFDGLITLSFIFCIGFLLKNLLQWLFFRANWT------------------------- 50

Query: 97  AFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFGLF-PIF 155
             +      + FG +P  QRWRP L   +   L T  L+          I +  +     
Sbjct: 51  -VVTHNLSLYTFGIFPPDQRWRPTLWLFSLLALTTVTLLRPGLPWVRKLIPIAWISAVPV 109

Query: 156 SFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACIT 215
             ++L GGLGL  + +  WGGL +TL +     +I+ PLG++ A+GR S   +++Y    
Sbjct: 110 GIYLLSGGLGLLPISSRYWGGLTLTLFLMASSALIAFPLGMIFAIGRQSEHFLIKYLSAI 169

Query: 216 FIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSI 275
           +I+  R +PL+ +LF   +++PLFLP   +++++LRA++  + F SAY+AE +RGGLQ+I
Sbjct: 170 YIDTLRAIPLIAILFFGQLLIPLFLPFGLEINRVLRAVIAFALFVSAYVAEDIRGGLQAI 229

Query: 276 SKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGI 335
              Q EAA +LGL+  Q  + I++PQ I   IP + N  IGL +++SL++I+ + +LLGI
Sbjct: 230 PTSQIEAAKALGLTDFQIKQFIVLPQAITIAIPALANQAIGLLQNTSLMAILGLVELLGI 289

Query: 336 VRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
            R   +   +I         +++  ++W+ C  I++ S  IE+ +  G 
Sbjct: 290 SRSILANPEFIGRY--VEVYVWLALIYWLVCTVIAILSRHIEQRMKIGK 336


>gi|314934022|ref|ZP_07841387.1| amino acid ABC transporter, permease/substrate-binding protein
           [Staphylococcus caprae C87]
 gi|313654172|gb|EFS17929.1| amino acid ABC transporter, permease/substrate-binding protein
           [Staphylococcus caprae C87]
          Length = 485

 Score =  172 bits (436), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 66/214 (30%), Positives = 113/214 (52%), Gaps = 7/214 (3%)

Query: 171 TSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLF 230
           +    G+  T++IS  G+I+   LG  +AL + +    L +    +IE  RG P++  +F
Sbjct: 279 SFFIKGIKNTILISLVGVILGSILGAFIALLKINKFKPLSWLASIYIEFLRGTPMLVQVF 338

Query: 231 MASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSY 290
           +             DV  L+   + +   +SAYIAE++R G+ ++ KGQ EAA SLGL+Y
Sbjct: 339 IVF--FGTTAALGLDVSALICGTIALIINSSAYIAEIIRAGINAVDKGQMEAARSLGLNY 396

Query: 291 LQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVT 350
           +Q M+ +IMPQ IK ++P + N F+ L K+SS++S I + +++   +V    S       
Sbjct: 397 IQTMKSVIMPQAIKNILPALGNEFVTLIKESSIVSTIGVGEIMFNAQVVQGIS-----FD 451

Query: 351 PTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
           P T LI    +++I  F++S     +E  +    
Sbjct: 452 PFTPLIVAAVLYFILTFALSRIMSLVEGRMKASD 485


>gi|75675719|ref|YP_318140.1| amino acid ABC transporter, inner membrane component [Nitrobacter
           winogradskyi Nb-255]
 gi|74420589|gb|ABA04788.1| amino acid ABC transporter membrane protein 2, PAAT family
           [Nitrobacter winogradskyi Nb-255]
          Length = 506

 Score =  172 bits (436), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 128/264 (48%), Positives = 179/264 (67%)

Query: 122 VFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTL 181
            F++  +        +     L S+  F    +    +     GL +V+T LWGGLLVTL
Sbjct: 242 AFISLLLFFFSGGFRAGWGALLTSLTAFAGMGLIIAVMPLDRGGLPVVDTRLWGGLLVTL 301

Query: 182 VISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLP 241
           V+S  GI+ S+P+GI LALGR S +P++R   I FIE +RGVPL+TVLF A+ MLPLFLP
Sbjct: 302 VVSVTGIVSSIPIGIALALGRRSTLPLIRVFSIAFIEFWRGVPLITVLFFATYMLPLFLP 361

Query: 242 DTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQ 301
             + VD L+R L+G++ FA AY AEV+RGGL ++  GQ EAA++LGLSY +   LI+MPQ
Sbjct: 362 GNFTVDGLVRVLIGIALFAGAYNAEVIRGGLAAVPGGQAEAAHALGLSYWKTTGLIVMPQ 421

Query: 302 VIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFV 361
            ++ VIPG+VN+FI LFKD+SL+SI+ +FDLLGI+R +F++ TW +  T  TG  F G +
Sbjct: 422 AVRHVIPGLVNSFIALFKDTSLVSIVALFDLLGILRASFADPTWATPTTLFTGFAFTGLI 481

Query: 362 FWIFCFSISLYSVFIEKTLHKGSK 385
           ++ FCFSIS YS+F+E  L+   +
Sbjct: 482 YFAFCFSISRYSLFVEHRLNAHRR 505



 Score = 99.0 bits (245), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 54/153 (35%), Positives = 82/153 (53%), Gaps = 5/153 (3%)

Query: 9   PYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDA 68
            +VR  L+     PV    ++ ++    F +P + LLT + + LL   +   + ++F+DA
Sbjct: 8   SFVRDDLVPERRAPVTTTNLLRFVQIRLFNSPGNALLTFVGVALLWLFVVPAVRFLFIDA 67

Query: 69  VWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSI 128
            W G +RT C     G         ACW F+  +  QFI+G YP  +RWR  L FL  ++
Sbjct: 68  AWEGQDRTSCLAADAGQS-----IGACWPFVQAKITQFIYGFYPEPERWRVNLTFLLAAV 122

Query: 129 LLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLY 161
           LL P+LIP  P K LN+ L F  FP+ +FF+L+
Sbjct: 123 LLLPLLIPRLPAKRLNAGLFFVAFPVTAFFLLH 155


>gi|223043619|ref|ZP_03613664.1| glutamine-binding periplasmic protein [Staphylococcus capitis SK14]
 gi|222443107|gb|EEE49207.1| glutamine-binding periplasmic protein [Staphylococcus capitis SK14]
          Length = 485

 Score =  172 bits (436), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 66/214 (30%), Positives = 113/214 (52%), Gaps = 7/214 (3%)

Query: 171 TSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLF 230
           +    G+  T++IS  G+I+   LG  +AL + +    L +    +IE  RG P++  +F
Sbjct: 279 SFFIKGIKNTILISLVGVILGSILGAFIALLKINKFKPLSWLASIYIEFLRGTPMLVQVF 338

Query: 231 MASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSY 290
           +             DV  L+   + +   +SAYIAE++R G+ ++ KGQ EAA SLGL+Y
Sbjct: 339 IVF--FGTTAALGLDVSALICGTIALIINSSAYIAEIIRAGINAVDKGQMEAARSLGLNY 396

Query: 291 LQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVT 350
           +Q M+ +IMPQ IK ++P + N F+ L K+SS++S I + +++   +V    S       
Sbjct: 397 IQTMKSVIMPQAIKNILPALGNEFVTLIKESSIVSTIGVSEIMFNAQVVQGIS-----FD 451

Query: 351 PTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
           P T LI    +++I  F++S     +E  +    
Sbjct: 452 PFTPLIVAAVLYFILTFALSRIMSLVEGRMKASD 485


>gi|307155069|ref|YP_003890453.1| polar amino acid ABC transporter inner membrane subunit [Cyanothece
           sp. PCC 7822]
 gi|306985297|gb|ADN17178.1| polar amino acid ABC transporter, inner membrane subunit
           [Cyanothece sp. PCC 7822]
          Length = 511

 Score =  172 bits (436), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 64/261 (24%), Positives = 123/261 (47%), Gaps = 12/261 (4%)

Query: 133 MLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISM 192
            +   +       + L                    +  +L  G  +T++++ F ++  +
Sbjct: 252 SIYEKWFGTQPPELPLTAPSLDSQSEKFDPQSFYINLFQNLIKGAGITVLLTAFSVLFGL 311

Query: 193 PLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDT----WDVDK 248
             G L+AL   S   +LR  C  +++ FRG P++  LF+    LP    D     W + +
Sbjct: 312 MGGTLIALALISPYSLLRLLCRIYVDFFRGTPMLVQLFIIYFGLPALFQDHLGIEWSLPR 371

Query: 249 LLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIP 308
              A++ +S   +AY+AE++RGG++SI +GQ+EA  SLG++  Q M+ +I PQ  +R++P
Sbjct: 372 FPAAVIALSLNVAAYLAEIIRGGIESIDRGQWEACESLGMTPQQTMQDVIFPQAFRRILP 431

Query: 309 GIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFS 368
            + N FI L KD+SL ++I   +L    ++  + +            I +  V+ I    
Sbjct: 432 PLGNEFITLIKDTSLTAVIGFQELFREGQLIVAVT-----YKAFEVYIAVALVYLILTSL 486

Query: 369 ISLYSVFIEKTLH---KGSKK 386
            S+   ++E  ++   +  K+
Sbjct: 487 SSIAFKWLEAAMNPLERAKKR 507


>gi|27379559|ref|NP_771088.1| amino acid ABC transporter permease protein [Bradyrhizobium
           japonicum USDA 110]
 gi|27352711|dbj|BAC49713.1| amino acid ABC transporter permease protein [Bradyrhizobium
           japonicum USDA 110]
          Length = 506

 Score =  172 bits (436), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 128/269 (47%), Positives = 179/269 (66%)

Query: 117 WRPILVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGG 176
           +    V ++    L    + +  R   +SI  F    I    +     GL +VETSLWGG
Sbjct: 237 FAITAVIVSLIAFLLGGGVRAGWRALASSIATFVAIAIVIKLMGLDHGGLPVVETSLWGG 296

Query: 177 LLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIML 236
           LLVTLV+S  GI+ S+P+GI LALGR S IP++R   I FIE +RGVPL+TVLF A+ ML
Sbjct: 297 LLVTLVVSVTGIVTSLPIGIALALGRRSTIPLIRIFSIAFIEFWRGVPLITVLFFATYML 356

Query: 237 PLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRL 296
           PLFLP  + VD L+RAL+G++ F  AY AE +RGGL +I +GQ EAA +LGLS+ +   L
Sbjct: 357 PLFLPGNFTVDGLVRALIGIALFTGAYQAENVRGGLAAIPRGQGEAAAALGLSWWKTTSL 416

Query: 297 IIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLI 356
           I++PQ ++ VIP +VN+FI LFKD+SL+SI+ +FDLLG +R +FS+  W +  T  TG  
Sbjct: 417 IVLPQALRHVIPNLVNSFISLFKDTSLVSIVALFDLLGSLRASFSDPKWSTPSTAFTGFA 476

Query: 357 FIGFVFWIFCFSISLYSVFIEKTLHKGSK 385
           F G ++++FCF +S YS+F+E  L+   +
Sbjct: 477 FAGIIYFLFCFGMSRYSLFVEHRLNAHRR 505



 Score = 96.0 bits (237), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 49/141 (34%), Positives = 72/141 (51%), Gaps = 6/141 (4%)

Query: 1   MIDSCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGI 60
           M D      +VR+ LL     PV   G +  +    F +P +ILLT +   LL F+I   
Sbjct: 1   MTDITSS-SFVRQDLLTERPAPVKTTGFVGLMRTRLFNSPTNILLTIVGALLLWFTIIPS 59

Query: 61  IHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPI 120
           + ++ +DAVW G +RT C   + G         ACW +I  +  Q I+G YP A+RWR  
Sbjct: 60  VRFLMVDAVWAGKDRTACLAENAGFAV-----GACWPYIQAKLPQLIYGFYPEAERWRVN 114

Query: 121 LVFLTGSILLTPMLIPSFPRK 141
           L  +  ++LL P+L+P  P K
Sbjct: 115 LTLILAAVLLVPLLVPRLPSK 135


>gi|323464072|gb|ADX76225.1| glutamine-binding periplasmic protein [Staphylococcus
           pseudintermedius ED99]
          Length = 486

 Score =  172 bits (435), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 65/209 (31%), Positives = 113/209 (54%), Gaps = 7/209 (3%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
              G+  T+VIS  G+++    G + AL + S I  L++    +IE  RG PL+  +F+ 
Sbjct: 282 FLTGIKSTIVISLIGVVLGAVFGSMFALMKISTIRPLKWFASAYIEFLRGTPLLVQVFLV 341

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
                       D+   +   + +    SAYIAE++R G+ ++ KGQ EAA SLGLSY Q
Sbjct: 342 F--FGTTAVLGLDISAFICGAIALVINCSAYIAEIIRAGINAVDKGQMEAARSLGLSYSQ 399

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPT 352
            ++ +IMPQ IK+++P + N F+ + K+SS++S+I + +++   +V    S       P 
Sbjct: 400 TIKSVIMPQAIKKILPALGNEFVTVIKESSIVSVIGVSEIMFNAQVVQGAS-----FDPF 454

Query: 353 TGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
           T L+    +++I  F++S    F+E  + 
Sbjct: 455 TPLLIAAVLYFILTFTLSRLMSFLEGRMS 483


>gi|283770942|ref|ZP_06343834.1| polar amino acid ABC transporter inner membrane subunit
           [Staphylococcus aureus subsp. aureus H19]
 gi|283461089|gb|EFC08179.1| polar amino acid ABC transporter inner membrane subunit
           [Staphylococcus aureus subsp. aureus H19]
          Length = 485

 Score =  172 bits (435), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 65/226 (28%), Positives = 119/226 (52%), Gaps = 7/226 (3%)

Query: 159 VLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIE 218
           +      +S   +    G+ +T++IS  G+ +   LG  +AL + S I ++ +    +IE
Sbjct: 267 MNDDSGFISKYGSFFLKGIKITILISLIGVALGSILGAFVALMKLSKIKIISWIPSIYIE 326

Query: 219 LFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKG 278
           + RG P++  +F+      +      D+  L+   + +   +SAYIAE++R G+ ++ KG
Sbjct: 327 ILRGTPMLVQVFIVF--FGITAALGLDISALVCGTIALVINSSAYIAEIIRAGINAVDKG 384

Query: 279 QFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRV 338
           Q EAA SLGL+Y Q M+ +IMPQ IK ++P + N F+ L K+SS++S I + +++   +V
Sbjct: 385 QMEAARSLGLNYRQTMKSVIMPQAIKNILPALGNEFVTLIKESSIVSTIGVGEIMFNAQV 444

Query: 339 NFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
               S       P T L+    ++++  F ++     IE  L+   
Sbjct: 445 VQGIS-----FDPFTPLLVAAALYFVLTFVLTRIMNMIEGRLNASD 485


>gi|92117597|ref|YP_577326.1| amino acid ABC transporter permease [Nitrobacter hamburgensis X14]
 gi|91800491|gb|ABE62866.1| amino acid ABC transporter membrane protein 2, PAAT family
           [Nitrobacter hamburgensis X14]
          Length = 506

 Score =  172 bits (435), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 129/264 (48%), Positives = 179/264 (67%)

Query: 122 VFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTL 181
             ++  + L      +  R  L S+  F    +    +     GL IV T LWGGLLVTL
Sbjct: 242 AIVSLLLFLLSGAFRTGWRALLTSLTTFVGIGLVIAVMHLDRGGLPIVNTRLWGGLLVTL 301

Query: 182 VISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLP 241
           V+S  GI+ S+P+GI LALGR S IP++R   I FIE +RG+PL+TVLF A+ MLPLFLP
Sbjct: 302 VVSVTGIVASIPIGIALALGRRSTIPLIRIFSIAFIEFWRGIPLITVLFFATYMLPLFLP 361

Query: 242 DTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQ 301
             + VD L+R L+GV+ FA AY AEV+RGGL +I +GQ EAA++LGLSY +   LI+MPQ
Sbjct: 362 GNFTVDGLVRVLIGVALFAGAYNAEVIRGGLAAIPRGQAEAAHALGLSYWKTTGLIVMPQ 421

Query: 302 VIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFV 361
            ++ VIPG+VN+FI LFKD+SL+SI+ +FDLLG +R +F++ TW +  T  TG  F G +
Sbjct: 422 ALRHVIPGLVNSFIALFKDTSLVSIVALFDLLGSLRASFADPTWATPTTLFTGFAFAGII 481

Query: 362 FWIFCFSISLYSVFIEKTLHKGSK 385
           +++FCF +S YS+F+E  L+   +
Sbjct: 482 YFVFCFGMSRYSLFVEHRLNAHRR 505



 Score =  105 bits (262), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 57/155 (36%), Positives = 82/155 (52%), Gaps = 5/155 (3%)

Query: 7   EFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFL 66
              +VR  L+     P+   G + ++    F TP + LLT +   LL F I   I ++ +
Sbjct: 6   TLSFVRADLVPERPAPIKTIGFVGFLRTRLFNTPTNALLTIVGALLLWFIIVPTIRFLLV 65

Query: 67  DAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTG 126
           DAVW G +RT C     G         ACW F+  +  QFI+G YP  +RWR  L FL  
Sbjct: 66  DAVWEGKDRTSCLAADAGQS-----IGACWPFVQAKITQFIYGFYPEPERWRVNLTFLLA 120

Query: 127 SILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLY 161
           ++LL P+LIP  P K LN+ + F  FP+ +FF+L+
Sbjct: 121 AVLLLPLLIPRLPAKSLNAGVFFVAFPVVAFFLLH 155


>gi|116492898|ref|YP_804633.1| ABC-type amino acid transport system, permease and periplasmic
           component [Pediococcus pentosaceus ATCC 25745]
 gi|116103048|gb|ABJ68191.1| amino acid ABC transporter membrane protein, PAAT family / amino
           acid ABC transporter substrate-binding protein, PAAT
           family [Pediococcus pentosaceus ATCC 25745]
          Length = 488

 Score =  171 bits (434), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 75/223 (33%), Positives = 117/223 (52%), Gaps = 16/223 (7%)

Query: 168 IVETSLWGGL-------LVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELF 220
            V TS+             T++IS  G+I     G LLAL R S+  VLR     ++E  
Sbjct: 275 TVNTSMIHYWKYFAMGVGYTILISILGVIFGFITGTLLALLRLSDNKVLRGLSAAYVEFV 334

Query: 221 RGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQF 280
           RG PL+  L      L LF     ++  L   ++ VS  + AY+AEV+RGG+ S+  GQ 
Sbjct: 335 RGTPLMVQLMFVYFGLGLF----VNLPALTAGIIAVSLNSGAYVAEVIRGGINSVDDGQR 390

Query: 281 EAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNF 340
           EAA SLGL+   +MR +IMPQ +K + P + N FI L K+SS++SII + DL+  +++  
Sbjct: 391 EAAESLGLNKRDRMRFVIMPQALKNIWPALGNEFISLIKESSIVSIIGVTDLIYQLKIVQ 450

Query: 341 SESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKG 383
           S++           ++    ++++  FS+S    F E+  + G
Sbjct: 451 SDT-----YRGVAPIVVAMILYFVMTFSLSRLLKFYERKFNNG 488


>gi|293366163|ref|ZP_06612849.1| amino acid ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|291319685|gb|EFE60045.1| amino acid ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus epidermidis
           M23864:W2(grey)]
          Length = 472

 Score =  171 bits (434), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 64/214 (29%), Positives = 116/214 (54%), Gaps = 7/214 (3%)

Query: 171 TSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLF 230
           +    G+  T++IS  G+++   LG  +AL + S I  L++    +IE  RG P++  +F
Sbjct: 266 SFFIKGIKNTILISLVGVVLGSILGSFIALLKISKIRPLQWIASIYIEFLRGTPMLVQVF 325

Query: 231 MASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSY 290
           +             D+  L+   + +   +SAYIAE++R G+ ++ KGQ EAA SLGL+Y
Sbjct: 326 IVF--FGTTAALGLDISALICGTIALVINSSAYIAEIIRAGINAVDKGQTEAARSLGLNY 383

Query: 291 LQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVT 350
            Q M+ ++MPQ IK+++P + N F+ L K+SS++S I + +++   +V    S       
Sbjct: 384 RQTMQSVVMPQAIKKILPALGNEFVTLIKESSIVSTIGVSEIMFNAQVVQGIS-----FD 438

Query: 351 PTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
           P T L+    ++++  F+++    FIE  +    
Sbjct: 439 PFTPLLVAALLYFLLTFALTRVMNFIEGRMSASD 472


>gi|328464936|gb|EGF36224.1| glutamine ABC transporter substrate binding/permease protein
           [Lactobacillus helveticus MTCC 5463]
          Length = 473

 Score =  171 bits (434), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 60/209 (28%), Positives = 110/209 (52%), Gaps = 8/209 (3%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
              G   T++I+ F ++I + LG+LLAL R S   +L +  + +IE  RG P +  +   
Sbjct: 270 FVKGTEYTIIITVFSVLIGIVLGMLLALMRLSKNKLLHWIAVCYIEFIRGTPQMVQILFV 329

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
              +   +    ++  L+  ++ +   + AY+AE +R G+ S++KGQ EAA SLGLS  +
Sbjct: 330 YFGVGALIS---NLSALVAGIIAIGLNSGAYVAEDIRSGIASVAKGQTEAARSLGLSQAK 386

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPT 352
             R +I+PQ +K + P + N FI L KDSSL+S+I + +L+    +  + +         
Sbjct: 387 AYRYVIIPQALKNIWPALDNEFITLLKDSSLVSVIGVTELMYQTELIQTST-----YRGV 441

Query: 353 TGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
             L     +++I  F+++    + E+ + 
Sbjct: 442 LPLFIAMIIYFIMTFTLTRLLNYFERRMK 470


>gi|90424050|ref|YP_532420.1| amino acid ABC transporter permease [Rhodopseudomonas palustris
           BisB18]
 gi|90106064|gb|ABD88101.1| Amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine [Rhodopseudomonas palustris
           BisB18]
          Length = 499

 Score =  171 bits (433), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 130/264 (49%), Positives = 184/264 (69%)

Query: 122 VFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTL 181
             ++G + +      +  R  L S+ +F    +  F +     GL IV+T +WGGLLVTL
Sbjct: 235 AVVSGLLFVLNGGFRNGWRALLRSLAMFAGIAVVIFVMRLDRGGLPIVDTRMWGGLLVTL 294

Query: 182 VISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLP 241
           V+S  GI+ SMP+GI LALGR S IP++R   + FIE +RGVPL+TVLF A+ MLPLFLP
Sbjct: 295 VVSVTGIVTSMPVGIALALGRRSTIPLIRIFSVLFIEFWRGVPLITVLFFATYMLPLFLP 354

Query: 242 DTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQ 301
             + VD L+R L+G++ FA AY AEV+RGGLQ+I +GQ EAA++LGLSY +   L++MPQ
Sbjct: 355 GNFTVDGLVRVLIGIALFAGAYNAEVIRGGLQAIPRGQAEAASALGLSYWKITGLVVMPQ 414

Query: 302 VIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFV 361
            ++ VIPG+VN+FI LFKD+SL+SI+ +FDLLG +R +F++ TW +  T  TG  F G V
Sbjct: 415 ALRHVIPGLVNSFIALFKDTSLVSIVALFDLLGSLRASFADPTWSTPTTLFTGFAFTGIV 474

Query: 362 FWIFCFSISLYSVFIEKTLHKGSK 385
           +++FCF +S YS+F+E  L+   +
Sbjct: 475 YFVFCFGMSRYSLFVEHRLNAHRR 498



 Score =  105 bits (263), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 55/153 (35%), Positives = 83/153 (54%), Gaps = 5/153 (3%)

Query: 9   PYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDA 68
            +VR+ L+     PV   G   +I    F TP + +LT +   LL  +I   + ++ +DA
Sbjct: 7   SFVRQDLVDSRPAPVKTTGFTGFIRTRLFNTPTNAILTIVGAALLWLTIVPTVKFLLIDA 66

Query: 69  VWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSI 128
           VW G++RT C     G         ACW F+  ++ QF++G YP  +RWR  L F   ++
Sbjct: 67  VWQGTSRTDCLAAGAGHEV-----GACWPFVQAKFAQFVYGFYPEQERWRVNLTFGLAAL 121

Query: 129 LLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLY 161
           LL P+LIP  P K LN+ L F  FP+ +FF+L+
Sbjct: 122 LLLPLLIPRVPAKSLNAGLFFVAFPVVAFFLLH 154


>gi|16330176|ref|NP_440904.1| glutamine ABC transporter [Synechocystis sp. PCC 6803]
 gi|1652664|dbj|BAA17584.1| glutamine-binding periplasmic protein/glutamine transport system
           permease protein [Synechocystis sp. PCC 6803]
          Length = 530

 Score =  171 bits (433), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 61/219 (27%), Positives = 114/219 (52%), Gaps = 8/219 (3%)

Query: 166 LSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPL 225
           L  +  +L+ G ++T++++ F +   +  G  +A+   S+I  L+     ++E FRG P+
Sbjct: 303 LITLFRNLFKGSILTVLLTAFSVFFGLIGGTGVAIALISDIKPLQLIFRIYVEFFRGTPM 362

Query: 226 VTVLFMASIMLPLFL---PDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEA 282
           +  LF+    LP           +D+   A++ +S   +AY+AE++RGG+QSI +GQ+EA
Sbjct: 363 LVQLFIIYFGLPALFKEIGLGITIDRFPAAIIALSLNVAAYLAEIIRGGIQSIDQGQWEA 422

Query: 283 ANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSE 342
             SLG+S  Q M+ +I PQ  +R++P + N FI L KD+SL ++I   +L    ++  + 
Sbjct: 423 CESLGMSPWQTMKEVIFPQAFRRILPPLGNEFITLIKDTSLTAVIGFQELFREGQLIVAT 482

Query: 343 STWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
           +            I +  V+ +     S    ++E  + 
Sbjct: 483 T-----YRAFEVYIAVALVYLLLTTISSFVFKWLENYMD 516


>gi|85717303|ref|ZP_01048257.1| amino acid ABC transporter, inner membrane component [Nitrobacter
           sp. Nb-311A]
 gi|85695892|gb|EAQ33796.1| amino acid ABC transporter, inner membrane component [Nitrobacter
           sp. Nb-311A]
          Length = 506

 Score =  171 bits (433), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 126/264 (47%), Positives = 177/264 (67%)

Query: 122 VFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTL 181
             ++  + L         R    S+  F    +    +     GL +V+T LWGGLLVTL
Sbjct: 242 AIVSLLLFLLSGGFRGGWRTLFTSLTTFVGMGLIIAVMHLDRGGLPVVDTRLWGGLLVTL 301

Query: 182 VISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLP 241
           V+S  GI+ S+P+GI LALGR S +P++R   I FIE +RGVPL+TVLF A+ MLPLFLP
Sbjct: 302 VVSVTGIVSSIPIGIALALGRRSTLPLIRIFSIAFIEFWRGVPLITVLFFATYMLPLFLP 361

Query: 242 DTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQ 301
             + +D L+R L+G++ FA AY AEV+RGGL +I  GQ EAA++LGLSY +   LI+MPQ
Sbjct: 362 GNFTIDGLVRVLIGIALFAGAYNAEVIRGGLAAIPSGQAEAAHALGLSYWKTTGLIVMPQ 421

Query: 302 VIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFV 361
            ++ VIPG+VN+FI LFKD+SL+SI+ +FDLLGI+R +F++  W +  T  TG  F G +
Sbjct: 422 AVRNVIPGLVNSFIALFKDTSLVSIVALFDLLGILRASFADPAWATPTTLFTGFAFTGLI 481

Query: 362 FWIFCFSISLYSVFIEKTLHKGSK 385
           ++ FCFS+S YS+F+E  L+   +
Sbjct: 482 YFAFCFSMSRYSLFVEHRLNAHRR 505



 Score = 97.1 bits (240), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 55/153 (35%), Positives = 79/153 (51%), Gaps = 5/153 (3%)

Query: 9   PYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDA 68
            +VR  L+     PV    ++  +    F +P + LLT +   LL   +   + + F+DA
Sbjct: 8   SFVRVALVPERRAPVRTTSLVRLLGIRLFSSPSNALLTVVGAALLWLFLVPAVRFFFVDA 67

Query: 69  VWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSI 128
           VW G NRT C               ACW F+  +  QFI+G YP  +RWR  L FL  ++
Sbjct: 68  VWEGQNRTSCLAADASQS-----IGACWPFVQAKITQFIYGFYPEPERWRVNLTFLLAAV 122

Query: 129 LLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLY 161
           LL P+LIP  P K LN+ L F  FP+ +FF+L+
Sbjct: 123 LLLPLLIPRLPAKRLNAGLFFVAFPVAAFFLLH 155


>gi|257869222|ref|ZP_05648875.1| amino acid ABC transporter [Enterococcus gallinarum EG2]
 gi|257803386|gb|EEV32208.1| amino acid ABC transporter [Enterococcus gallinarum EG2]
          Length = 718

 Score =  171 bits (433), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 60/209 (28%), Positives = 114/209 (54%), Gaps = 7/209 (3%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
           L  GL  TL+++     +++ +GI+L L   S I  LR     ++++ RG+P++ + F  
Sbjct: 517 LLKGLWNTLLLALISFALALIIGIILGLFSVSPIRALRIFAGIYVDIIRGIPMMVLAFFI 576

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
              L         +      ++ ++  ASAYIAE++RGG++++  GQ EA+ SLGL+Y +
Sbjct: 577 FFGLS--DAIGITIPDFAAGVITLTLNASAYIAEIVRGGIKAVPVGQMEASRSLGLTYTR 634

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPT 352
            M+ II+PQ IK +IP  VN F+   KD+++IS+I + +LL   ++  + +        T
Sbjct: 635 TMQKIILPQAIKIMIPSFVNQFVISLKDTTIISVIGVVELLQTGKIIVART-----TQST 689

Query: 353 TGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
              + +  ++ I   +++  +  +EK + 
Sbjct: 690 YVYLIVAVMYLIVITALTKLAKVLEKKVK 718


>gi|227894251|ref|ZP_04012056.1| amino acid ABC superfamily ATP binding cassette transporter,
           membrane protein [Lactobacillus ultunensis DSM 16047]
 gi|227863971|gb|EEJ71392.1| amino acid ABC superfamily ATP binding cassette transporter,
           membrane protein [Lactobacillus ultunensis DSM 16047]
          Length = 494

 Score =  171 bits (433), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 61/209 (29%), Positives = 112/209 (53%), Gaps = 8/209 (3%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
              G+  T+VI+ F ++I + LG+LLAL R S   +L +  + +IE  RG P +  +   
Sbjct: 291 FIKGVGYTIVITVFSVLIGIVLGMLLALMRLSQNKLLHWIAVCYIEFIRGTPQMVQILFV 350

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
              + + +    ++  L+  ++ +   + AY+AE +R G+ S++KGQ EAA SLGLS  +
Sbjct: 351 YFGIGVLIS---NLSALVAGIIAIGLNSGAYVAEDIRSGISSVAKGQTEAARSLGLSQAK 407

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPT 352
             R +I+PQ +K + P + N FI L KDSSL+S+I + +L+    +  + +         
Sbjct: 408 AYRYVIIPQALKNIWPALGNEFITLLKDSSLVSVIGVTELMYQTELIQTST-----YRGV 462

Query: 353 TGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
             L     +++I  F+++    + E+ + 
Sbjct: 463 LPLFIAMIIYFIMTFTLTRLLNYFERRMK 491


>gi|256849332|ref|ZP_05554765.1| glutamine ABC transporter permease [Lactobacillus crispatus
           MV-1A-US]
 gi|256714108|gb|EEU29096.1| glutamine ABC transporter permease [Lactobacillus crispatus
           MV-1A-US]
          Length = 494

 Score =  171 bits (433), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 60/209 (28%), Positives = 111/209 (53%), Gaps = 8/209 (3%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
              G+  T+VI+ F ++I + LG+LLAL R S   +L +  + +IE  RG P +  +   
Sbjct: 291 FIKGVGYTIVITIFSVLIGIILGMLLALMRLSKNKLLHWIAVCYIEFIRGTPQMVQILFV 350

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
              +   +    ++  ++  ++ +   + AY+AE +R G+ S++KGQ EAA SLGLS  +
Sbjct: 351 YFGVGALIS---NLSAVVAGIIAIGLNSGAYVAEDIRSGIASVAKGQTEAARSLGLSQAK 407

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPT 352
             R +I+PQ +K + P + N FI L KDSSL+S+I + +L+    +  + +         
Sbjct: 408 AYRYVIIPQALKNIWPALGNEFITLLKDSSLVSVIGVTELMYQTELIQTST-----YRGV 462

Query: 353 TGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
             L     +++I  F+++    + E+ + 
Sbjct: 463 LPLFIAMIIYFIMTFTLTRLLNYFERRMK 491


>gi|86750027|ref|YP_486523.1| polar amino acid ABC transporter, inner membrane subunit
           [Rhodopseudomonas palustris HaA2]
 gi|86573055|gb|ABD07612.1| polar amino acid ABC transporter, inner membrane subunit
           [Rhodopseudomonas palustris HaA2]
          Length = 501

 Score =  171 bits (433), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 125/265 (47%), Positives = 179/265 (67%)

Query: 121 LVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVT 180
              +  +++     + +  R  L ++  F    +   ++     GL IV T  WGGLLVT
Sbjct: 236 TALIVTALVAVLTGLRNGGRPLLMTLATFIGIAVVIAWLRLDRGGLPIVGTRQWGGLLVT 295

Query: 181 LVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFL 240
           LV+S  GI+ SMP+GI LALGR S IP++R   + FIE +RGVPL+TVLF A+ MLPLFL
Sbjct: 296 LVVSVTGIVASMPIGIALALGRRSTIPLIRLFSVGFIEFWRGVPLITVLFFATYMLPLFL 355

Query: 241 PDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMP 300
           P  + +D L+R L+GV+ FA AY AEV+RGGL +I +GQ EAA++LGLSY +   LI++P
Sbjct: 356 PGNFTIDGLMRVLIGVALFAGAYNAEVVRGGLNAIPRGQAEAASALGLSYAKTTGLIVLP 415

Query: 301 QVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGF 360
           Q ++ VIPG+VN+FI LFKD+SL+SI+ +FDLLG +R  F++ TW +  T  TG  F G 
Sbjct: 416 QALRHVIPGLVNSFIALFKDTSLVSIVALFDLLGQLRAAFADPTWSTPTTLFTGFAFTGL 475

Query: 361 VFWIFCFSISLYSVFIEKTLHKGSK 385
           ++++FCF +S YS+F+E  L+   +
Sbjct: 476 IYFVFCFGMSRYSLFVEHRLNAHRR 500



 Score =  103 bits (257), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 67/252 (26%), Positives = 107/252 (42%), Gaps = 16/252 (6%)

Query: 7   EFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFL 66
              +VR  L+     PV   G I  +    F +P +ILLT +   L+ F++   + ++ +
Sbjct: 8   TPAFVRAELVPERAAPVKTTGFIGVMRGRLFNSPTNILLTIVGALLMYFTVVPTVKFLLV 67

Query: 67  DAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTG 126
           DAVW GSNRT C   +           ACW F+  +  QF++G YP  +RWR  L F   
Sbjct: 68  DAVWTGSNRTDCLAETLHRDV-----GACWPFVQAKASQFVYGFYPQPERWRVDLTFALA 122

Query: 127 SILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFF 186
           ++LL P+LIP  P K LN+ L F  FP+ +FF+L+GG            G +V+      
Sbjct: 123 ALLLLPLLIPRAPAKTLNAGLFFVAFPVLAFFLLHGGG---------LQGFMVSWTADLL 173

Query: 187 GIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDV 246
             ++         L R   + V        + +   +  +    +              +
Sbjct: 174 SGLVGSLGEAGSELARGGALAV--GIGKPVLWIATALSWLIAPLVWLRDWIAASGQPVWI 231

Query: 247 DKLLRALLGVSA 258
           D  L AL+  + 
Sbjct: 232 DLGLTALIVTAL 243


>gi|146340848|ref|YP_001205896.1| putative amino acid ABC transport, permease [Bradyrhizobium sp.
           ORS278]
 gi|146193654|emb|CAL77671.1| putative amino acid ABC transport, permease protein [Bradyrhizobium
           sp. ORS278]
          Length = 506

 Score =  171 bits (433), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 123/267 (46%), Positives = 178/267 (66%)

Query: 119 PILVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLL 178
            I      +++          R  + +I  F    +    +     GL +V+T LWGG+L
Sbjct: 239 VITAVAVSALVFVIGGGSRALRSVIGTIATFVGIAVVIAVMGLDRGGLPVVDTRLWGGML 298

Query: 179 VTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPL 238
           VTLV++  GI+ SMP+GI LALGR S IP++R   I FIEL RGVPL+TVLF A+ MLPL
Sbjct: 299 VTLVVTVIGIVASMPIGIALALGRRSTIPLIRIFSIAFIELVRGVPLITVLFFATYMLPL 358

Query: 239 FLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLII 298
           FLP    +D L+RAL+GV+ F+ AY+AEV+RGGLQ+I +GQ EAA++LGLS+ +    I+
Sbjct: 359 FLPGNLRIDGLVRALIGVALFSGAYMAEVIRGGLQAIPRGQAEAASALGLSWWKTTSFIV 418

Query: 299 MPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFI 358
           +PQ ++ VIPGIVN+FI LFKD+SL+SI+ +FDLLG ++ +F++  W +  T  TG  F 
Sbjct: 419 LPQALRHVIPGIVNSFISLFKDTSLVSIVALFDLLGSLKASFADPVWATPTTAFTGFAFT 478

Query: 359 GFVFWIFCFSISLYSVFIEKTLHKGSK 385
           G +++ FCF +S YS+ +E+ L+   +
Sbjct: 479 GLIYFAFCFGMSRYSLLVERRLNAHRR 505



 Score =  105 bits (261), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 49/152 (32%), Positives = 83/152 (54%), Gaps = 5/152 (3%)

Query: 10  YVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAV 69
           ++R+ +      P+   G+I ++      +P +ILLT +   L+ F++   + ++ +DAV
Sbjct: 9   FIRQDMAGERPAPIKTTGVIGFVRTQLLNSPTNILLTLVSALLIWFTVIPALQFLLVDAV 68

Query: 70  WIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSIL 129
           W+G +R  C   + G         ACW +I  ++ QF++G YP AQRWR  L ++    L
Sbjct: 69  WVGKDREACLAQNAGHPV-----GACWPYITAKFSQFMYGFYPEAQRWRVNLTYVLFVAL 123

Query: 130 LTPMLIPSFPRKFLNSILLFGLFPIFSFFVLY 161
           L P++I S P K LN+ L     P+ +FF+LY
Sbjct: 124 LAPLMIRSVPAKTLNAGLFLVALPVVAFFLLY 155


>gi|120405655|ref|YP_955484.1| polar amino acid ABC transporter inner membrane subunit
           [Mycobacterium vanbaalenii PYR-1]
 gi|119958473|gb|ABM15478.1| amino acid ABC transporter membrane protein, PAAT family / amino
           acid ABC transporter substrate-binding protein, PAAT
           family [Mycobacterium vanbaalenii PYR-1]
          Length = 492

 Score =  171 bits (433), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 70/221 (31%), Positives = 118/221 (53%), Gaps = 7/221 (3%)

Query: 160 LYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIEL 219
                 L      L  GL +TL+++   I I++ LG++  L R S    LR    T++++
Sbjct: 277 NSFFGLLKSTFPILMEGLRLTLILTVVSIAIALVLGVMFGLFRVSRSIWLRAIGTTYVDI 336

Query: 220 FRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQ 279
           FRG PL+   F     +P      + +  L   ++ +S  A AY+ E++RGG+QS+ KGQ
Sbjct: 337 FRGTPLLVQAFFIYFGVP--SALDFRMTALTAGIITLSLNAGAYMTEIVRGGIQSVDKGQ 394

Query: 280 FEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVN 339
            EAA SLG+ YL  MR +I+PQ I+ +IP  VN F+   KD+S++S+I + +L    R+ 
Sbjct: 395 MEAARSLGIGYLPTMRKVILPQAIRTMIPSYVNQFVITLKDTSILSVIGIAELTQTGRLI 454

Query: 340 FSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTL 380
            +      +    T  + IG +++I   +++  S  +E+ L
Sbjct: 455 IA-----RNYQSFTMWLIIGVIYFIVIMALTKLSDRLERRL 490


>gi|56751274|ref|YP_171975.1| amino acid ABC transporter permease [Synechococcus elongatus PCC
           6301]
 gi|56686233|dbj|BAD79455.1| permease protein of amino acid ABC transporter [Synechococcus
           elongatus PCC 6301]
          Length = 396

 Score =  171 bits (433), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 121/384 (31%), Positives = 204/384 (53%), Gaps = 30/384 (7%)

Query: 25  QRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWI------------- 71
           Q+  IAW+ +N F +  +  +T L++ +++  +  +  W+  +A W              
Sbjct: 11  QQTPIAWLRQNLFSSWLNSAITLLLVVIIVTVVGRLGLWITTEARWTVLVDNWTLFFVGR 70

Query: 72  --GSNRTVCTTVSQGGIQPDGWNAACWAFIYDRY-EQFIFGNYPM-------AQRWRPIL 121
              + +              G    C A    R+  + ++G   +          W P  
Sbjct: 71  YPAAEQWRLWLWLGLLSPTLGLTWGCLATGSHRWQRRSLWGWAGLAAAIAGIPLPWFPHK 130

Query: 122 VFLTGSILLTPMLIPSFPRKFLNSI-----LLFGLFPIFSFFVLYGGLGLSIVETSLWGG 176
           + L       P       R    +       L+G+  +   ++L GGLGL  V ++ W G
Sbjct: 131 LGLAAIAATVPAASWLAQRCRGQAWLRFLPTLWGVLFLVGLWLLQGGLGLRPVSSNDWSG 190

Query: 177 LLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIML 236
           LL+TL  +   ++ S+PLGILLALGR S++P +R+  +T+IELFRG+PLVT+LF   +M+
Sbjct: 191 LLLTLATALISMVCSLPLGILLALGRQSSLPAIRWLSVTYIELFRGLPLVTILFFGQVMV 250

Query: 237 PLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRL 296
           PL L   W +D++LRA++G++ F SAY+AE +RGGLQ+I +GQFEAA +LGL   Q  R 
Sbjct: 251 PLMLDSEWRIDRILRAIVGLTIFLSAYLAETVRGGLQAIPQGQFEAAAALGLDLFQTYRF 310

Query: 297 IIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLI 356
           I++PQ ++  IP IV  F+ L +D++L+SI+ + +LLGI R   +   ++         +
Sbjct: 311 IVLPQALRISIPAIVGLFLNLLQDTTLLSIVGLLELLGISRSILANPAYLGRYA--EVYL 368

Query: 357 FIGFVFWIFCFSISLYSVFIEKTL 380
           F+G ++W+ C+ ++  S  +E+ L
Sbjct: 369 FLGVLYWLCCYGLAQLSRRLEQRL 392


>gi|320547054|ref|ZP_08041352.1| glutamine ABC superfamily ATP binding cassette transporter,
           membrane protein [Streptococcus equinus ATCC 9812]
 gi|320448291|gb|EFW89036.1| glutamine ABC superfamily ATP binding cassette transporter,
           membrane protein [Streptococcus equinus ATCC 9812]
          Length = 733

 Score =  171 bits (432), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 56/215 (26%), Positives = 111/215 (51%), Gaps = 9/215 (4%)

Query: 171 TSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPL-VTVL 229
           + L  GL  TL ++     I+M +GI+  +   +   VLR     F+++ RG+PL +   
Sbjct: 524 SQLLTGLGTTLSLTLISFAIAMIIGIIFGMMAVAPNKVLRTISAIFVDVVRGIPLMIVAA 583

Query: 230 FMASIMLPLFLP---DTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSL 286
           F+   +  L          ++  L A + +S  A AYIAE++RGG++++ KGQ EA+ SL
Sbjct: 584 FIFWGIPNLIESMTGHQSPINDFLAATIALSLNAGAYIAEIVRGGIEAVPKGQMEASRSL 643

Query: 287 GLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWI 346
           G+SY + M+ +I+PQ ++ ++P  +N F+   KD++++S I + +L    ++  +     
Sbjct: 644 GISYGKTMQKVILPQAVRVMLPNFINQFVISLKDTTIVSAIGLVELFQTGKIIIA----- 698

Query: 347 SSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
            +         +  ++ +    ++  +  +EK L 
Sbjct: 699 RNYQSFRMYAILAVIYLVMITLLTRLAKRLEKRLK 733


>gi|171779932|ref|ZP_02920836.1| hypothetical protein STRINF_01719 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
 gi|171281280|gb|EDT46715.1| hypothetical protein STRINF_01719 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
          Length = 743

 Score =  171 bits (432), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 56/215 (26%), Positives = 111/215 (51%), Gaps = 9/215 (4%)

Query: 171 TSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPL-VTVL 229
           + L  GL  TL ++     I+M +GI+  +   +   VLR     F+++ RG+PL +   
Sbjct: 534 SQLLSGLGTTLSLTLISFAIAMVIGIIFGMMAVAPNKVLRTISAVFVDVVRGIPLMIVAA 593

Query: 230 FMASIMLPLFLP---DTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSL 286
           F+   +  L          ++  L A + +S  A AYIAE++RGG++++ KGQ EA+ SL
Sbjct: 594 FIFWGIPNLIESMTGHQSPINDFLAATIALSLNAGAYIAEIVRGGIEAVPKGQMEASRSL 653

Query: 287 GLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWI 346
           G+SY + M+ +I+PQ ++ ++P  +N F+   KD++++S I + +L    ++  +     
Sbjct: 654 GISYGKTMKKVILPQAVRVMLPNFINQFVISLKDTTIVSAIGLVELFQTGKIIIA----- 708

Query: 347 SSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
            +         +  ++ +    ++  +  +EK L 
Sbjct: 709 RNYQSFRMYAILAIIYLVIITLLTRLAKRLEKRLK 743


>gi|227877868|ref|ZP_03995884.1| amino acid ABC superfamily ATP binding cassette transporter,
           membrane protein [Lactobacillus crispatus JV-V01]
 gi|256844269|ref|ZP_05549755.1| glutamine ABC transporter permease [Lactobacillus crispatus
           125-2-CHN]
 gi|262047651|ref|ZP_06020605.1| glutamine ABC transporter permease [Lactobacillus crispatus
           MV-3A-US]
 gi|293380559|ref|ZP_06626618.1| ABC transporter, permease protein [Lactobacillus crispatus 214-1]
 gi|295691987|ref|YP_003600597.1| amino acid ABC transporter, amino acid-binding/permease protein
           [Lactobacillus crispatus ST1]
 gi|312976974|ref|ZP_07788723.1| amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine
           family [Lactobacillus crispatus CTV-05]
 gi|227862530|gb|EEJ70033.1| amino acid ABC superfamily ATP binding cassette transporter,
           membrane protein [Lactobacillus crispatus JV-V01]
 gi|256613347|gb|EEU18550.1| glutamine ABC transporter permease [Lactobacillus crispatus
           125-2-CHN]
 gi|260572051|gb|EEX28617.1| glutamine ABC transporter permease [Lactobacillus crispatus
           MV-3A-US]
 gi|290922873|gb|EFD99816.1| ABC transporter, permease protein [Lactobacillus crispatus 214-1]
 gi|295030093|emb|CBL49572.1| Amino acid ABC transporter, amino acid-binding/permease protein
           [Lactobacillus crispatus ST1]
 gi|310896302|gb|EFQ45367.1| amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine
           family [Lactobacillus crispatus CTV-05]
          Length = 494

 Score =  171 bits (432), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 60/209 (28%), Positives = 111/209 (53%), Gaps = 8/209 (3%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
              G+  T+VI+ F ++I + LG+LLAL R S   +L +  + +IE  RG P +  +   
Sbjct: 291 FIKGVGYTIVITIFSVLIGIILGMLLALMRLSKNKLLHWIAVCYIEFIRGTPQMVQILFV 350

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
              +   +    ++  ++  ++ +   + AY+AE +R G+ S++KGQ EAA SLGLS  +
Sbjct: 351 YFGVGALIS---NLSAVVAGIIAIGLNSGAYVAEDIRSGIASVAKGQTEAARSLGLSQAK 407

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPT 352
             R +I+PQ +K + P + N FI L KDSSL+S+I + +L+    +  + +         
Sbjct: 408 AYRYVIIPQALKNIWPALGNEFITLLKDSSLVSVIGVTELMYQTELIQTST-----YRGV 462

Query: 353 TGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
             L     +++I  F+++    + E+ + 
Sbjct: 463 LPLFIAMIIYFIMTFTLTRLLNYFERRMK 491


>gi|118473444|ref|YP_889564.1| glutamine ABC transporter permease/substrate-binding protein
           [Mycobacterium smegmatis str. MC2 155]
 gi|118174731|gb|ABK75627.1| glutamine ABC transporter, permease/substrate-binding protein
           [Mycobacterium smegmatis str. MC2 155]
          Length = 468

 Score =  171 bits (432), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 70/215 (32%), Positives = 119/215 (55%), Gaps = 7/215 (3%)

Query: 166 LSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPL 225
           L      L  GL +TL+++   I I++ LG++  L R S   VLR    T++++FRG PL
Sbjct: 259 LKSTFPILMIGLRMTLILTVVSIAIALVLGVIFGLLRVSRSVVLRAIGTTYVDIFRGTPL 318

Query: 226 VTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANS 285
           +   F     +P      + +  L   ++ +S  A AY+ E++RGG+QS+ KGQ EAA S
Sbjct: 319 LVQAFFIYFGIP--SALGFQMSALTAGIITLSLNAGAYMTEIVRGGIQSVDKGQMEAARS 376

Query: 286 LGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTW 345
           LG+ YL  MR +I+PQ I+ +IP  +N F+   KD+S++S+I + +L    R+  +    
Sbjct: 377 LGIGYLPTMRKVILPQAIRTMIPSYINQFVITLKDTSILSVIGIAELTQTGRIIIA---- 432

Query: 346 ISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTL 380
             +    T  + IG ++++   +++  S  +EK L
Sbjct: 433 -RNFQSFTMWLIIGIIYFVVIMALTKLSDRVEKRL 466


>gi|289434115|ref|YP_003463987.1| glutamine ABC transporter, permease/substrate-binding protein
           [Listeria seeligeri serovar 1/2b str. SLCC3954]
 gi|289170359|emb|CBH26899.1| glutamine ABC transporter, permease/substrate-binding protein
           [Listeria seeligeri serovar 1/2b str. SLCC3954]
 gi|313634164|gb|EFS00821.1| glutamine ABC transporter, permease/substrate-binding protein
           [Listeria seeligeri FSL N1-067]
 gi|313638787|gb|EFS03871.1| glutamine ABC transporter, permease/substrate-binding protein
           [Listeria seeligeri FSL S4-171]
          Length = 480

 Score =  171 bits (432), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 60/209 (28%), Positives = 111/209 (53%), Gaps = 7/209 (3%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
           L  G+ +T+ ++   +II+  +GI     + SN  +LR     ++++FRG PL+   F  
Sbjct: 277 LLDGMWLTIKLAVVSLIIAFIIGITFGFMKVSNSKILRGIATVYVDIFRGTPLIVQAFFF 336

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
              +P      + +   L  ++ +S  A AY+ E++RGG+QS+ KGQ EAA SLGL + +
Sbjct: 337 YFGIP--AALDFRMPVFLAGVIALSLNAGAYMVEIVRGGIQSVDKGQMEAARSLGLPHKK 394

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPT 352
            M  +++PQ I+ +IP  +N F+   KD+S++S I + +L    ++  + +        T
Sbjct: 395 AMLKVVLPQAIRMMIPSFINQFVITLKDTSIMSAIGLVELTQSGKIIMART-----FEST 449

Query: 353 TGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
              + IG ++ I    ++  S  +E+ L 
Sbjct: 450 WTWLIIGIMYLIVITILTKVSDRLERRLR 478


>gi|242243079|ref|ZP_04797524.1| amino acid ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus epidermidis W23144]
 gi|242233427|gb|EES35739.1| amino acid ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus epidermidis W23144]
          Length = 485

 Score =  171 bits (432), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 63/214 (29%), Positives = 115/214 (53%), Gaps = 7/214 (3%)

Query: 171 TSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLF 230
           +    G+  T++IS  G+++   LG  +AL + S I  L++    +IE  RG P++  +F
Sbjct: 279 SFFIKGIKNTILISLVGVVLGSILGSFIALLKLSKIRPLQWIAGIYIEFLRGTPMLVQVF 338

Query: 231 MASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSY 290
           +             D+  L+   + +   +SAYIAE+ R G+ ++ KGQ EAA SLG++Y
Sbjct: 339 IVF--FGTTAALGLDISALICGTIALVINSSAYIAEIFRAGINAVDKGQTEAARSLGMNY 396

Query: 291 LQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVT 350
            Q M+ ++MPQ IK+++P + N F+ L K+SS++S I + +++   +V    S       
Sbjct: 397 RQTMQSVVMPQAIKKILPALGNEFVTLIKESSIVSTIGVSEIMFNAQVVQGIS-----FD 451

Query: 351 PTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
           P T L+    ++++  F+++    FIE  +    
Sbjct: 452 PFTPLLVAALLYFLLTFALTRVMNFIEGRMSASD 485


>gi|298291389|ref|YP_003693328.1| polar amino acid ABC transporter inner membrane subunit [Starkeya
           novella DSM 506]
 gi|296927900|gb|ADH88709.1| polar amino acid ABC transporter, inner membrane subunit [Starkeya
           novella DSM 506]
          Length = 458

 Score =  171 bits (432), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 129/264 (48%), Positives = 179/264 (67%)

Query: 122 VFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTL 181
           + +  +I     LI    R    + +   L             GL  VET  WGGLLVTL
Sbjct: 194 LVVMAAIGGVIRLIGGDGRAAARATMWVFLAFGLLVLAWDIDFGLPYVETRQWGGLLVTL 253

Query: 182 VISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLP 241
           VI+  GI+ S+PLGI LALGR S +P++R   + FIE +RGVPL+TVLF A+ MLPLFLP
Sbjct: 254 VIAVTGIVASLPLGIALALGRRSQMPIVRLLSVVFIEFWRGVPLITVLFFATYMLPLFLP 313

Query: 242 DTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQ 301
              + D LLRAL+GV+ F++AY+AEV+RGGLQ+I KGQ+E A ++GL++ Q MRLII+PQ
Sbjct: 314 QGSNPDGLLRALVGVALFSAAYMAEVIRGGLQAIPKGQYEGAMAVGLTWSQMMRLIILPQ 373

Query: 302 VIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFV 361
            +  VIPGIVN+FI LFKD++L+ I+++FD LG +R +F++  W S VT  TG  F G V
Sbjct: 374 ALTLVIPGIVNSFISLFKDTTLVLIVSIFDFLGQLRASFTDPNWASPVTLYTGFAFAGVV 433

Query: 362 FWIFCFSISLYSVFIEKTLHKGSK 385
           +++FCF +S YS+F+E+ L+   +
Sbjct: 434 YFLFCFGMSRYSLFVERRLNTSHR 457



 Score =  105 bits (263), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 56/159 (35%), Positives = 91/159 (57%), Gaps = 9/159 (5%)

Query: 1   MIDSCKEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGI 60
           M  +  +  ++R  ++ P  PP  Q G I W+ +N F +  + +LT + + L+L  +P +
Sbjct: 1   MSLTFDDGTFIRTEMVAPLPPPRRQVGAIGWMRENLFSSILNTVLTLVGLGLVLLIVPPL 60

Query: 61  IHWVFLDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPI 120
           + ++F+DAVW G +R  C               ACW FI  +  Q I+G YP+ QRWRP 
Sbjct: 61  VRFMFIDAVWTGQSREACLAPG---------TGACWPFINAKLGQLIYGFYPIDQRWRPN 111

Query: 121 LVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFV 159
           +VF  G++LL P+L+ S+P K LN+ L F ++PI +F +
Sbjct: 112 IVFAAGAVLLVPLLVLSWPFKKLNAFLFFVIYPIVAFIL 150


>gi|319401122|gb|EFV89341.1| amino ABC transporter, permease , 3-TM region,
           His/Glu/Gln/Arg/opine family domain protein
           [Staphylococcus epidermidis FRI909]
          Length = 485

 Score =  171 bits (432), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 63/214 (29%), Positives = 115/214 (53%), Gaps = 7/214 (3%)

Query: 171 TSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLF 230
           +    G+  T++IS  G+++   LG  +AL + S I  L++    +IE  RG P++  +F
Sbjct: 279 SFFIKGIKNTILISLVGVVLGSILGSFIALLKLSKIRPLQWIAGIYIEFLRGTPMLVQVF 338

Query: 231 MASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSY 290
           +             D+  L+   + +   +SAYIAE+ R G+ ++ KGQ EAA SLG++Y
Sbjct: 339 IVF--FGTTAALGLDISALICGTIALVINSSAYIAEIFRAGINAVDKGQTEAARSLGMNY 396

Query: 291 LQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVT 350
            Q M+ ++MPQ IK+++P + N F+ L K+SS++S I + +++   +V    S       
Sbjct: 397 RQTMQSVVMPQAIKKILPALGNEFVTLIKESSIVSTIGVSEIMFNAQVVQGIS-----FD 451

Query: 351 PTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
           P T L+    ++++  F+++    FIE  +    
Sbjct: 452 PFTPLLVAALLYFLLTFALTRVMNFIEGRMSASD 485


>gi|18311075|ref|NP_563009.1| amino acid ABC transporter [Clostridium perfringens str. 13]
 gi|18145757|dbj|BAB81799.1| probable amino acid ABC transporter [Clostridium perfringens str.
           13]
          Length = 502

 Score =  171 bits (432), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 66/210 (31%), Positives = 109/210 (51%), Gaps = 5/210 (2%)

Query: 172 SLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFM 231
            L   + VT+ +S FG+I+ + +GI LA+ R   IPVL+     +I  FRG PL+  LF+
Sbjct: 296 MLLKAINVTISLSVFGMILGLIVGIALAMIRVYKIPVLKQIAEVYISFFRGTPLLVQLFL 355

Query: 232 ASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYL 291
               +P  +P   ++     AL+G+   ASAYIAE+LR  + +I KGQ EA  SLG++  
Sbjct: 356 LYFGVPQVIPSLQNMSAFTAALIGLGLNASAYIAEILRSSIDAIDKGQMEACLSLGMTMA 415

Query: 292 QKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTP 351
           Q ++ +++PQ  +  IP + N F+   K SSL   + + +LL   ++  + S        
Sbjct: 416 QALKRVVLPQAFRIAIPPLGNIFVDTVKGSSLAFTLGVVELLAKAQMEAAAS-----YKF 470

Query: 352 TTGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
               + +  ++WI     +     +EK L 
Sbjct: 471 FESYVVVAIMYWIIIGFFNYLQKILEKKLS 500


>gi|81299059|ref|YP_399267.1| amino acid ABC transporter permease [Synechococcus elongatus PCC
           7942]
 gi|81167940|gb|ABB56280.1| Amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine [Synechococcus elongatus PCC 7942]
          Length = 396

 Score =  170 bits (431), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 121/384 (31%), Positives = 205/384 (53%), Gaps = 30/384 (7%)

Query: 25  QRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWI------------- 71
           Q+  IAW+ +N F +  +  +T L++ +++  +  +  W+  +A W              
Sbjct: 11  QQTPIAWLRQNLFSSWLNSAITLLLVVIIVTVVGRLGLWITTEARWTVLVDNWTLFFVGR 70

Query: 72  --GSNRTVCTTVSQGGIQPDGWNAACWAFIYDRY-EQFIFGNYPM-------AQRWRPIL 121
              + +              G    C A    R+  + ++G   +          W P  
Sbjct: 71  YPAAEQWRLWLWLGLLSPTLGLTWGCLATGSHRWQRRSLWGWAGLAAAIAGIPLPWFPHK 130

Query: 122 VFLTGSILLTPMLIPSFPRKFLNSI-----LLFGLFPIFSFFVLYGGLGLSIVETSLWGG 176
           + L       P       R    +       L+G+  +   ++L GGLGL  V ++ W G
Sbjct: 131 LGLAAIAATVPAASWLAQRCRGQAWLRFLPTLWGVLFLVGLWLLQGGLGLRPVSSNDWSG 190

Query: 177 LLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIML 236
           LL+TL  +   ++ S+PLGILLALGR S++P +R+  +T+IELFRG+PLVT+LF   +M+
Sbjct: 191 LLLTLATALISMVCSLPLGILLALGRQSSLPAIRWLSVTYIELFRGLPLVTILFFGQVMV 250

Query: 237 PLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRL 296
           PL L   W +D++LRA++G++ F SAY+AE +RGGLQ+I +GQFEAA +LGL+  Q  R 
Sbjct: 251 PLMLDSEWRIDRILRAIVGLTIFLSAYLAETVRGGLQAIPQGQFEAAAALGLNLFQTYRF 310

Query: 297 IIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLI 356
           I++PQ ++  IP IV  F+ L +D++L+SI+ + +LLGI R   +   ++         +
Sbjct: 311 IVLPQALRISIPAIVGLFLNLLQDTTLLSIVGLLELLGISRSILANPAYLGRYA--EVYL 368

Query: 357 FIGFVFWIFCFSISLYSVFIEKTL 380
           F+G ++W+ C+ ++  S  +E+ L
Sbjct: 369 FLGVLYWLCCYGLAQLSRRLEQRL 392


>gi|323465692|gb|ADX69379.1| Glutamine ABC superfamily ATP binding cassette transporter,
           permease protein [Lactobacillus helveticus H10]
          Length = 494

 Score =  170 bits (431), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 60/209 (28%), Positives = 111/209 (53%), Gaps = 8/209 (3%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
              G+  T++I+ F ++I + LG+LLAL R S   +L +  + +IE  RG P +  +   
Sbjct: 291 FVKGIEYTIIITVFSVLIGIVLGMLLALMRLSKNKLLHWIAVCYIEFIRGTPQMVQILFV 350

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
              +   +    ++  L+  ++ +   + AY+AE +R G+ S++KGQ EAA SLGLS  +
Sbjct: 351 YFGVGALIS---NLSALVAGIIAIGLNSGAYVAEDIRSGIASVAKGQTEAARSLGLSQAK 407

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPT 352
             R +I+PQ +K + P + N FI L KDSSL+S+I + +L+    +  + +         
Sbjct: 408 AYRYVIIPQALKNIWPALGNEFITLLKDSSLVSVIGVTELMYQTELIQTST-----YRGV 462

Query: 353 TGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
             L     +++I  F+++    + E+ + 
Sbjct: 463 LPLFIAMIIYFIMTFTLTRLLNYFERRMK 491


>gi|110798792|ref|YP_696773.1| His/Glu/Gln/Arg/opine amino acid ABC transporter amino acid-binding
           protein/permease [Clostridium perfringens ATCC 13124]
 gi|168208796|ref|ZP_02634421.1| amino acid ABC transporter, amino acid-binding protein/permease
           protein, His/Glu/Gln/Arg/opine family [Clostridium
           perfringens B str. ATCC 3626]
 gi|168212869|ref|ZP_02638494.1| amino acid ABC transporter, amino acid-binding protein/permease
           protein, His/Glu/Gln/Arg/opine family [Clostridium
           perfringens CPE str. F4969]
 gi|168215721|ref|ZP_02641346.1| amino acid ABC transporter, amino acid-binding protein/permease
           protein, His/Glu/Gln/Arg/opine family [Clostridium
           perfringens NCTC 8239]
 gi|110673439|gb|ABG82426.1| amino acid ABC transporter, amino acid-binding protein/permease
           protein, His/Glu/Gln/Arg/opine family [Clostridium
           perfringens ATCC 13124]
 gi|170713169|gb|EDT25351.1| amino acid ABC transporter, amino acid-binding protein/permease
           protein, His/Glu/Gln/Arg/opine family [Clostridium
           perfringens B str. ATCC 3626]
 gi|170715496|gb|EDT27678.1| amino acid ABC transporter, amino acid-binding protein/permease
           protein, His/Glu/Gln/Arg/opine family [Clostridium
           perfringens CPE str. F4969]
 gi|182382310|gb|EDT79789.1| amino acid ABC transporter, amino acid-binding protein/permease
           protein, His/Glu/Gln/Arg/opine family [Clostridium
           perfringens NCTC 8239]
          Length = 502

 Score =  170 bits (431), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 66/210 (31%), Positives = 109/210 (51%), Gaps = 5/210 (2%)

Query: 172 SLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFM 231
            L   + VT+ +S FG+I+ + +GI LA+ R   IPVL+     +I  FRG PL+  LF+
Sbjct: 296 MLLKAINVTISLSVFGMILGLIVGIALAMIRVYKIPVLKQIAEVYISFFRGTPLLVQLFL 355

Query: 232 ASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYL 291
               +P  +P   ++     AL+G+   ASAYIAE+LR  + +I KGQ EA  SLG++  
Sbjct: 356 LYFGVPQVIPSLQNMSAFTAALIGLGLNASAYIAEILRSSIDAIDKGQMEACLSLGMTRA 415

Query: 292 QKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTP 351
           Q ++ +++PQ  +  IP + N F+   K SSL   + + +LL   ++  + S        
Sbjct: 416 QALKRVVLPQAFRIAIPPLGNIFVDTVKGSSLAFTLGVVELLAKAQMEAAAS-----YKF 470

Query: 352 TTGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
               + +  ++WI     +     +EK L 
Sbjct: 471 FESYVVVAIMYWIIIGFFNYLQKILEKKLS 500


>gi|314936089|ref|ZP_07843436.1| amino acid ABC transporter, permease/substrate-binding protein
           [Staphylococcus hominis subsp. hominis C80]
 gi|313654708|gb|EFS18453.1| amino acid ABC transporter, permease/substrate-binding protein
           [Staphylococcus hominis subsp. hominis C80]
          Length = 484

 Score =  170 bits (431), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 68/212 (32%), Positives = 111/212 (52%), Gaps = 7/212 (3%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
              GL  T++IS  G+++   LG L+AL + S   +L +    +IE  RG P++  +F+ 
Sbjct: 280 FIKGLKNTILISMIGVVLGAVLGALIALAKLSKFKLLSWIASIYIEFLRGTPMLVQVFLV 339

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
                       DV  L+   + +   +SAYIAE+ R G+ ++ KGQ EAA  LGL+Y +
Sbjct: 340 F--FGTTAVLGLDVSALVCGTIALVINSSAYIAEIFRAGINAVDKGQTEAAQCLGLNYSK 397

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPT 352
            MR II+PQ IK ++P + N F+ L K+SS++S I + +++   +V    S       P 
Sbjct: 398 TMRYIILPQAIKNILPALGNEFVTLIKESSIVSTIGVGEIMFNAQVVQGIS-----FDPF 452

Query: 353 TGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
           T LI    +++I  F++S     IE  +    
Sbjct: 453 TPLIIAAIMYFILTFTLSRGMSLIEGRMKASD 484


>gi|145221824|ref|YP_001132502.1| polar amino acid ABC transporter, inner membrane subunit
           [Mycobacterium gilvum PYR-GCK]
 gi|145214310|gb|ABP43714.1| amino acid ABC transporter substrate-binding protein, PAAT family /
           amino acid ABC transporter membrane protein, PAAT family
           [Mycobacterium gilvum PYR-GCK]
          Length = 503

 Score =  170 bits (431), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 60/208 (28%), Positives = 102/208 (49%), Gaps = 8/208 (3%)

Query: 179 VTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPL 238
           +T+ ++    +I + + + +AL R S+  VL      +I + RG PL+  LF+    LP 
Sbjct: 304 MTIPLTIISFVIGLVIALGVALARLSSNVVLSNLARFYISVIRGTPLLVQLFIVFFALPE 363

Query: 239 FLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLII 298
           F      +D    A++  S     Y AE++R  +QSI KGQ+EAA ++GL+Y+  +R II
Sbjct: 364 F---GVKIDPFPAAVIAFSLNVGGYAAEIIRSAIQSIPKGQWEAAETIGLNYVGTLRRII 420

Query: 299 MPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFI 358
           +PQ  +  +P + NT I L KD+SL S I + +LL   ++  + +               
Sbjct: 421 LPQATRVAVPPLSNTLISLVKDTSLASTILVTELLRQAQIIAAPT-----FEFFALYGTA 475

Query: 359 GFVFWIFCFSISLYSVFIEKTLHKGSKK 386
              +W+ C  +S      E  L +   +
Sbjct: 476 AVYYWVICLVLSFGQARFEHRLERYVAR 503


>gi|110801621|ref|YP_699371.1| glutamine-binding periplasmic protein of glutamine ABC transporter
           [Clostridium perfringens SM101]
 gi|110682122|gb|ABG85492.1| amino acid ABC transporter, amino acid-binding protein/permease
           protein, His/Glu/Gln/Arg/opine family [Clostridium
           perfringens SM101]
          Length = 502

 Score =  170 bits (431), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 66/210 (31%), Positives = 110/210 (52%), Gaps = 5/210 (2%)

Query: 172 SLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFM 231
            L   + VT+ +S FG+I+ + +GI LA+ R   IPVL+     +I  FRG PL+  LF+
Sbjct: 296 MLLKAINVTISLSVFGVILGLIVGIALAMIRVYKIPVLKQIAEVYISFFRGTPLLVQLFL 355

Query: 232 ASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYL 291
               +P  +P   +++    AL+G+   ASAYIAE+LR  + +I KGQ EA  SLG++  
Sbjct: 356 LYFGVPQVIPSLQNMNAFTAALIGLGLNASAYIAEILRSSIDAIDKGQMEACLSLGMTRA 415

Query: 292 QKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTP 351
           Q ++ +++PQ  +  IP + N F+   K SSL   + + +LL   ++  + S        
Sbjct: 416 QALKRVVLPQAFRIAIPPLGNIFVDTVKGSSLAFTLGVVELLAKAQMEAAAS-----YKF 470

Query: 352 TTGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
               + +  ++WI     +     +EK L 
Sbjct: 471 FESYVVVAIMYWIIIGFFNYLQKILEKKLS 500


>gi|325955845|ref|YP_004286455.1| glutamine ABC transporter substrate binding/permease protein
           [Lactobacillus acidophilus 30SC]
 gi|325332410|gb|ADZ06318.1| glutamine ABC transporter substrate binding/permease protein
           [Lactobacillus acidophilus 30SC]
 gi|327182680|gb|AEA31127.1| glutamine ABC transporter substrate binding/permease protein
           [Lactobacillus amylovorus GRL 1118]
          Length = 494

 Score =  170 bits (431), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 61/209 (29%), Positives = 111/209 (53%), Gaps = 8/209 (3%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
              G+  T+VI+ F ++I + LG+LLAL R S   +L +  + +IE  RG P +  +   
Sbjct: 291 FVKGVGYTIVITVFSVLIGIVLGMLLALMRLSRNKLLHWIAVCYIEFIRGTPQMVQILFV 350

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
              +   +    ++  ++  ++ +   + AY+AE +R G+ S++KGQ EAA SLGLS  +
Sbjct: 351 YFGVGALIS---NLSAVVAGIIAIGLNSGAYVAEDIRSGIASVAKGQTEAARSLGLSQAK 407

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPT 352
             R +I+PQ +K + P + N FI L KDSSL+S+I + +L+    +  + +         
Sbjct: 408 AYRYVIIPQALKNIWPALGNEFITLLKDSSLVSVIGVTELMYQTELIQTST-----YRGV 462

Query: 353 TGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
             L     +++I  F+++    + EK + 
Sbjct: 463 LPLFIAMIIYFIMTFTLTRLLNYFEKRMK 491


>gi|315446439|ref|YP_004079318.1| amino acid ABC transporter membrane protein, PAAT family ;amino
           acid ABC transporter substrate-binding protein, PAAT
           family [Mycobacterium sp. Spyr1]
 gi|315264742|gb|ADU01484.1| amino acid ABC transporter membrane protein, PAAT family ;amino
           acid ABC transporter substrate-binding protein, PAAT
           family [Mycobacterium sp. Spyr1]
          Length = 487

 Score =  170 bits (430), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 60/208 (28%), Positives = 102/208 (49%), Gaps = 8/208 (3%)

Query: 179 VTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPL 238
           +T+ ++    +I + + + +AL R S+  VL      +I + RG PL+  LF+    LP 
Sbjct: 288 MTIPLTIISFVIGLVIALGVALARLSSNVVLSNLARFYISVIRGTPLLVQLFIVFFALPE 347

Query: 239 FLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLII 298
           F      +D    A++  S     Y AE++R  +QSI KGQ+EAA ++GL+Y+  +R II
Sbjct: 348 F---GVKIDPFPAAVIAFSLNVGGYAAEIIRSAIQSIPKGQWEAAETIGLNYVGTLRRII 404

Query: 299 MPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFI 358
           +PQ  +  +P + NT I L KD+SL S I + +LL   ++  + +               
Sbjct: 405 LPQATRVAVPPLSNTLISLVKDTSLASTILVTELLRQAQIIAAPT-----FEFFALYGTA 459

Query: 359 GFVFWIFCFSISLYSVFIEKTLHKGSKK 386
              +W+ C  +S      E  L +   +
Sbjct: 460 AVYYWVICLVLSFGQARFEHRLERYVAR 487


>gi|315037375|ref|YP_004030943.1| glutamine ABC transporter substrate binding/permease protein
           [Lactobacillus amylovorus GRL 1112]
 gi|312275508|gb|ADQ58148.1| glutamine ABC transporter substrate binding/permease protein
           [Lactobacillus amylovorus GRL 1112]
          Length = 494

 Score =  170 bits (430), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 62/209 (29%), Positives = 111/209 (53%), Gaps = 8/209 (3%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
              G+  TLVI+ F ++I + LG+LLAL R S   +L +  + +IE  RG P +  +   
Sbjct: 291 FVKGVGYTLVITVFSVLIGIVLGMLLALMRLSRNKLLHWIAVCYIEFIRGTPQMVQILFV 350

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
              +   +    ++  ++  ++ +   + AY+AE +R G+ S++KGQ EAA SLGLS  +
Sbjct: 351 YFGVGALIS---NLSAVVAGIIAIGLNSGAYVAEDIRSGIASVAKGQTEAARSLGLSQAK 407

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPT 352
             R +I+PQ +K + P + N FI L KDSSL+S+I + +L+    +  + +         
Sbjct: 408 AYRYVIIPQALKNIWPALGNEFITLLKDSSLVSVIGVTELMYQTELIQTST-----YRGV 462

Query: 353 TGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
             L     +++I  F+++    + EK + 
Sbjct: 463 LPLFIAMIIYFIMTFTLTRLLNYFEKRMK 491


>gi|299133837|ref|ZP_07027031.1| polar amino acid ABC transporter, inner membrane subunit [Afipia
           sp. 1NLS2]
 gi|298591673|gb|EFI51874.1| polar amino acid ABC transporter, inner membrane subunit [Afipia
           sp. 1NLS2]
          Length = 454

 Score =  170 bits (430), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 127/454 (27%), Positives = 201/454 (44%), Gaps = 80/454 (17%)

Query: 6   KEFPYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVF 65
            +  +VRK L      PV   G++ ++    F +P +I LT   + L    +   I ++ 
Sbjct: 4   SDTIFVRKTLAPARKAPVITTGLVGFLRMRLFNSPLNIALTFASVALAWLILEPTIRFLL 63

Query: 66  LDAVWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLT 125
           +DAVW G++RT C     G         ACW FI  ++ Q I+G YP  QRWR  L F  
Sbjct: 64  IDAVWTGADRTACLADKAGHPV-----GACWPFIQAKFTQLIYGFYPEDQRWRANLTFAL 118

Query: 126 GSILLTPMLIPSFPRKFLNSILLFGLFP---------------IFSFFVLYGGLGLSIVE 170
            ++LL P+L+P  P K LN+ L F  FP               +F +     G+      
Sbjct: 119 AALLLAPLLVPKIPGKTLNAALFFLAFPFLAFFLLRGGGLDGFVFYWLAELFGMAWKPSL 178

Query: 171 TSLWGGLLVTLVISFFGIIISMPL-----------------------------GILLALG 201
              W    +T  I    +I+                                 G L  + 
Sbjct: 179 LRFWLDFSLTTTIVTAAVILLWGGWPNGRRAGLSSALTFAGIAIVIVALRLDQGGLPVVD 238

Query: 202 RNSNIPVLRYACITFIELFRGVPL-VTVLFMASIMLPLFLPDTWDVDKLLRAL-LGVSAF 259
                 +L    ++   +   +P+ + +    +  +PL         +  R + L    F
Sbjct: 239 TRLWGGLLVTLVVSITGIVASMPVGIALALGRTSRIPLLRIFCVAFIEFWRGVPLITVLF 298

Query: 260 ASAYI-----------------------------AEVLRGGLQSISKGQFEAANSLGLSY 290
            + Y+                             AEV+RGGL +I +GQ EAAN+LGLSY
Sbjct: 299 FATYMLPLFLPGDFTIDALVRVLVGIALFAGAYNAEVIRGGLLAIPRGQREAANALGLSY 358

Query: 291 LQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVT 350
            +   LI++PQ ++ VIP +VN+FI LFKD++L+ I+++FDLLG +R  F++ TW +  T
Sbjct: 359 WKTTGLIVLPQALRHVIPALVNSFIALFKDTTLVLIVSLFDLLGQLRAAFADPTWATPTT 418

Query: 351 PTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
             TG  F G ++W+ CF++S YS+F+E+ L+   
Sbjct: 419 LFTGFAFTGIIYWVGCFAMSRYSLFVERRLNAHR 452


>gi|226307850|ref|YP_002767810.1| glutamine ABC transporter glutamine-binding/permease protein
           [Rhodococcus erythropolis PR4]
 gi|226186967|dbj|BAH35071.1| putative glutamine ABC transporter glutamine-binding/permease
           protein [Rhodococcus erythropolis PR4]
          Length = 482

 Score =  170 bits (430), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 67/210 (31%), Positives = 118/210 (56%), Gaps = 7/210 (3%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
           L  GL +T+V+S   I I++ LG +  L R S    +R    T++++FRG PL+   F  
Sbjct: 280 LLKGLWLTIVLSVVSIAIALVLGAIFGLCRVSTNMFVRGIGTTYVDIFRGTPLLVQAFFI 339

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
              +P      + +      ++ +S  A AY+AE++RGG+ S+ KGQ EA+ SLG+SY++
Sbjct: 340 YFGIP--AALHFQMSAFTAGIITLSLNAGAYMAEIVRGGILSVDKGQMEASRSLGISYMK 397

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPT 352
            MR +IMPQ I+ +IP  +N F+   KD+S++S+I + +L    R+  +      +    
Sbjct: 398 SMRKVIMPQAIRTMIPSYINQFVITLKDTSILSVIGLAELTQTGRIIIA-----RNFQSF 452

Query: 353 TGLIFIGFVFWIFCFSISLYSVFIEKTLHK 382
              + IG +++I   +++  S  +EK ++K
Sbjct: 453 NMWLIIGVMYFIIIMALTKLSNRLEKRINK 482


>gi|57867284|ref|YP_188964.1| amino acid ABC transporter, permease/amino acid-binding protein,
           putative [Staphylococcus epidermidis RP62A]
 gi|251811199|ref|ZP_04825672.1| amino acid ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus epidermidis
           BCM-HMP0060]
 gi|282875757|ref|ZP_06284624.1| ABC transporter, permease protein [Staphylococcus epidermidis
           SK135]
 gi|57637942|gb|AAW54730.1| amino acid ABC transporter, permease/amino acid-binding protein,
           putative [Staphylococcus epidermidis RP62A]
 gi|251805280|gb|EES57937.1| amino acid ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus epidermidis
           BCM-HMP0060]
 gi|281294782|gb|EFA87309.1| ABC transporter, permease protein [Staphylococcus epidermidis
           SK135]
 gi|329734283|gb|EGG70598.1| ABC transporter, permease protein [Staphylococcus epidermidis
           VCU045]
 gi|329737224|gb|EGG73478.1| ABC transporter, permease protein [Staphylococcus epidermidis
           VCU028]
          Length = 485

 Score =  170 bits (430), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 64/214 (29%), Positives = 116/214 (54%), Gaps = 7/214 (3%)

Query: 171 TSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLF 230
           +    G+  T++IS  G+++   LG  +AL + S I  L++    +IE  RG P++  +F
Sbjct: 279 SFFIKGIKNTILISLVGVVLGSILGSFIALLKISKIRPLQWIASIYIEFLRGTPMLVQVF 338

Query: 231 MASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSY 290
           +             D+  L+   + +   +SAYIAE++R G+ ++ KGQ EAA SLGL+Y
Sbjct: 339 IVF--FGTTAALGLDISALICGTIALVINSSAYIAEIIRAGINAVDKGQTEAARSLGLNY 396

Query: 291 LQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVT 350
            Q M+ ++MPQ IK+++P + N F+ L K+SS++S I + +++   +V    S       
Sbjct: 397 RQTMQSVVMPQAIKKILPALGNEFVTLIKESSIVSTIGVSEIMFNAQVVQGIS-----FD 451

Query: 351 PTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
           P T L+    ++++  F+++    FIE  +    
Sbjct: 452 PFTPLLVAALLYFLLTFALTRVMNFIEGRMSASD 485


>gi|313680182|ref|YP_004057921.1| polar amino acid ABC transporter, inner membrane subunit
           [Oceanithermus profundus DSM 14977]
 gi|313152897|gb|ADR36748.1| polar amino acid ABC transporter, inner membrane subunit
           [Oceanithermus profundus DSM 14977]
          Length = 371

 Score =  170 bits (430), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 117/374 (31%), Positives = 178/374 (47%), Gaps = 21/374 (5%)

Query: 28  IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQ 87
            + W+ +N F    +  LT +   LL     G+  WVF +A W          +   G  
Sbjct: 3   ALTWLKENLFNGWFNSALTVVTAWLLFAVAKGVFLWVFEEARWSV--VPENMRLLMVGSY 60

Query: 88  PDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSIL 147
           P       W              Y    R R  L    G++ +  +  P         +L
Sbjct: 61  PPDQVWRIWTITAVVL-FVAGLLYAHCNRGRAPLWMWIGAVAVFAVSFPVLFPLTRVYLL 119

Query: 148 LFGLFPIFSFFVLYG----------------GLGLSIVETSLWGGLLVTLVISFFGIIIS 191
           +  L       V +                  L L   +T   GG   TL+++    + +
Sbjct: 120 ITVLSLPVGITVGHYLSARVVHAAAAFGALVILFLLWGKTDRLGGFSFTLMLTVLASVFA 179

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
            PLG+LLALGR    PV R   I +IEL RGVPL+TVLF++  M+PLFLP +W+V  L  
Sbjct: 180 FPLGLLLALGRTGKWPVFRALSILYIELIRGVPLITVLFLSYYMVPLFLPASWEVPTLFS 239

Query: 252 ALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIV 311
            ++G S FA+AY+AE +RGG+Q + KGQ+EAA +LGLS  Q  R II+PQ I+ VIP ++
Sbjct: 240 IVVGFSMFAAAYLAEYVRGGIQGVPKGQYEAAWALGLSGTQSARYIILPQAIRSVIPALI 299

Query: 312 NTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISL 371
              I +FKD+SL+ I+ +FDLL +         ++ +      L+FI  V+++    +S 
Sbjct: 300 GQLIAIFKDTSLVYILGLFDLLFMAITVARNPKFLGTER--EVLLFIALVYFVGAALMSY 357

Query: 372 YSVFIEKTLHKGSK 385
            S  +E+ +  G++
Sbjct: 358 ASRKLERAMGLGTR 371


>gi|228475903|ref|ZP_04060613.1| amino acid ABC transporter, permease/substrate-binding protein
           [Staphylococcus hominis SK119]
 gi|228270058|gb|EEK11528.1| amino acid ABC transporter, permease/substrate-binding protein
           [Staphylococcus hominis SK119]
          Length = 484

 Score =  170 bits (430), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 68/212 (32%), Positives = 111/212 (52%), Gaps = 7/212 (3%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
              GL  T++IS  G+++   LG L+AL + S   +L +    +IE  RG P++  +F+ 
Sbjct: 280 FIKGLKNTILISMIGVVLGAVLGALIALAKLSKFKLLSWIASIYIEFLRGTPMLVQVFLV 339

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
                       DV  L+   + +   +SAYIAE+ R G+ ++ KGQ EAA  LGL+Y +
Sbjct: 340 F--FGTTAVLGLDVSALVCGTIALVINSSAYIAEIFRAGINAVDKGQTEAAQCLGLNYSK 397

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPT 352
            MR II+PQ IK ++P + N F+ L K+SS++S I + +++   +V    S       P 
Sbjct: 398 TMRYIILPQAIKNILPALGNEFVTLIKESSIVSTIGVGEIMFNAQVVQGIS-----FDPF 452

Query: 353 TGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
           T LI    +++I  F++S     IE  +    
Sbjct: 453 TPLIIAAIMYFILTFTLSRGMSLIEGRMKASD 484


>gi|313609881|gb|EFR85296.1| glutamine ABC transporter, permease/substrate-binding protein
           [Listeria monocytogenes FSL F2-208]
          Length = 471

 Score =  170 bits (430), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 61/209 (29%), Positives = 111/209 (53%), Gaps = 7/209 (3%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
           L  GL +T+ ++   +II+  +GI     + SN  +LR     ++++FRG PL+   F  
Sbjct: 268 LLSGLWLTIRLAVVSLIIAFIIGITFGFMKVSNSKILRGIATVYVDIFRGTPLIVQAFFF 327

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
              +P      + +   L  ++ +S  A AY+ E++RGG+QS+ KGQ EAA SLGL + +
Sbjct: 328 YFGIP--AALDFRMPVFLAGVIALSLNAGAYMVEIVRGGIQSVDKGQMEAARSLGLPHKK 385

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPT 352
            M  +++PQ I+ +IP  +N F+   KD+S++S I + +L    ++  + +        T
Sbjct: 386 AMMKVVLPQAIRMMIPSFINQFVITLKDTSIMSAIGLVELTQSGKIIMART-----FEST 440

Query: 353 TGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
              + IG ++ I    ++  S  +E+ L 
Sbjct: 441 WTWLIIGIMYLIVITILTKISDRLERRLR 469


>gi|229494909|ref|ZP_04388660.1| glutamine ABC transporter, permease/substrate-binding protein
           [Rhodococcus erythropolis SK121]
 gi|229318133|gb|EEN84003.1| glutamine ABC transporter, permease/substrate-binding protein
           [Rhodococcus erythropolis SK121]
          Length = 482

 Score =  170 bits (430), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 67/210 (31%), Positives = 118/210 (56%), Gaps = 7/210 (3%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
           L  GL +T+V+S   I I++ LG +  L R S    +R    T++++FRG PL+   F  
Sbjct: 280 LLKGLWLTIVLSVVSIAIALVLGAIFGLCRVSTNMFVRGIGTTYVDIFRGTPLLVQAFFI 339

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
              +P      + +      ++ +S  A AY+AE++RGG+ S+ KGQ EA+ SLG+SY++
Sbjct: 340 YFGIP--AALHFQMSAFTAGIITLSLNAGAYMAEIVRGGILSVDKGQMEASRSLGISYMK 397

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPT 352
            MR +IMPQ I+ +IP  +N F+   KD+S++S+I + +L    R+  +      +    
Sbjct: 398 SMRKVIMPQAIRTMIPSYINQFVITLKDTSILSVIGLAELTQTGRIIIA-----RNFQSF 452

Query: 353 TGLIFIGFVFWIFCFSISLYSVFIEKTLHK 382
              + IG +++I   +++  S  +EK ++K
Sbjct: 453 NMWLIIGVMYFIIIMALTKLSNRLEKRINK 482


>gi|125718174|ref|YP_001035307.1| arginine/histidine ABC transporter permease [Streptococcus
           sanguinis SK36]
 gi|125498091|gb|ABN44757.1| Arginine/histidine ABC transporter, permease component, putative
           [Streptococcus sanguinis SK36]
          Length = 722

 Score =  170 bits (430), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 59/223 (26%), Positives = 108/223 (48%), Gaps = 9/223 (4%)

Query: 163 GLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRG 222
              L      L  GL VT+ ++     I+M +GI+  +   S    LR+    F+++ RG
Sbjct: 505 WGLLQNNYQELLKGLGVTIALALISFAIAMVIGIIFGMFSVSPYKPLRWIAEIFVDVIRG 564

Query: 223 VPL-VTVLFMASIMLPLFLPD---TWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKG 278
           +PL +   F+   +  L          ++  +   + +S  A AYIAE++RGG+Q++  G
Sbjct: 565 IPLMIVAAFIFWGIPNLIESMTGQQSPINAFVAGTIALSLNAGAYIAEIVRGGIQAVPVG 624

Query: 279 QFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRV 338
           Q EA+ SLG+SY + MR II+PQ  K ++P  VN F+   KD++++S I + +L    + 
Sbjct: 625 QMEASRSLGISYSKTMRKIILPQATKIMLPNFVNQFVIALKDTTIVSAIGLAELFKTGKD 684

Query: 339 NFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
             +      +         +  ++ I    ++  +  +EK + 
Sbjct: 685 IIA-----RNYQSFRMYAILAVLYLIIITLLTRLAKRLEKRIK 722


>gi|297518226|ref|ZP_06936612.1| putative transport system permease protein [Escherichia coli OP50]
          Length = 227

 Score =  169 bits (429), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 116/226 (51%), Positives = 158/226 (69%), Gaps = 2/226 (0%)

Query: 159 VLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIE 218
           +  G   L  VET  WGGL +TL+I+  GI  ++P GILLALGR S++P++R   + FIE
Sbjct: 1   MYGGFFALERVETRQWGGLTLTLIIASVGIAGALPWGILLALGRRSHMPIVRILSVIFIE 60

Query: 219 LFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKG 278
            +RGVPL+TVLFM+S+MLPLF+ +   +DKL+RAL+GV  F SAY+AEV+RGGLQ++ KG
Sbjct: 61  FWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVGVILFQSAYVAEVVRGGLQALPKG 120

Query: 279 QFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRV 338
           Q+EAA SL L Y +   L+I+PQ +K VIPG+VNT I LFKD+SL+ II +FDL   V+ 
Sbjct: 121 QYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTIIALFKDTSLVIIIGLFDLFSSVQQ 180

Query: 339 NFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
              +  W+     T G +F   ++WIFCFS+S YS  +EK  + G 
Sbjct: 181 ATVDPAWLG--MSTEGYVFAALIYWIFCFSMSRYSQHLEKRFNTGR 224


>gi|27468459|ref|NP_765096.1| glutamine-binding periplasmic protein [Staphylococcus epidermidis
           ATCC 12228]
 gi|27316006|gb|AAO05140.1|AE016749_86 glutamine-binding periplasmic protein [Staphylococcus epidermidis
           ATCC 12228]
          Length = 485

 Score =  169 bits (429), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 64/214 (29%), Positives = 116/214 (54%), Gaps = 7/214 (3%)

Query: 171 TSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLF 230
           +    G+  T++IS  G+++   LG  +AL + S I  L++    +IE  RG P++  +F
Sbjct: 279 SFFIKGIKNTILISLVGVVLGSILGSFIALLKISKIRPLQWIASIYIEFLRGTPMLVQVF 338

Query: 231 MASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSY 290
           +             D+  L+   + +   +SAYIAE++R G+ ++ KGQ EAA SLGL+Y
Sbjct: 339 IVF--FGTTAALGLDISALICGTIALVINSSAYIAEIIRAGINAVDKGQTEAARSLGLNY 396

Query: 291 LQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVT 350
            Q M+ ++MPQ IK+++P + N F+ L K+SS++S I + +++   +V    S       
Sbjct: 397 RQTMQSVVMPQAIKKILPALGNEFVTLIKESSIVSTIGVSEIMFNAQVVQGIS-----FD 451

Query: 351 PTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
           P T L+    ++++  F+++    FIE  +    
Sbjct: 452 PFTPLLVAALLYFLLTFALTRVMNFIEGRMSASD 485


>gi|242374107|ref|ZP_04819681.1| amino acid ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus epidermidis M23864:W1]
 gi|242348232|gb|EES39834.1| amino acid ABC superfamily ATP binding cassette transporter,
           membrane protein [Staphylococcus epidermidis M23864:W1]
          Length = 375

 Score =  169 bits (429), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 66/214 (30%), Positives = 113/214 (52%), Gaps = 7/214 (3%)

Query: 171 TSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLF 230
           +    G+  T++IS  G+I+   LG L+AL + S    L +    +IE  RG P++  +F
Sbjct: 169 SFFIKGIKDTILISSIGVILGSILGALIALMKLSKFKPLSWLASIYIEFLRGTPMLVQVF 228

Query: 231 MASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSY 290
           +             DV  L+   + +   +SAYIAE++R G+ ++ KGQ EAA SLGL+Y
Sbjct: 229 IVF--FGTTAALGLDVSALICGTIALVINSSAYIAEIIRAGINAVDKGQTEAARSLGLNY 286

Query: 291 LQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVT 350
            Q M+ ++MPQ IK ++P + N F+ L K+SS++S I + +++   +V    S       
Sbjct: 287 SQTMKFVVMPQAIKNILPALGNEFVTLIKESSIVSTIGVGEIMFNAQVVQGIS-----FD 341

Query: 351 PTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
           P T L+    +++I  F++S     +E  +    
Sbjct: 342 PFTPLLIAAVLYFILTFALSRIMSLVEGRMKASD 375


>gi|315641120|ref|ZP_07896199.1| glutamine ABC superfamily ATP binding cassette transporter,
           binding/permease protein [Enterococcus italicus DSM
           15952]
 gi|315483128|gb|EFU73645.1| glutamine ABC superfamily ATP binding cassette transporter,
           binding/permease protein [Enterococcus italicus DSM
           15952]
          Length = 722

 Score =  169 bits (429), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 59/219 (26%), Positives = 111/219 (50%), Gaps = 7/219 (3%)

Query: 163 GLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRG 222
              L      L  GL  T+V++     +++ +G++  L   + I  +R     ++++ RG
Sbjct: 511 WGILQNNYQQLLAGLGKTMVLALVSFALALVVGVIFGLMSVAPIKAVRIVASIYVDIIRG 570

Query: 223 VPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEA 282
           +P++ + F     L         +      ++ ++  ASAYIAE++RGG+ ++  GQ EA
Sbjct: 571 IPMMVLAFFIFFGLS--GATGITIPDFAAGIITLTLNASAYIAEIVRGGINAVPVGQMEA 628

Query: 283 ANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSE 342
           + SLGLSY + M+ II+PQ IK +IP  VN F+   KD+++IS+I + +LL   ++  + 
Sbjct: 629 SRSLGLSYGRTMQKIILPQAIKIMIPSFVNQFVISLKDTTIISVIGVVELLQTGKIIVAS 688

Query: 343 STWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
           +        T     I  ++ I    ++  +  +EK + 
Sbjct: 689 TL-----QSTYVYFIIAVMYLIIITVLTRIAKVLEKKVK 722


>gi|328946378|gb|EGG40519.1| glutamine ABC superfamily ATP binding cassette transporter,
           membrane protein [Streptococcus sanguinis SK1087]
          Length = 729

 Score =  169 bits (428), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 59/223 (26%), Positives = 108/223 (48%), Gaps = 9/223 (4%)

Query: 163 GLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRG 222
              L      L  GL VT+ ++     I+M +GI+  +   S    LR+    F+++ RG
Sbjct: 512 WGLLQNNYQELLKGLGVTIALALISFAIAMVIGIIFGMFSVSPYKPLRWIAEIFVDVIRG 571

Query: 223 VPL-VTVLFMASIMLPLFLPD---TWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKG 278
           +PL +   F+   +  L          ++  +   + +S  A AYIAE++RGG+Q++  G
Sbjct: 572 IPLMIVAAFIFWGIPNLIESMTGQQSPINAFVAGTIALSLNAGAYIAEIVRGGIQAVPVG 631

Query: 279 QFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRV 338
           Q EA+ SLG+SY + MR II+PQ  K ++P  VN F+   KD++++S I + +L    + 
Sbjct: 632 QMEASRSLGISYSKTMRKIILPQATKIMLPNFVNQFVIALKDTTIVSAIGLAELFKTGKD 691

Query: 339 NFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
             +      +         +  ++ I    ++  +  +EK + 
Sbjct: 692 IIA-----RNYQSFRMYAILAVLYLIIITLLTRLAKRLEKRIK 729


>gi|86605964|ref|YP_474727.1| polar amino acid ABC transporter permease [Synechococcus sp.
           JA-3-3Ab]
 gi|86554506|gb|ABC99464.1| polar amino amino acid ABC transporter (PAAT) family, permease
           protein [Synechococcus sp. JA-3-3Ab]
          Length = 401

 Score =  169 bits (428), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 115/392 (29%), Positives = 179/392 (45%), Gaps = 31/392 (7%)

Query: 20  LPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCT 79
           LPP  ++  +AW+ +N F +    LLT +   +L ++I    +W F  A W         
Sbjct: 15  LPPREKQSPLAWVRRNLFDSWLSTLLTLVSALVLAWAISLFWNWAFTQARWEV--IPANL 72

Query: 80  TVSQGGIQPDGWNAACWAFIY-------------------------DRYEQFIFGNYPMA 114
            +   G  P       WA +                                 F      
Sbjct: 73  KIFASGTYPSSQLWRVWAVLGIVLATLGVAGGAWGGVLLHYLILLGAAMGLAAFLPLGTQ 132

Query: 115 QRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLW 174
            +    +        +         R     +    L       +   G     V     
Sbjct: 133 SQGWLAVCSGVTFAAIALSRGRESWRLASIWVWALILPLCLELLLGNLGPNWPAVRAEQL 192

Query: 175 GGLLVTLVISFFGIIISMPLGILLALGRNSN-IPVLRYACITFIELFRGVPLVTVLFMAS 233
            GLL+TL+++   +II  P+G+LLALGR +  +PV+R  C   IEL RGVPL T+LF A 
Sbjct: 193 SGLLLTLILAAAAMIIGFPIGVLLALGRANRALPVIRIFCTLVIELVRGVPLTTILFAAW 252

Query: 234 IMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQK 293
           +++P FL     V+ ++RA +    F + Y+AE +RGGLQSI  GQ EAA +LGL+  Q 
Sbjct: 253 LLVPFFLG-GISVNLIIRAEVAFILFTAVYVAEDVRGGLQSIPLGQLEAARALGLNPFQV 311

Query: 294 MRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTT 353
             L+I+PQ ++  +P +VN F+ LFKD+SL+ I+ + DLL   RV F+   W+ +     
Sbjct: 312 TALVILPQALRAAVPALVNEFLTLFKDTSLVFIVGLIDLLQAGRVVFTNPNWLGTQR--E 369

Query: 354 GLIFIGFVFWIFCFSISLYSVFIEKTLHKGSK 385
            L FIG +++I CF+++  +  +EK L  G +
Sbjct: 370 VLFFIGLIYFICCFAMAYAAQQVEKALGLGKR 401


>gi|325694667|gb|EGD36574.1| glutamine ABC superfamily ATP binding cassette transporter,
           membrane protein [Streptococcus sanguinis SK150]
          Length = 729

 Score =  169 bits (428), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 59/223 (26%), Positives = 108/223 (48%), Gaps = 9/223 (4%)

Query: 163 GLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRG 222
              L      L  GL VT+ ++     I+M +GI+  +   S    LR+    F+++ RG
Sbjct: 512 WGLLQNNYQELLKGLGVTIALALISFAIAMVIGIIFGMFSVSPYKPLRWIAEIFVDVIRG 571

Query: 223 VPL-VTVLFMASIMLPLFLPD---TWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKG 278
           +PL +   F+   +  L          ++  +   + +S  A AYIAE++RGG+Q++  G
Sbjct: 572 IPLMIVAAFIFWGIPNLIESMTGQQSPINAFVAGTIALSLNAGAYIAEIVRGGIQAVPVG 631

Query: 279 QFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRV 338
           Q EA+ SLG+SY + MR II+PQ  K ++P  VN F+   KD++++S I + +L    + 
Sbjct: 632 QMEASRSLGISYSKTMRKIILPQATKIMLPNFVNQFVIALKDTTIVSAIGLAELFKTGKD 691

Query: 339 NFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
             +      +         +  ++ I    ++  +  +EK + 
Sbjct: 692 IIA-----RNYQSFRMYAILAVLYLIIITLLTRLAKRLEKRIK 729


>gi|58336481|ref|YP_193066.1| glutamine ABC transporter permease protein [Lactobacillus
           acidophilus NCFM]
 gi|227903033|ref|ZP_04020838.1| glutamine ABC superfamily ATP binding cassette transporter permease
           protein [Lactobacillus acidophilus ATCC 4796]
 gi|58253798|gb|AAV42035.1| glutamine ABC transporter permease protein [Lactobacillus
           acidophilus NCFM]
 gi|227869207|gb|EEJ76628.1| glutamine ABC superfamily ATP binding cassette transporter permease
           protein [Lactobacillus acidophilus ATCC 4796]
          Length = 491

 Score =  169 bits (428), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 60/209 (28%), Positives = 110/209 (52%), Gaps = 8/209 (3%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
              G+  T+VI+ F ++I + LG+LLAL R S   +L    + +IE  RG P +  +   
Sbjct: 288 FVKGIGYTIVITIFSVLIGIILGMLLALMRLSKNKLLHGIAVCYIEFIRGTPQMVQILFV 347

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
              +   +    ++  L+  ++ +   + AY+AE +R G+ S++KGQ EAA SLGLS  +
Sbjct: 348 YFGVGTLIS---NLSALVAGIIAIGLNSGAYVAEDIRSGIASVAKGQTEAARSLGLSQAK 404

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPT 352
             R +++PQ +K + P + N FI L KDSSL+S+I + +L+    +  + +         
Sbjct: 405 AYRYVVIPQALKNIWPALGNEFITLLKDSSLVSVIGVTELMYQTELIQTST-----YRGV 459

Query: 353 TGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
             L     +++I  F+++    + E+ + 
Sbjct: 460 LPLFIAMIIYFIMTFTLTRLLNYFERRMK 488


>gi|169343527|ref|ZP_02864526.1| amino acid ABC transporter, amino acid-binding protein/permease
           protein, His/Glu/Gln/Arg/opine family [Clostridium
           perfringens C str. JGS1495]
 gi|169298087|gb|EDS80177.1| amino acid ABC transporter, amino acid-binding protein/permease
           protein, His/Glu/Gln/Arg/opine family [Clostridium
           perfringens C str. JGS1495]
          Length = 519

 Score =  169 bits (428), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 66/210 (31%), Positives = 109/210 (51%), Gaps = 5/210 (2%)

Query: 172 SLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFM 231
            L   + VT+ +S FG+I+ + +GI LA+ R   IPVL+     +I  FRG PL+  LF+
Sbjct: 313 MLLKAINVTISLSVFGMILGLIVGIALAMIRVYKIPVLKQIAEVYISFFRGTPLLVQLFL 372

Query: 232 ASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYL 291
               +P  +P   ++     AL+G+   ASAYIAE+LR  + +I KGQ EA  SLG++  
Sbjct: 373 LYFGVPQVIPSLQNMSAFTAALIGLGLNASAYIAEILRSSIDAIDKGQMEACLSLGMTRA 432

Query: 292 QKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTP 351
           Q ++ +++PQ  +  IP + N F+   K SSL   + + +LL   ++  + S        
Sbjct: 433 QALKRVVLPQAFRIAIPPLGNIFVDTVKGSSLAFTLGVVELLAKAQMEAAAS-----YKF 487

Query: 352 TTGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
               + +  ++WI     +     +EK L 
Sbjct: 488 FESYVVVAIMYWIIIGFFNYLQKILEKKLS 517


>gi|325687630|gb|EGD29651.1| glutamine ABC superfamily ATP binding cassette transporter,
           membrane protein [Streptococcus sanguinis SK72]
          Length = 729

 Score =  169 bits (428), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 59/223 (26%), Positives = 108/223 (48%), Gaps = 9/223 (4%)

Query: 163 GLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRG 222
              L      L  GL VT+ ++     I+M +GI+  +   S    LR+    F+++ RG
Sbjct: 512 WGLLQNNYQELLKGLGVTIALALISFAIAMVIGIIFGMFSVSPYKPLRWIAEIFVDVIRG 571

Query: 223 VPL-VTVLFMASIMLPLFLPD---TWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKG 278
           +PL +   F+   +  L          ++  +   + +S  A AYIAE++RGG+Q++  G
Sbjct: 572 IPLMIVAAFIFWGIPNLIESMTGQQSPINAFVAGTIALSLNAGAYIAEIVRGGIQAVPVG 631

Query: 279 QFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRV 338
           Q EA+ SLG+SY + MR II+PQ  K ++P  VN F+   KD++++S I + +L    + 
Sbjct: 632 QMEASRSLGISYSKTMRKIILPQATKIMLPNFVNQFVIALKDTTIVSAIGLAELFKTGKD 691

Query: 339 NFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
             +      +         +  ++ I    ++  +  +EK + 
Sbjct: 692 IIA-----RNYQSFRMYAILAVLYLIIITLLTRLAKRLEKRIK 729


>gi|324990984|gb|EGC22918.1| glutamine ABC superfamily ATP binding cassette transporter,
           membrane protein [Streptococcus sanguinis SK353]
          Length = 729

 Score =  169 bits (428), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 59/223 (26%), Positives = 108/223 (48%), Gaps = 9/223 (4%)

Query: 163 GLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRG 222
              L      L  GL VT+ ++     I+M +GI+  +   S    LR+    F+++ RG
Sbjct: 512 WGLLQNNYQELLKGLGVTIALALISFAIAMVIGIIFGMFSVSPYKPLRWIAEIFVDVIRG 571

Query: 223 VPL-VTVLFMASIMLPLFLPD---TWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKG 278
           +PL +   F+   +  L          ++  +   + +S  A AYIAE++RGG+Q++  G
Sbjct: 572 IPLMIVAAFIFWGIPNLIESMTGQQSPINAFVAGTIALSLNAGAYIAEIVRGGIQAVPVG 631

Query: 279 QFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRV 338
           Q EA+ SLG+SY + MR II+PQ  K ++P  VN F+   KD++++S I + +L    + 
Sbjct: 632 QMEASRSLGISYSKTMRKIILPQATKIMLPNFVNQFVIALKDTTIVSAIGLAELFKTGKD 691

Query: 339 NFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
             +      +         +  ++ I    ++  +  +EK + 
Sbjct: 692 IIA-----RNYQSFRMYAILAVLYLIIITLLTRLAKRLEKRIK 729


>gi|323351404|ref|ZP_08087060.1| glutamine ABC superfamily ATP binding cassette transporter,
           membrane protein [Streptococcus sanguinis VMC66]
 gi|322122628|gb|EFX94339.1| glutamine ABC superfamily ATP binding cassette transporter,
           membrane protein [Streptococcus sanguinis VMC66]
          Length = 729

 Score =  169 bits (428), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 59/223 (26%), Positives = 108/223 (48%), Gaps = 9/223 (4%)

Query: 163 GLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRG 222
              L      L  GL VT+ ++     I+M +GI+  +   S    LR+    F+++ RG
Sbjct: 512 WGLLQNNYQELLKGLGVTIALALISFAIAMVIGIIFGMFSVSPYKPLRWIAEIFVDVIRG 571

Query: 223 VPL-VTVLFMASIMLPLFLPD---TWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKG 278
           +PL +   F+   +  L          ++  +   + +S  A AYIAE++RGG+Q++  G
Sbjct: 572 IPLMIVAAFIFWGIPNLIESMTGQQSPINAFVAGTIALSLNAGAYIAEIVRGGIQAVPVG 631

Query: 279 QFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRV 338
           Q EA+ SLG+SY + MR II+PQ  K ++P  VN F+   KD++++S I + +L    + 
Sbjct: 632 QMEASRSLGISYSKTMRKIILPQATKIMLPNFVNQFVIALKDTTIVSAIGLAELFKTGKD 691

Query: 339 NFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
             +      +         +  ++ I    ++  +  +EK + 
Sbjct: 692 IIA-----RNYQSFRMYAILAVLYLIIITLLTRLAKRLEKRIK 729


>gi|168205901|ref|ZP_02631906.1| amino acid ABC transporter, amino acid-binding protein/permease
           protein, His/Glu/Gln/Arg/opine family [Clostridium
           perfringens E str. JGS1987]
 gi|182624018|ref|ZP_02951806.1| amino acid ABC transporter, amino acid-binding protein/permease
           protein, His/Glu/Gln/Arg/opine family [Clostridium
           perfringens D str. JGS1721]
 gi|170662631|gb|EDT15314.1| amino acid ABC transporter, amino acid-binding protein/permease
           protein, His/Glu/Gln/Arg/opine family [Clostridium
           perfringens E str. JGS1987]
 gi|177910911|gb|EDT73265.1| amino acid ABC transporter, amino acid-binding protein/permease
           protein, His/Glu/Gln/Arg/opine family [Clostridium
           perfringens D str. JGS1721]
          Length = 519

 Score =  169 bits (428), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 66/210 (31%), Positives = 109/210 (51%), Gaps = 5/210 (2%)

Query: 172 SLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFM 231
            L   + VT+ +S FG+I+ + +GI LA+ R   IPVL+     +I  FRG PL+  LF+
Sbjct: 313 MLLKAINVTISLSVFGMILGLIVGIALAMIRVYKIPVLKQIAEVYISFFRGTPLLVQLFL 372

Query: 232 ASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYL 291
               +P  +P   ++     AL+G+   ASAYIAE+LR  + +I KGQ EA  SLG++  
Sbjct: 373 LYFGVPQVIPSLQNMSAFTAALIGLGLNASAYIAEILRSSIDAIDKGQMEACLSLGMTRA 432

Query: 292 QKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTP 351
           Q ++ +++PQ  +  IP + N F+   K SSL   + + +LL   ++  + S        
Sbjct: 433 QALKRVVLPQAFRIAIPPLGNIFVDTVKGSSLAFTLGVVELLAKAQMEAAAS-----YKF 487

Query: 352 TTGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
               + +  ++WI     +     +EK L 
Sbjct: 488 FESYVVVAIMYWIIIGFFNYLQKILEKKLS 517


>gi|325695929|gb|EGD37820.1| glutamine ABC superfamily ATP binding cassette transporter,
           membrane protein [Streptococcus sanguinis SK160]
          Length = 729

 Score =  169 bits (428), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 59/223 (26%), Positives = 108/223 (48%), Gaps = 9/223 (4%)

Query: 163 GLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRG 222
              L      L  GL VT+ ++     I+M +GI+  +   S    LR+    F+++ RG
Sbjct: 512 WGLLQNNYQELLKGLGVTIALALISFAIAMVIGIIFGMFSVSPYKPLRWIAEIFVDVIRG 571

Query: 223 VPL-VTVLFMASIMLPLFLPD---TWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKG 278
           +PL +   F+   +  L          ++  +   + +S  A AYIAE++RGG+Q++  G
Sbjct: 572 IPLMIVAAFIFWGIPNLIESMTGQQSPINAFVAGTIALSLNAGAYIAEIVRGGIQAVPVG 631

Query: 279 QFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRV 338
           Q EA+ SLG+SY + MR II+PQ  K ++P  VN F+   KD++++S I + +L    + 
Sbjct: 632 QMEASRSLGISYSKTMRKIILPQATKIMLPNFVNQFVIALKDTTIVSAIGLAELFKTGKD 691

Query: 339 NFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
             +      +         +  ++ I    ++  +  +EK + 
Sbjct: 692 IIA-----RNYQSFRMYAILAVLYLIIITLLTRLAKRLEKRIK 729


>gi|328950980|ref|YP_004368315.1| polar amino acid ABC transporter, inner membrane subunit
           [Marinithermus hydrothermalis DSM 14884]
 gi|328451304|gb|AEB12205.1| polar amino acid ABC transporter, inner membrane subunit
           [Marinithermus hydrothermalis DSM 14884]
          Length = 376

 Score =  169 bits (428), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 116/376 (30%), Positives = 181/376 (48%), Gaps = 20/376 (5%)

Query: 28  IIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQ 87
             AW+  N F    + LLT L    +      ++ W   +A W          +      
Sbjct: 3   AWAWMRTNLFNGWWNTLLTLLTGAGIFLLGKAVLLWALSEARWAVIPNNFRLFMVGPFPP 62

Query: 88  PDGWNAACWAFIYDRYEQFIFGNYPM--AQRWRPILVFLTGSILLTPMLIPS-------- 137
              W                +G       + WR          +L   L+          
Sbjct: 63  EAVWRVWLVVLETTVLGGLSYGVLAQGLPRAWRAFWGGALLLAVLLWPLVFPATWAWAVA 122

Query: 138 --------FPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGII 189
                            L   L  ++   +   G  LS V T+LWGGLL+TL+I+   ++
Sbjct: 123 TAAALPGAIWAGARLRGLRPYLPLLWLLGLFAAGALLSGVNTNLWGGLLLTLLITLLTVV 182

Query: 190 ISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKL 249
           +S PLG+LLALGR S +P +R     +IE  RGVPLV+VLF+A IM+PLF+P+ W   +L
Sbjct: 183 LSFPLGLLLALGRTSRLPAIRILATLYIETVRGVPLVSVLFLAWIMVPLFVPEAWRPPQL 242

Query: 250 LRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPG 309
           +R + G + FA+AY+AE +RGGLQ + KGQ+EAA +LGL+  Q    II+PQ I+ VIP 
Sbjct: 243 VRVIAGFTLFAAAYLAEYIRGGLQGVPKGQYEAAWALGLNGFQTAYYIILPQAIRSVIPA 302

Query: 310 IVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSI 369
           ++   I +FKD+SL++I+ + DLLGI +   +   ++         +F+  V++I    +
Sbjct: 303 LIGQVIAIFKDTSLVAIVGLLDLLGIAQSVLANPNYLGLER--EVYLFLLVVYFIGAGLM 360

Query: 370 SLYSVFIEKTLHKGSK 385
           S  S  +E+ +  G++
Sbjct: 361 SYASRQLERAMGLGTR 376


>gi|327470838|gb|EGF16294.1| glutamine ABC superfamily ATP binding cassette transporter,
           membrane protein [Streptococcus sanguinis SK330]
          Length = 729

 Score =  169 bits (428), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 59/223 (26%), Positives = 108/223 (48%), Gaps = 9/223 (4%)

Query: 163 GLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRG 222
              L      L  GL VT+ ++     I+M +GI+  +   S    LR+    F+++ RG
Sbjct: 512 WGLLQNNYQELLKGLGVTIALALISFAIAMVIGIIFGMFSVSPYKPLRWIAEIFVDVIRG 571

Query: 223 VPL-VTVLFMASIMLPLFLPD---TWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKG 278
           +PL +   F+   +  L          ++  +   + +S  A AYIAE++RGG+Q++  G
Sbjct: 572 IPLMIVAAFIFWGIPNLIESMTGQQSPINAFVAGTIALSLNAGAYIAEIVRGGIQAVPVG 631

Query: 279 QFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRV 338
           Q EA+ SLG+SY + MR II+PQ  K ++P  VN F+   KD++++S I + +L    + 
Sbjct: 632 QMEASRSLGISYSKTMRKIILPQATKIMLPNFVNQFVIALKDTTIVSAIGLAELFKTGKD 691

Query: 339 NFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
             +      +         +  ++ I    ++  +  +EK + 
Sbjct: 692 IIA-----RNYQSFRMYAILAVLYLIIITLLTRLAKRLEKRIK 729


>gi|325690565|gb|EGD32568.1| glutamine ABC superfamily ATP binding cassette transporter,
           membrane protein [Streptococcus sanguinis SK115]
          Length = 729

 Score =  169 bits (428), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 59/223 (26%), Positives = 108/223 (48%), Gaps = 9/223 (4%)

Query: 163 GLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRG 222
              L      L  GL VT+ ++     I+M +GI+  +   S    LR+    F+++ RG
Sbjct: 512 WGLLQNNYQELLKGLGVTIALALISFAIAMVIGIIFGMFSVSPYKPLRWIAEIFVDVIRG 571

Query: 223 VPL-VTVLFMASIMLPLFLPD---TWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKG 278
           +PL +   F+   +  L          ++  +   + +S  A AYIAE++RGG+Q++  G
Sbjct: 572 IPLMIVAAFIFWGIPNLIESMTGQQSPINAFVAGTIALSLNAGAYIAEIVRGGIQAVPVG 631

Query: 279 QFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRV 338
           Q EA+ SLG+SY + MR II+PQ  K ++P  VN F+   KD++++S I + +L    + 
Sbjct: 632 QMEASRSLGISYSKTMRKIILPQATKIMLPNFVNQFVIALKDTTIVSAIGLAELFKTGKD 691

Query: 339 NFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
             +      +         +  ++ I    ++  +  +EK + 
Sbjct: 692 IIA-----RNYQSFRMYAILAVLYLIIITLLTRLAKRLEKRIK 729


>gi|324992737|gb|EGC24657.1| glutamine ABC superfamily ATP binding cassette transporter,
           membrane protein [Streptococcus sanguinis SK405]
          Length = 729

 Score =  169 bits (427), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 59/223 (26%), Positives = 108/223 (48%), Gaps = 9/223 (4%)

Query: 163 GLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRG 222
              L      L  GL VT+ ++     I+M +GI+  +   S    LR+    F+++ RG
Sbjct: 512 WGLLQNNYQELLKGLGVTIALALISFAIAMVIGIIFGMFSVSPYKPLRWIAEIFVDVIRG 571

Query: 223 VPL-VTVLFMASIMLPLFLPD---TWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKG 278
           +PL +   F+   +  L          ++  +   + +S  A AYIAE++RGG+Q++  G
Sbjct: 572 IPLMIVAAFIFWGIPNLIESMTGQQSPINAFVAGTIALSLNAGAYIAEIVRGGIQAVPVG 631

Query: 279 QFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRV 338
           Q EA+ SLG+SY + MR II+PQ  K ++P  VN F+   KD++++S I + +L    + 
Sbjct: 632 QMEASRSLGISYSKTMRKIILPQATKIMLPNFVNQFVIALKDTTIVSAIGLAELFKTGKD 691

Query: 339 NFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
             +      +         +  ++ I    ++  +  +EK + 
Sbjct: 692 IIA-----RNYQSFRMYAILAVLYLIIITLLTRLAKRLEKRIK 729


>gi|16799914|ref|NP_470182.1| hypothetical protein lin0840 [Listeria innocua Clip11262]
 gi|16413291|emb|CAC96072.1| lin0840 [Listeria innocua Clip11262]
 gi|313619849|gb|EFR91431.1| glutamine ABC transporter, permease/substrate-binding protein
           [Listeria innocua FSL S4-378]
          Length = 480

 Score =  169 bits (427), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 60/209 (28%), Positives = 111/209 (53%), Gaps = 7/209 (3%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
           L  G+ +T+ ++   +II+  +GI     + SN  +LR     ++++FRG PL+   F  
Sbjct: 277 LLAGMWLTIRLAVVSLIIAFIIGITFGFMKVSNSKILRGIATVYVDIFRGTPLIVQAFFF 336

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
              +P      + +   L  ++ +S  A AY+ E++RGG+QS+ KGQ EAA SLGL + +
Sbjct: 337 YFGIP--AALDFRMPVFLAGVIALSLNAGAYMVEIVRGGIQSVDKGQMEAARSLGLPHKK 394

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPT 352
            M  +++PQ I+ +IP  +N F+   KD+S++S I + +L    ++  + +        T
Sbjct: 395 AMMKVVLPQAIRMMIPSFINQFVITLKDTSIMSAIGLVELTQSGKIIMART-----FEST 449

Query: 353 TGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
              + IG ++ I    ++  S  +E+ L 
Sbjct: 450 WTWLIIGIMYLIVITILTKVSDRLERRLR 478


>gi|327460181|gb|EGF06518.1| glutamine ABC superfamily ATP binding cassette transporter,
           membrane protein [Streptococcus sanguinis SK1057]
          Length = 729

 Score =  169 bits (427), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 59/223 (26%), Positives = 108/223 (48%), Gaps = 9/223 (4%)

Query: 163 GLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRG 222
              L      L  GL VT+ ++     I+M +GI+  +   S    LR+    F+++ RG
Sbjct: 512 WGLLQNNYQELLKGLGVTIALALISFAIAMIIGIIFGMFSVSPYKPLRWIAEIFVDVIRG 571

Query: 223 VPL-VTVLFMASIMLPLFLPD---TWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKG 278
           +PL +   F+   +  L          ++  +   + +S  A AYIAE++RGG+Q++  G
Sbjct: 572 IPLMIVAAFIFWGIPNLIESMTGQQSPINAFVAGTIALSLNAGAYIAEIVRGGIQAVPVG 631

Query: 279 QFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRV 338
           Q EA+ SLG+SY + MR II+PQ  K ++P  VN F+   KD++++S I + +L    + 
Sbjct: 632 QMEASRSLGISYSKTMRKIILPQATKIMLPNFVNQFVIALKDTTIVSAIGLAELFKTGKD 691

Query: 339 NFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
             +      +         +  ++ I    ++  +  +EK + 
Sbjct: 692 IIA-----RNYQSFRMYAILAVLYLIIITLLTRLAKRLEKRIK 729


>gi|260102147|ref|ZP_05752384.1| glutamine ABC superfamily ATP binding cassette transporter,
           permease protein [Lactobacillus helveticus DSM 20075]
 gi|260084037|gb|EEW68157.1| glutamine ABC superfamily ATP binding cassette transporter,
           permease protein [Lactobacillus helveticus DSM 20075]
          Length = 494

 Score =  169 bits (427), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 60/209 (28%), Positives = 111/209 (53%), Gaps = 8/209 (3%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
              G+  T++I+ F ++I + LG+LLAL R S   +L +  + +IE  RG P +  +   
Sbjct: 291 FVKGIEYTIIITVFSVLIGIVLGMLLALMRLSKNKLLHWIAVCYIEFIRGTPQMVQILFV 350

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
              +   +    ++  L+  ++ +   + AY+AE +R G+ S++KGQ EAA SLGLS  +
Sbjct: 351 YFGVGALIS---NLSALVAGIIAIGLNSGAYVAEDIRSGIASVAKGQTEAARSLGLSQAK 407

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPT 352
             R +I+PQ +K + P + N FI L KDSSL+S+I + +L+    +  + +         
Sbjct: 408 AYRYVIIPQALKNIWPALDNEFITLLKDSSLVSVIGVTELMYQTELIQTST-----YRGV 462

Query: 353 TGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
             L     +++I  F+++    + E+ + 
Sbjct: 463 LPLFIAMIIYFIMTFTLTRLLNYFERRMK 491


>gi|217965060|ref|YP_002350738.1| glutamine ABC transporter, permease/substrate-binding protein
           [Listeria monocytogenes HCC23]
 gi|290892961|ref|ZP_06555951.1| glutamine ABC transporter [Listeria monocytogenes FSL J2-071]
 gi|217334330|gb|ACK40124.1| glutamine ABC transporter, permease/substrate-binding protein
           [Listeria monocytogenes HCC23]
 gi|290557537|gb|EFD91061.1| glutamine ABC transporter [Listeria monocytogenes FSL J2-071]
 gi|307570380|emb|CAR83559.1| glutamine ABC transporter, permease/substrate-binding protein
           [Listeria monocytogenes L99]
          Length = 480

 Score =  169 bits (427), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 61/209 (29%), Positives = 111/209 (53%), Gaps = 7/209 (3%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
           L  GL +T+ ++   +II+  +GI     + SN  +LR     ++++FRG PL+   F  
Sbjct: 277 LLSGLWLTIRLAVVSLIIAFIIGITFGFMKVSNSKILRGIATVYVDIFRGTPLIVQAFFF 336

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
              +P      + +   L  ++ +S  A AY+ E++RGG+QS+ KGQ EAA SLGL + +
Sbjct: 337 YFGIP--AALDFRMPVFLAGVIALSLNAGAYMVEIVRGGIQSVDKGQMEAARSLGLPHKK 394

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPT 352
            M  +++PQ I+ +IP  +N F+   KD+S++S I + +L    ++  + +        T
Sbjct: 395 AMMKVVLPQAIRMMIPSFINQFVITLKDTSIMSAIGLVELTQSGKIIMART-----FEST 449

Query: 353 TGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
              + IG ++ I    ++  S  +E+ L 
Sbjct: 450 WTWLIIGIMYLIVITILTKISDRLERRLR 478


>gi|324994617|gb|EGC26530.1| glutamine ABC superfamily ATP binding cassette transporter,
           membrane protein [Streptococcus sanguinis SK678]
 gi|327462473|gb|EGF08797.1| glutamine ABC superfamily ATP binding cassette transporter,
           membrane protein [Streptococcus sanguinis SK1]
 gi|327474328|gb|EGF19734.1| glutamine ABC superfamily ATP binding cassette transporter,
           membrane protein [Streptococcus sanguinis SK408]
 gi|327489715|gb|EGF21505.1| glutamine ABC superfamily ATP binding cassette transporter,
           membrane protein [Streptococcus sanguinis SK1058]
          Length = 729

 Score =  169 bits (427), Expect = 9e-40,   Method: Composition-based stats.
 Identities = 59/223 (26%), Positives = 108/223 (48%), Gaps = 9/223 (4%)

Query: 163 GLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRG 222
              L      L  GL VT+ ++     I+M +GI+  +   S    LR+    F+++ RG
Sbjct: 512 WGLLQNNYQELLKGLGVTIALALISFAIAMVIGIIFGMFSVSPYKPLRWIAEIFVDVIRG 571

Query: 223 VPL-VTVLFMASIMLPLFLPD---TWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKG 278
           +PL +   F+   +  L          ++  +   + +S  A AYIAE++RGG+Q++  G
Sbjct: 572 IPLMIVAAFIFWGIPNLIESMTGQQSPINAFVAGTIALSLNAGAYIAEIVRGGIQAVPVG 631

Query: 279 QFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRV 338
           Q EA+ SLG+SY + MR II+PQ  K ++P  VN F+   KD++++S I + +L    + 
Sbjct: 632 QMEASRSLGISYSKTMRKIILPQATKIMLPNFVNQFVIALKDTTIVSAIGLAELFKTGKD 691

Query: 339 NFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
             +      +         +  ++ I    ++  +  +EK + 
Sbjct: 692 IIA-----RNYQSFRMYAILAVLYLIIITLLTRLAKRLEKRIK 729


>gi|289435591|ref|YP_003465463.1| amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine
           family [Listeria seeligeri serovar 1/2b str. SLCC3954]
 gi|289171835|emb|CBH28381.1| amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine
           family [Listeria seeligeri serovar 1/2b str. SLCC3954]
          Length = 486

 Score =  169 bits (427), Expect = 9e-40,   Method: Composition-based stats.
 Identities = 61/227 (26%), Positives = 113/227 (49%), Gaps = 8/227 (3%)

Query: 158 FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFI 217
            +   G            G L+T+ ++  G++     G LLAL + +    LR+    +I
Sbjct: 268 LMFQDGSFYEKYGNYFIKGTLITIALAAIGVLCGAVFGSLLALMKLAKTRWLRWPASCYI 327

Query: 218 ELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISK 277
           E  RG PL+  +F+      +      DV   +   + +S  ++AY+AE++R G+ +++K
Sbjct: 328 EFVRGTPLLIQIFIVFFGTQII---GLDVSAFVSGCIALSLNSAAYVAEIIRAGISAVNK 384

Query: 278 GQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVR 337
           GQ EAA SLG++    MR II+PQ +K ++P + N F+ + K+SS++S+I + +L+ +  
Sbjct: 385 GQMEAARSLGMTQSASMRYIILPQAVKNILPALGNEFVTVIKESSIVSVIGVTELMFMTG 444

Query: 338 VNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
           V    S       P   L+    ++++  FS+S      E+ +    
Sbjct: 445 VVQGAS-----FKPFIPLVITSLIYFVLTFSLSRLLGVAERRMRTSD 486


>gi|116872260|ref|YP_849041.1| glutamine ABC transporter binding and transport protein, putative
           [Listeria welshimeri serovar 6b str. SLCC5334]
 gi|116741138|emb|CAK20258.1| glutamine ABC transporter binding and transport protein, putative
           [Listeria welshimeri serovar 6b str. SLCC5334]
          Length = 480

 Score =  169 bits (427), Expect = 9e-40,   Method: Composition-based stats.
 Identities = 60/209 (28%), Positives = 111/209 (53%), Gaps = 7/209 (3%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
           L  G+ +T+ ++   +II+  +GI     + SN  +LR     ++++FRG PL+   F  
Sbjct: 277 LLAGMWLTIRLAVVSLIIAFIIGITFGFMKVSNSKILRGIATVYVDIFRGTPLIVQAFFF 336

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
              +P      + +   L  ++ +S  A AY+ E++RGG+QS+ KGQ EAA SLGL + +
Sbjct: 337 YFGIP--AALDFRMPVFLAGVIALSLNAGAYMVEIVRGGIQSVDKGQMEAARSLGLPHKK 394

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPT 352
            M  +++PQ I+ +IP  +N F+   KD+S++S I + +L    ++  + +        T
Sbjct: 395 AMMKVVLPQAIRMMIPSFINQFVITLKDTSIMSAIGLVELTQSGKIIMART-----FEST 449

Query: 353 TGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
              + IG ++ I    ++  S  +E+ L 
Sbjct: 450 WTWLIIGIMYLIVITILTKVSDRLERRLR 478


>gi|313624521|gb|EFR94518.1| glutamine ABC transporter, permease/substrate-binding protein
           [Listeria innocua FSL J1-023]
          Length = 480

 Score =  169 bits (427), Expect = 9e-40,   Method: Composition-based stats.
 Identities = 60/209 (28%), Positives = 111/209 (53%), Gaps = 7/209 (3%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
           L  G+ +T+ ++   +II+  +GI     + SN  +LR     ++++FRG PL+   F  
Sbjct: 277 LLAGMWLTIRLAVVSLIIAFIIGITFGFMKVSNSKILRGIATVYVDIFRGTPLIVQAFFF 336

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
              +P      + +   L  ++ +S  A AY+ E++RGG+QS+ KGQ EAA SLGL + +
Sbjct: 337 YFGIP--AALDFRMPVFLAGVIALSLNAGAYMVEIVRGGIQSVDKGQMEAARSLGLPHKK 394

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPT 352
            M  +++PQ I+ +IP  +N F+   KD+S++S I + +L    ++  + +        T
Sbjct: 395 AMMKVVLPQAIRMMIPSFINQFVITLKDTSIMSAIGLVELTQSGKIIMART-----FEST 449

Query: 353 TGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
              + IG ++ I    ++  S  +E+ L 
Sbjct: 450 WTWLIIGIMYLIVITILTKVSDRLERRLR 478


>gi|161506742|ref|YP_001576692.1| glutamine ABC transporter substrate binding/permease protein
           [Lactobacillus helveticus DPC 4571]
 gi|160347731|gb|ABX26405.1| Glutamine ABC transporter substrate binding/permease protein
           [Lactobacillus helveticus DPC 4571]
          Length = 494

 Score =  169 bits (427), Expect = 9e-40,   Method: Composition-based stats.
 Identities = 60/209 (28%), Positives = 111/209 (53%), Gaps = 8/209 (3%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
              G+  T++I+ F ++I + LG+LLAL R S   +L +  + +IE  RG P +  +   
Sbjct: 291 FVKGIEYTIIITVFSVLIGIVLGMLLALMRLSKNKLLHWIAVCYIEFIRGTPQMVQILFV 350

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
              +   +    ++  L+  ++ +   + AY+AE +R G+ S++KGQ EAA SLGLS  +
Sbjct: 351 YFGVGALIS---NLSALVAGIIAIGLNSGAYVAEDIRSGIASVAKGQTEAARSLGLSQAK 407

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPT 352
             R +I+PQ +K + P + N FI L KDSSL+S+I + +L+    +  + +         
Sbjct: 408 AYRYVIIPQALKNIWPALDNEFITLLKDSSLVSVIGVTELMYQTELIQTST-----YRGV 462

Query: 353 TGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
             L     +++I  F+++    + E+ + 
Sbjct: 463 LPLFIAMIIYFIMTFTLTRLLNYFERRMK 491


>gi|116873682|ref|YP_850463.1| His/Glu/Gln/Arg/opine ABC transporter permease [Listeria welshimeri
           serovar 6b str. SLCC5334]
 gi|116742560|emb|CAK21684.1| amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine
           family [Listeria welshimeri serovar 6b str. SLCC5334]
          Length = 486

 Score =  168 bits (426), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 63/227 (27%), Positives = 114/227 (50%), Gaps = 8/227 (3%)

Query: 158 FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFI 217
            +   G            G L+T+ ++  G++    LG LLAL + +    LR+    +I
Sbjct: 268 LMFQDGSFYEKYGNYFITGTLITIALAAIGVLCGAILGSLLALMKLAKTRWLRWPAACYI 327

Query: 218 ELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISK 277
           E  RG PL+  +F+      +      DV   +   + +S  ++AY+AE++R G+ +++K
Sbjct: 328 EFVRGTPLLIQIFIVFFGTQII---GMDVSAFVSGCIALSLNSAAYVAEIIRAGISAVNK 384

Query: 278 GQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVR 337
           GQ EAA SLG++    MR II+PQ +K ++P + N F+ + K+SS++S+I + +L+ +  
Sbjct: 385 GQMEAARSLGMTQRASMRYIILPQAVKNILPALGNEFVTVIKESSIVSVIGVTELMFMTG 444

Query: 338 VNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
           V    S       P   LI    ++++  FS+S      E+ +    
Sbjct: 445 VVQGAS-----FKPFIPLIITSLIYFVLTFSLSRLLGVAERRMRTSD 486


>gi|47094853|ref|ZP_00232467.1| glutamine ABC transporter, permease/substrate-binding protein
           [Listeria monocytogenes str. 1/2a F6854]
 gi|254898981|ref|ZP_05258905.1| glutamine ABC transporter, permease/substrate-binding protein
           [Listeria monocytogenes J0161]
 gi|254911531|ref|ZP_05261543.1| glutamine ABC transporter [Listeria monocytogenes J2818]
 gi|254935857|ref|ZP_05267554.1| glutamine ABC transporter [Listeria monocytogenes F6900]
 gi|47016735|gb|EAL07654.1| glutamine ABC transporter, permease/substrate-binding protein
           [Listeria monocytogenes str. 1/2a F6854]
 gi|258608445|gb|EEW21053.1| glutamine ABC transporter [Listeria monocytogenes F6900]
 gi|293589477|gb|EFF97811.1| glutamine ABC transporter [Listeria monocytogenes J2818]
          Length = 480

 Score =  168 bits (426), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 61/209 (29%), Positives = 111/209 (53%), Gaps = 7/209 (3%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
           L  GL +T+ ++   +II+  +GI     + SN  +LR     ++++FRG PL+   F  
Sbjct: 277 LLSGLWLTIRLAVVSLIIAFIIGITFGFMKVSNSKILRGIATVYVDIFRGTPLIVQAFFF 336

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
              +P      + +   L  ++ +S  A AY+ E++RGG+QS+ KGQ EAA SLGL + +
Sbjct: 337 YFGIP--AALDFRMPVFLAGVIALSLNAGAYMVEIVRGGIQSVDKGQMEAARSLGLPHKK 394

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPT 352
            M  +++PQ I+ +IP  +N F+   KD+S++S I + +L    ++  + +        T
Sbjct: 395 AMMKVVLPQAIRMMIPSFINQFVITLKDTSIMSAIGLVELTQSGKIIMART-----FEST 449

Query: 353 TGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
              + IG ++ I    ++  S  +E+ L 
Sbjct: 450 WTWLIIGIMYLIVITILTKISDRLERRLR 478


>gi|47092054|ref|ZP_00229847.1| glutamine ABC transporter, permease/substrate-binding protein
           [Listeria monocytogenes str. 4b H7858]
 gi|226223465|ref|YP_002757572.1| Glutamine ABC transporter (binding and transport protein) [Listeria
           monocytogenes Clip81459]
 gi|254823885|ref|ZP_05228886.1| glutamine ABC transporter [Listeria monocytogenes FSL J1-194]
 gi|254852338|ref|ZP_05241686.1| glutamine ABC transporter [Listeria monocytogenes FSL R2-503]
 gi|254931228|ref|ZP_05264587.1| glutamine ABC transporter [Listeria monocytogenes HPB2262]
 gi|254993068|ref|ZP_05275258.1| Glutamine ABC transporter (binding and transport protein) [Listeria
           monocytogenes FSL J2-064]
 gi|300765789|ref|ZP_07075764.1| glutamine ABC transporter, permease/substrate-binding protein
           [Listeria monocytogenes FSL N1-017]
 gi|47019494|gb|EAL10234.1| glutamine ABC transporter, permease/substrate-binding protein
           [Listeria monocytogenes str. 4b H7858]
 gi|225875927|emb|CAS04631.1| Putative Glutamine ABC transporter (binding and transport protein)
           [Listeria monocytogenes serotype 4b str. CLIP 80459]
 gi|258605645|gb|EEW18253.1| glutamine ABC transporter [Listeria monocytogenes FSL R2-503]
 gi|293582776|gb|EFF94808.1| glutamine ABC transporter [Listeria monocytogenes HPB2262]
 gi|293593110|gb|EFG00871.1| glutamine ABC transporter [Listeria monocytogenes FSL J1-194]
 gi|300513483|gb|EFK40555.1| glutamine ABC transporter, permease/substrate-binding protein
           [Listeria monocytogenes FSL N1-017]
 gi|328467121|gb|EGF38211.1| Glutamine ABC transporter (binding and transport protein) [Listeria
           monocytogenes 1816]
 gi|328475546|gb|EGF46305.1| Glutamine ABC transporter (binding and transport protein) [Listeria
           monocytogenes 220]
          Length = 480

 Score =  168 bits (426), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 61/209 (29%), Positives = 111/209 (53%), Gaps = 7/209 (3%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
           L  GL +T+ ++   +II+  +GI     + SN  +LR     ++++FRG PL+   F  
Sbjct: 277 LLSGLWLTIRLAVVSLIIAFIIGITFGFMKVSNSKILRGIATVYVDIFRGTPLIVQAFFF 336

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
              +P      + +   L  ++ +S  A AY+ E++RGG+QS+ KGQ EAA SLGL + +
Sbjct: 337 YFGIP--AALDFRMPVFLAGVIALSLNAGAYMVEIVRGGIQSVDKGQMEAARSLGLPHKK 394

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPT 352
            M  +++PQ I+ +IP  +N F+   KD+S++S I + +L    ++  + +        T
Sbjct: 395 AMMKVVLPQAIRMMIPSFINQFVITLKDTSIMSAIGLVELTQSGKIIMART-----FEST 449

Query: 353 TGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
              + IG ++ I    ++  S  +E+ L 
Sbjct: 450 WTWLIIGIMYLIVITILTKISDRLERRLR 478


>gi|224500426|ref|ZP_03668775.1| glutamine ABC transporter, permease/substrate-binding protein
           [Listeria monocytogenes Finland 1988]
 gi|254827790|ref|ZP_05232477.1| glutamine ABC transporter [Listeria monocytogenes FSL N3-165]
 gi|258600171|gb|EEW13496.1| glutamine ABC transporter [Listeria monocytogenes FSL N3-165]
          Length = 480

 Score =  168 bits (426), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 61/209 (29%), Positives = 111/209 (53%), Gaps = 7/209 (3%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
           L  GL +T+ ++   +II+  +GI     + SN  +LR     ++++FRG PL+   F  
Sbjct: 277 LLSGLWLTIRLAVVSLIIAFIIGITFGFMKVSNSKILRGIATVYVDIFRGTPLIVQAFFF 336

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
              +P      + +   L  ++ +S  A AY+ E++RGG+QS+ KGQ EAA SLGL + +
Sbjct: 337 YFGIP--AALDFRMPVFLAGVIALSLNAGAYMVEIVRGGIQSVDKGQMEAARSLGLPHKK 394

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPT 352
            M  +++PQ I+ +IP  +N F+   KD+S++S I + +L    ++  + +        T
Sbjct: 395 AMMKVVLPQAIRMMIPSFINQFVITLKDTSIMSAIGLVELTQSGKIIMART-----FEST 449

Query: 353 TGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
              + IG ++ I    ++  S  +E+ L 
Sbjct: 450 WTWLIIGIMYLIVITILTKISDRLERRLR 478


>gi|315304435|ref|ZP_07874723.1| His/Glu/Gln/Arg/opine ABC transporter permease [Listeria ivanovii
           FSL F6-596]
 gi|313627196|gb|EFR96041.1| His/Glu/Gln/Arg/opine ABC transporter permease [Listeria ivanovii
           FSL F6-596]
          Length = 486

 Score =  168 bits (426), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 64/227 (28%), Positives = 114/227 (50%), Gaps = 8/227 (3%)

Query: 158 FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFI 217
            +   G            G L+T+ ++  G++    LG LLAL + +    LR+    +I
Sbjct: 268 LMFQDGSFYEKYGNYFVKGTLITIALAAIGVLCGAVLGSLLALMKLAKTRWLRWPAACYI 327

Query: 218 ELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISK 277
           E  RG PL+  +F+      +      DV   +   + +S  ++AY+AE++R G+ +++K
Sbjct: 328 EFVRGTPLLIQIFIVFFGTQII---GMDVSAFVSGCIALSLNSAAYVAEIIRAGISAVNK 384

Query: 278 GQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVR 337
           GQ EAA SLG++    MR II+PQ +K ++P + N F+ + K+SS++S+I + +L+ +  
Sbjct: 385 GQMEAARSLGMTQSASMRYIILPQAVKNILPALGNEFVTVIKESSIVSVIGVTELMFMTG 444

Query: 338 VNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
           V    S       P   LI    +++I  FS+S      E+ +    
Sbjct: 445 VVQGAS-----FKPFIPLIITSLIYFILTFSLSRLLGVAERRMRTSD 486


>gi|258611866|ref|ZP_05711691.1| LOW QUALITY PROTEIN: amino acid ABC transporter [Listeria
           monocytogenes FSL R2-503]
 gi|258606739|gb|EEW19347.1| LOW QUALITY PROTEIN: amino acid ABC transporter [Listeria
           monocytogenes FSL R2-503]
          Length = 444

 Score =  168 bits (426), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 63/227 (27%), Positives = 114/227 (50%), Gaps = 8/227 (3%)

Query: 158 FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFI 217
            +   G            G L+T+ ++  G++    LG LLAL + +    LR+    +I
Sbjct: 226 LMFQDGSFYEKYGNYFITGTLITIALAAIGVLCGAILGSLLALMKLAKTRWLRWPAACYI 285

Query: 218 ELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISK 277
           E  RG PL+  +F+      +      DV   +   + +S  ++AY+AE++R G+ +++K
Sbjct: 286 EFVRGTPLLIQIFIVFFGTQII---GMDVSAFVSGCIALSLNSAAYVAEIIRAGISAVNK 342

Query: 278 GQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVR 337
           GQ EAA SLG++    MR II+PQ +K ++P + N F+ + K+SS++S+I + +L+ +  
Sbjct: 343 GQMEAARSLGMTQGASMRYIILPQAVKNILPALGNEFVTVIKESSIVSVIGVTELMFMTG 402

Query: 338 VNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
           V    S       P   LI    ++++  FS+S      E+ +    
Sbjct: 403 VVQGAS-----FKPFIPLIITSLIYFVLTFSLSRLLGVAERRMRTSD 444


>gi|46907078|ref|YP_013467.1| glutamine ABC transporter, permease/substrate-binding protein
           [Listeria monocytogenes str. 4b F2365]
 gi|224503184|ref|ZP_03671491.1| glutamine ABC transporter, permease/substrate-binding protein
           [Listeria monocytogenes FSL R2-561]
 gi|254832188|ref|ZP_05236843.1| glutamine ABC transporter, permease/substrate-binding protein
           [Listeria monocytogenes 10403S]
 gi|255520210|ref|ZP_05387447.1| glutamine ABC transporter, permease/substrate-binding protein
           [Listeria monocytogenes FSL J1-175]
 gi|284801176|ref|YP_003413041.1| hypothetical protein LM5578_0926 [Listeria monocytogenes 08-5578]
 gi|284994318|ref|YP_003416086.1| hypothetical protein LM5923_0880 [Listeria monocytogenes 08-5923]
 gi|46880345|gb|AAT03644.1| glutamine ABC transporter, permease/substrate-binding protein
           [Listeria monocytogenes serotype 4b str. F2365]
 gi|284056738|gb|ADB67679.1| hypothetical protein LM5578_0926 [Listeria monocytogenes 08-5578]
 gi|284059785|gb|ADB70724.1| hypothetical protein LM5923_0880 [Listeria monocytogenes 08-5923]
          Length = 480

 Score =  168 bits (426), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 61/209 (29%), Positives = 111/209 (53%), Gaps = 7/209 (3%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
           L  GL +T+ ++   +II+  +GI     + SN  +LR     ++++FRG PL+   F  
Sbjct: 277 LLSGLWLTIRLAVVSLIIAFIIGITFGFMKVSNSKILRGIATVYVDIFRGTPLIVQAFFF 336

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
              +P      + +   L  ++ +S  A AY+ E++RGG+QS+ KGQ EAA SLGL + +
Sbjct: 337 YFGIP--AALDFRMPVFLAGVIALSLNAGAYMVEIVRGGIQSVDKGQMEAARSLGLPHKK 394

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPT 352
            M  +++PQ I+ +IP  +N F+   KD+S++S I + +L    ++  + +        T
Sbjct: 395 AMMKVVLPQAIRMMIPSFINQFVITLKDTSIMSAIGLVELTQSGKIIMART-----FEST 449

Query: 353 TGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
              + IG ++ I    ++  S  +E+ L 
Sbjct: 450 WTWLIIGIMYLIVITILTKISDRLERRLR 478


>gi|315281521|ref|ZP_07870132.1| glutamine ABC transporter, permease/substrate-binding protein
           [Listeria marthii FSL S4-120]
 gi|313614833|gb|EFR88366.1| glutamine ABC transporter, permease/substrate-binding protein
           [Listeria marthii FSL S4-120]
          Length = 480

 Score =  168 bits (426), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 61/209 (29%), Positives = 111/209 (53%), Gaps = 7/209 (3%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
           L  G+ +T+ ++   +II+  +GI     + SN  +LR     ++++FRG PL+   F  
Sbjct: 277 LLAGMWLTIRLAVVSLIIAFIIGITFGFMKVSNNKILRGIATVYVDIFRGTPLIVQAFFF 336

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
              +P      + +   L  ++ +S  A AY+ E++RGG+QS+ KGQ EAA SLGL Y +
Sbjct: 337 YFGIP--AALDFRMPVFLAGVIALSLNAGAYMVEIVRGGIQSVDKGQMEAARSLGLPYKK 394

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPT 352
            M  +++PQ I+ +IP  +N F+   KD+S++S I + +L    ++  + +        T
Sbjct: 395 AMMKVVLPQAIRMMIPSFINQFVITLKDTSIMSAIGLVELTQSGKIIMART-----FEST 449

Query: 353 TGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
              + IG ++ I    ++  S  +E+ L 
Sbjct: 450 WTWLIIGIMYLIVITILTKVSDRLERRLR 478


>gi|73662246|ref|YP_301027.1| truncated ABC-type amino acid transport system periplasmic
           component [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
 gi|72494761|dbj|BAE18082.1| truncated ABC-type amino acid transport system periplasmic
           component [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
          Length = 398

 Score =  168 bits (426), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 62/212 (29%), Positives = 112/212 (52%), Gaps = 7/212 (3%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
              G+  T++IS  G+++    G  +AL + S I +L +    +IE  RG PL+  +F+ 
Sbjct: 194 FLKGIQNTILISIVGVLLGTVFGAGIALLKLSKIKLLSWLASAYIEFLRGTPLLVQVFLV 253

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
                       ++  L+  ++ +    SAYIAE++R G+ ++  GQ EAA SLGL+Y Q
Sbjct: 254 Y--FGTTAVLGLNISALICGMIALVINCSAYIAEIIRAGINAVDSGQTEAARSLGLTYGQ 311

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPT 352
            M+ +I+PQ IK ++P + N F+ + K+SS++S+I + +++   +V    S       P 
Sbjct: 312 TMKSVILPQAIKNILPALGNEFVTVIKESSIVSVIGVSEIMFNAQVVQGAS-----FDPF 366

Query: 353 TGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
           T LI    +++I  F++S    + E  +    
Sbjct: 367 TPLIVAAILYFILTFTLSRVMYYFEGRMKVSD 398


>gi|16804289|ref|NP_465774.1| hypothetical protein lmo2250 [Listeria monocytogenes EGD-e]
 gi|224500950|ref|ZP_03669257.1| hypothetical protein LmonFR_00275 [Listeria monocytogenes FSL
           R2-561]
 gi|16411720|emb|CAD00328.1| arpJ [Listeria monocytogenes EGD-e]
          Length = 486

 Score =  168 bits (426), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 63/227 (27%), Positives = 114/227 (50%), Gaps = 8/227 (3%)

Query: 158 FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFI 217
            +   G            G L+T+ ++  G++    LG LLAL + +    LR+    +I
Sbjct: 268 LMFQDGSFYEKYGNYFVTGTLITIALAAIGVLCGAILGSLLALMKLAKTRWLRWPAACYI 327

Query: 218 ELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISK 277
           E  RG PL+  +F+      +      DV   +   + +S  ++AY+AE++R G+ +++K
Sbjct: 328 EFVRGTPLLIQIFIVFFGTQII---GMDVSAFVSGCIALSLNSAAYVAEIIRAGISAVNK 384

Query: 278 GQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVR 337
           GQ EAA SLG++    MR II+PQ +K ++P + N F+ + K+SS++S+I + +L+ +  
Sbjct: 385 GQMEAARSLGMTQGASMRYIILPQAVKNILPALGNEFVTVIKESSIVSVIGVTELMFMTG 444

Query: 338 VNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
           V    S       P   LI    ++++  FS+S      E+ +    
Sbjct: 445 VVQGAS-----FKPFIPLIITSLIYFVLTFSLSRLLGVAERRMRTSD 486


>gi|118470254|ref|YP_890525.1| glutamine-binding periplasmic protein/glutamine transporter
           permease [Mycobacterium smegmatis str. MC2 155]
 gi|118171541|gb|ABK72437.1| glutamine-binding periplasmic protein/glutamine transport system
           permease protein [Mycobacterium smegmatis str. MC2 155]
          Length = 475

 Score =  168 bits (425), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 59/208 (28%), Positives = 102/208 (49%), Gaps = 8/208 (3%)

Query: 179 VTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPL 238
           +T+ ++     I + + + +AL R S+  VL      +I + RG PL+  LF+    LP 
Sbjct: 276 MTIPLTIISFAIGLVIALGVALARLSSNAVLSNVARLYISIIRGTPLLVQLFLVFYALPE 335

Query: 239 FLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLII 298
           F      +D    A++  S     Y AE++R  + SI KGQ+EAA ++GL+Y + ++ II
Sbjct: 336 F---GVRIDPFPAAVIAFSLNVGGYAAEIIRAAILSIPKGQWEAAETIGLTYGKSLQRII 392

Query: 299 MPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTGLIFI 358
           +PQ  +  +P + NT I L KD+SL S I + +LL   ++  + +               
Sbjct: 393 LPQAARVAVPPLSNTLISLVKDTSLASTILVTELLRQAQIAAAPT-----FEFFALYGTA 447

Query: 359 GFVFWIFCFSISLYSVFIEKTLHKGSKK 386
              +W+ C  +S     IE+ L +   +
Sbjct: 448 AVYYWVICLVLSFGQSRIERRLERYVAR 475


>gi|224498994|ref|ZP_03667343.1| hypothetical protein LmonF1_04543 [Listeria monocytogenes Finland
           1988]
 gi|254831313|ref|ZP_05235968.1| hypothetical protein Lmon1_08142 [Listeria monocytogenes 10403S]
          Length = 486

 Score =  168 bits (425), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 63/227 (27%), Positives = 114/227 (50%), Gaps = 8/227 (3%)

Query: 158 FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFI 217
            +   G            G L+T+ ++  G++    LG LLAL + +    LR+    +I
Sbjct: 268 LMFQDGSFYEKYGNYFVTGTLITIALAAIGVLCGAILGSLLALMKLAKTRWLRWPAACYI 327

Query: 218 ELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISK 277
           E  RG PL+  +F+      +      DV   +   + +S  ++AY+AE++R G+ +++K
Sbjct: 328 EFVRGTPLLIQIFIVFFGTQII---GMDVSAFVSGCIALSLNSAAYVAEIIRAGISAVNK 384

Query: 278 GQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVR 337
           GQ EAA SLG++    MR II+PQ +K ++P + N F+ + K+SS++S+I + +L+ +  
Sbjct: 385 GQMEAARSLGMTQGASMRYIILPQAVKNILPALGNEFVTVIKESSIVSVIGVTELMFMTG 444

Query: 338 VNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
           V    S       P   LI    ++++  FS+S      E+ +    
Sbjct: 445 VVQGAS-----FKPFIPLIITSLIYFVLTFSLSRLLGVAERRMRTSD 486


>gi|16802888|ref|NP_464373.1| hypothetical protein lmo0847 [Listeria monocytogenes EGD-e]
 gi|16410235|emb|CAC98925.1| lmo0847 [Listeria monocytogenes EGD-e]
          Length = 480

 Score =  168 bits (425), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 61/209 (29%), Positives = 111/209 (53%), Gaps = 7/209 (3%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
           L  GL +T+ ++   +II+  +GI     + SN  +LR     ++++FRG PL+   F  
Sbjct: 277 LLSGLWLTIRLAVVSLIIAFIIGITFGFMKVSNSKILRGIATVYVDIFRGTPLIVQAFFF 336

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
              +P      + +   L  ++ +S  A AY+ E++RGG+QS+ KGQ EAA SLGL + +
Sbjct: 337 YFGIP--AALDFRMPVFLAGVIALSLNAGAYMVEIVRGGIQSVDKGQMEAARSLGLPHKK 394

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPT 352
            M  +++PQ I+ +IP  +N F+   KD+S++S I + +L    ++  + +        T
Sbjct: 395 AMMKVVLPQAIRMMIPSFINQFVITLKDTSIMSAIGLVELTQSGKIIMART-----FEST 449

Query: 353 TGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
              + IG ++ I    ++  S  +E+ L 
Sbjct: 450 WTWLIIGIMYLIVITILTKISDRLERRLR 478


>gi|254899048|ref|ZP_05258972.1| hypothetical protein LmonJ_04529 [Listeria monocytogenes J0161]
 gi|254912811|ref|ZP_05262823.1| conserved hypothetical protein [Listeria monocytogenes J2818]
 gi|254937138|ref|ZP_05268835.1| arpJ [Listeria monocytogenes F6900]
 gi|284802697|ref|YP_003414562.1| hypothetical protein LM5578_2453 [Listeria monocytogenes 08-5578]
 gi|284995839|ref|YP_003417607.1| hypothetical protein LM5923_2404 [Listeria monocytogenes 08-5923]
 gi|258609741|gb|EEW22349.1| arpJ [Listeria monocytogenes F6900]
 gi|284058259|gb|ADB69200.1| hypothetical protein LM5578_2453 [Listeria monocytogenes 08-5578]
 gi|284061306|gb|ADB72245.1| hypothetical protein LM5923_2404 [Listeria monocytogenes 08-5923]
 gi|293590807|gb|EFF99141.1| conserved hypothetical protein [Listeria monocytogenes J2818]
          Length = 486

 Score =  168 bits (425), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 63/227 (27%), Positives = 114/227 (50%), Gaps = 8/227 (3%)

Query: 158 FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFI 217
            +   G            G L+T+ ++  G++    LG LLAL + +    LR+    +I
Sbjct: 268 LMFQDGSFYEKYGNYFVTGTLITIALAAIGVLCGAILGSLLALMKLAKTRWLRWPAACYI 327

Query: 218 ELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISK 277
           E  RG PL+  +F+      +      DV   +   + +S  ++AY+AE++R G+ +++K
Sbjct: 328 EFVRGTPLLIQIFIVFFGTQII---GMDVSAFVSGCIALSLNSAAYVAEIIRAGISAVNK 384

Query: 278 GQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVR 337
           GQ EAA SLG++    MR II+PQ +K ++P + N F+ + K+SS++S+I + +L+ +  
Sbjct: 385 GQMEAARSLGMTQGASMRYIILPQAVKNILPALGNEFVTVIKESSIVSVIGVTELMFMTG 444

Query: 338 VNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
           V    S       P   LI    ++++  FS+S      E+ +    
Sbjct: 445 VVQGAS-----FKPFIPLIITSLIYFVLTFSLSRLLGVAERRMRTSD 486


>gi|315283361|ref|ZP_07871572.1| His/Glu/Gln/Arg/opine ABC transporter permease [Listeria marthii
           FSL S4-120]
 gi|313613009|gb|EFR86940.1| His/Glu/Gln/Arg/opine ABC transporter permease [Listeria marthii
           FSL S4-120]
          Length = 486

 Score =  168 bits (425), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 63/227 (27%), Positives = 114/227 (50%), Gaps = 8/227 (3%)

Query: 158 FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFI 217
            +   G            G L+T+ ++  G++    LG LLAL + +    LR+    +I
Sbjct: 268 LMFQDGSFYEKYGNYFITGTLITIALAAIGVLCGAVLGSLLALMKLAKTRWLRWPAACYI 327

Query: 218 ELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISK 277
           E  RG PL+  +F+      +      DV   +   + +S  ++AY+AE++R G+ +++K
Sbjct: 328 EFVRGTPLLIQIFIVFFGTQII---GMDVSAFVSGCIALSLNSAAYVAEIIRAGISAVNK 384

Query: 278 GQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVR 337
           GQ EAA SLG++    MR II+PQ +K ++P + N F+ + K+SS++S+I + +L+ +  
Sbjct: 385 GQMEAARSLGMTQSASMRYIILPQAVKNILPALGNEFVTVIKESSIVSVIGVTELMFMTG 444

Query: 338 VNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
           V    S       P   LI    ++++  FS+S      E+ +    
Sbjct: 445 VVQGAS-----FKPFIPLIITSLIYFVLTFSLSRLLGVAERRMRTSD 486


>gi|314939959|ref|ZP_07847159.1| ABC transporter, permease protein [Enterococcus faecium TX0133a04]
 gi|314942568|ref|ZP_07849402.1| ABC transporter, permease protein [Enterococcus faecium TX0133C]
 gi|314947466|ref|ZP_07850881.1| ABC transporter, permease protein [Enterococcus faecium TX0082]
 gi|314952490|ref|ZP_07855491.1| ABC transporter, permease protein [Enterococcus faecium TX0133A]
 gi|314992413|ref|ZP_07857839.1| ABC transporter, permease protein [Enterococcus faecium TX0133B]
 gi|314996253|ref|ZP_07861312.1| ABC transporter, permease protein [Enterococcus faecium TX0133a01]
 gi|313589575|gb|EFR68420.1| ABC transporter, permease protein [Enterococcus faecium TX0133a01]
 gi|313593048|gb|EFR71893.1| ABC transporter, permease protein [Enterococcus faecium TX0133B]
 gi|313595396|gb|EFR74241.1| ABC transporter, permease protein [Enterococcus faecium TX0133A]
 gi|313598672|gb|EFR77517.1| ABC transporter, permease protein [Enterococcus faecium TX0133C]
 gi|313640793|gb|EFS05373.1| ABC transporter, permease protein [Enterococcus faecium TX0133a04]
 gi|313646016|gb|EFS10596.1| ABC transporter, permease protein [Enterococcus faecium TX0082]
          Length = 487

 Score =  168 bits (425), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 59/209 (28%), Positives = 114/209 (54%), Gaps = 7/209 (3%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
           L  GL  T++++     +++ +G++  L   + I  LR     ++++ RG+P++ + F  
Sbjct: 286 LLKGLWRTILLTLISFALAIVIGVIFGLFSVAPIRALRTIASIYVDIIRGIPMMVLAFFI 345

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
              LP      + +   L  ++ ++  ASAYIAE++RGG+ ++  GQ EA+ SLGLSY +
Sbjct: 346 FFGLP--GIVGFTIPDFLAGVITLTLNASAYIAEIVRGGINAVPVGQMEASRSLGLSYNR 403

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPT 352
            M+ II+PQ I+ +IP  VN F+   KD+++IS I + +LL   ++  + +        T
Sbjct: 404 TMQKIILPQAIRIMIPSFVNQFVISLKDTTIISAIGVVELLQTGKIIVART-----TQST 458

Query: 353 TGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
              + I  ++ I   +++  +  +EK + 
Sbjct: 459 YVYLIIAIMYLILITALTKLAKVLEKKVK 487


>gi|306831687|ref|ZP_07464844.1| glutamine ABC superfamily ATP binding cassette transporter permease
           protein [Streptococcus gallolyticus subsp. gallolyticus
           TX20005]
 gi|261411856|gb|ACX81324.1| Sbs9 [Streptococcus gallolyticus subsp. gallolyticus]
 gi|304426112|gb|EFM29227.1| glutamine ABC superfamily ATP binding cassette transporter permease
           protein [Streptococcus gallolyticus subsp. gallolyticus
           TX20005]
          Length = 745

 Score =  168 bits (425), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 55/223 (24%), Positives = 111/223 (49%), Gaps = 9/223 (4%)

Query: 163 GLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRG 222
              L    + L  GL  TL ++     I+M +GI+  +   +   VLR     F+++ RG
Sbjct: 528 WGLLKNNYSQLLSGLGKTLSLTLISFAIAMVIGIIFGMMAVAPNKVLRTISAVFVDIVRG 587

Query: 223 VPL-VTVLFMASIMLPLFLPD---TWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKG 278
           +PL +   F+   +  L          ++  + A + +S    AYIAE++RGG++++ +G
Sbjct: 588 IPLMIVAAFIFWGIPNLLESITGKQSPINDFVAATIALSLNGGAYIAEIVRGGIEAVPQG 647

Query: 279 QFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRV 338
           Q EA+ SLG+SY + M+ II+PQ ++ ++P  +N F+   KD++++S I + +L    ++
Sbjct: 648 QMEASRSLGISYSKTMQKIILPQAVRLMLPNFINQFVISLKDTTIVSAIGLVELFQTGKI 707

Query: 339 NFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
             +      +         +  ++ +    ++  +  +EK L 
Sbjct: 708 IIA-----RNYQSFRMYAILAVIYLVIITLLTRLAKRLEKRLK 745


>gi|255026707|ref|ZP_05298693.1| hypothetical protein LmonocytFSL_10867 [Listeria monocytogenes FSL
           J2-003]
          Length = 486

 Score =  168 bits (425), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 63/227 (27%), Positives = 114/227 (50%), Gaps = 8/227 (3%)

Query: 158 FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFI 217
            +   G            G L+T+ ++  G++    LG LLAL + +    LR+    +I
Sbjct: 268 LMFQDGSFYEKYGNYFVTGTLITIALAAIGVLCGAILGSLLALMKLAKTRWLRWPAACYI 327

Query: 218 ELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISK 277
           E  RG PL+  +F+      +      DV   +   + +S  ++AY+AE++R G+ +++K
Sbjct: 328 EFVRGTPLLIQIFIVFFGTQII---GMDVSAFVSGCIALSLNSAAYVAEIIRAGISAVNK 384

Query: 278 GQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVR 337
           GQ EAA SLG++    MR II+PQ +K ++P + N F+ + K+SS++S+I + +L+ +  
Sbjct: 385 GQMEAARSLGMTQSASMRYIILPQAVKNILPALGNEFVTVIKESSIVSVIGVTELMFMTG 444

Query: 338 VNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
           V    S       P   LI    ++++  FS+S      E+ +    
Sbjct: 445 VVQGAS-----FKPFIPLIITSLIYFVLTFSLSRLLGVAERRMRTSD 486


>gi|254826861|ref|ZP_05231548.1| his/Glu/Gln/Arg/opine ABC transporter permease [Listeria
           monocytogenes FSL N3-165]
 gi|258599240|gb|EEW12565.1| his/Glu/Gln/Arg/opine ABC transporter permease [Listeria
           monocytogenes FSL N3-165]
          Length = 486

 Score =  168 bits (425), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 63/227 (27%), Positives = 114/227 (50%), Gaps = 8/227 (3%)

Query: 158 FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFI 217
            +   G            G L+T+ ++  G++    LG LLAL + +    LR+    +I
Sbjct: 268 LMFQDGSFYEKYGNYFITGTLITIALAAIGVLCGAILGSLLALMKLAKTRWLRWPAACYI 327

Query: 218 ELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISK 277
           E  RG PL+  +F+      +      DV   +   + +S  ++AY+AE++R G+ +++K
Sbjct: 328 EFVRGTPLLIQIFIVFFGTQII---GMDVSAFVSGCIALSLNSAAYVAEIIRAGISAVNK 384

Query: 278 GQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVR 337
           GQ EAA SLG++    MR II+PQ +K ++P + N F+ + K+SS++S+I + +L+ +  
Sbjct: 385 GQMEAARSLGMTQGASMRYIILPQAVKNILPALGNEFVTVIKESSIVSVIGVTELMFMTG 444

Query: 338 VNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
           V    S       P   LI    ++++  FS+S      E+ +    
Sbjct: 445 VVQGAS-----FKPFIPLIITSLIYFVLTFSLSRLLGVAERRMRTSD 486


>gi|22537609|ref|NP_688460.1| glutamine ABC transporter, glutamine-binding protein/permease
           protein [Streptococcus agalactiae 2603V/R]
 gi|25011575|ref|NP_735970.1| glutamine ABC transporter permease and substrate binding protein
           [Streptococcus agalactiae NEM316]
 gi|76797646|ref|ZP_00779916.1| glutamine ABC transporter permease and substrate binding protein
           [Streptococcus agalactiae 18RS21]
 gi|77405223|ref|ZP_00782321.1| amino acid ABC transporter, amino acid-binding/permease protein
           [Streptococcus agalactiae H36B]
 gi|77414125|ref|ZP_00790292.1| amino acid ABC transporter, amino acid-binding/permease protein
           [Streptococcus agalactiae 515]
 gi|22534494|gb|AAN00333.1|AE014259_4 glutamine ABC transporter, glutamine-binding protein/permease
           protein [Streptococcus agalactiae 2603V/R]
 gi|24413114|emb|CAD47192.1| glutamine ABC transporter permease and substrate binding protein
           [Streptococcus agalactiae NEM316]
 gi|76587007|gb|EAO63495.1| glutamine ABC transporter permease and substrate binding protein
           [Streptococcus agalactiae 18RS21]
 gi|77159836|gb|EAO70980.1| amino acid ABC transporter, amino acid-binding/permease protein
           [Streptococcus agalactiae 515]
 gi|77176225|gb|EAO78996.1| amino acid ABC transporter, amino acid-binding/permease protein
           [Streptococcus agalactiae H36B]
          Length = 727

 Score =  168 bits (425), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 52/213 (24%), Positives = 108/213 (50%), Gaps = 9/213 (4%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPL-VTVLFM 231
           L  G+  TL ++     I+M +GI+  +   S    LR   + F+++ RG+PL +   F+
Sbjct: 520 LLSGIGTTLSLTLISFAIAMVIGIIFGMMSVSPSNTLRTISMIFVDIVRGIPLMIVAAFI 579

Query: 232 ASIMLPLFLP---DTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGL 288
              +  L          ++  + A + +S    AYIAE++RGG++++  GQ EA+ SLG+
Sbjct: 580 FWGIPNLIESITGHQSPINDFVAATIALSLNGGAYIAEIVRGGIEAVPSGQMEASRSLGI 639

Query: 289 SYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISS 348
           SY + M+ +I+PQ ++ ++P  +N F+   KD++++S I + +L    ++  +      +
Sbjct: 640 SYGKTMQKVILPQAVRLMLPNFINQFVISLKDTTIVSAIGLVELFQTGKIIIA-----RN 694

Query: 349 VTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
                    +  ++ +    ++  +  +EK L 
Sbjct: 695 YQSFRMYAILAIMYLVIITLLTRLAKRLEKRLK 727


>gi|46908483|ref|YP_014872.1| His/Glu/Gln/Arg/opine ABC transporter permease [Listeria
           monocytogenes str. 4b F2365]
 gi|226224858|ref|YP_002758965.1| amino acid ABC transporter, permease protein [Listeria
           monocytogenes Clip81459]
 gi|254825186|ref|ZP_05230187.1| his/Glu/Gln/Arg/opine ABC transporter permease [Listeria
           monocytogenes FSL J1-194]
 gi|254931637|ref|ZP_05264996.1| his/Glu/Gln/Arg/opine ABC transporter permease [Listeria
           monocytogenes HPB2262]
 gi|254992059|ref|ZP_05274249.1| amino acid ABC transporter, permease protein [Listeria
           monocytogenes FSL J2-064]
 gi|255519729|ref|ZP_05386966.1| amino acid ABC transporter, permease protein [Listeria
           monocytogenes FSL J1-175]
 gi|46881754|gb|AAT05049.1| amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine
           family [Listeria monocytogenes serotype 4b str. F2365]
 gi|225877320|emb|CAS06034.1| Putative amino acid ABC transporter, permease protein [Listeria
           monocytogenes serotype 4b str. CLIP 80459]
 gi|293583191|gb|EFF95223.1| his/Glu/Gln/Arg/opine ABC transporter permease [Listeria
           monocytogenes HPB2262]
 gi|293594430|gb|EFG02191.1| his/Glu/Gln/Arg/opine ABC transporter permease [Listeria
           monocytogenes FSL J1-194]
 gi|328465831|gb|EGF37019.1| amino acid ABC transporter, permease protein [Listeria
           monocytogenes 1816]
 gi|328472142|gb|EGF43017.1| amino acid ABC transporter, permease protein [Listeria
           monocytogenes 220]
          Length = 486

 Score =  168 bits (425), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 63/227 (27%), Positives = 114/227 (50%), Gaps = 8/227 (3%)

Query: 158 FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFI 217
            +   G            G L+T+ ++  G++    LG LLAL + +    LR+    +I
Sbjct: 268 LMFQDGSFYEKYGNYFITGTLITIALAAIGVLCGAILGSLLALMKLAKTRWLRWPAACYI 327

Query: 218 ELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISK 277
           E  RG PL+  +F+      +      DV   +   + +S  ++AY+AE++R G+ +++K
Sbjct: 328 EFVRGTPLLIQIFIVFFGTQII---GMDVSAFVSGCIALSLNSAAYVAEIIRAGISAVNK 384

Query: 278 GQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVR 337
           GQ EAA SLG++    MR II+PQ +K ++P + N F+ + K+SS++S+I + +L+ +  
Sbjct: 385 GQMEAARSLGMTQGASMRYIILPQAVKNILPALGNEFVTVIKESSIVSVIGVTELMFMTG 444

Query: 338 VNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
           V    S       P   LI    ++++  FS+S      E+ +    
Sbjct: 445 VVQGAS-----FKPFIPLIITSLIYFVLTFSLSRLLGVAERRMRTSD 486


>gi|319745422|gb|EFV97729.1| glutamine ABC superfamily ATP binding cassette transporter,
           membrane protein [Streptococcus agalactiae ATCC 13813]
          Length = 727

 Score =  167 bits (424), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 52/213 (24%), Positives = 108/213 (50%), Gaps = 9/213 (4%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPL-VTVLFM 231
           L  G+  TL ++     I+M +GI+  +   S    LR   + F+++ RG+PL +   F+
Sbjct: 520 LLSGIGTTLSLTLISFAIAMVIGIIFGMMSVSPSNTLRTISMIFVDVVRGIPLMIVAAFI 579

Query: 232 ASIMLPLFLP---DTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGL 288
              +  L          ++  + A + +S    AYIAE++RGG++++  GQ EA+ SLG+
Sbjct: 580 FWGIPNLIESITGHQSPINDFVAATIALSLNGGAYIAEIVRGGIEAVPSGQMEASRSLGI 639

Query: 289 SYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISS 348
           SY + M+ +I+PQ ++ ++P  +N F+   KD++++S I + +L    ++  +      +
Sbjct: 640 SYGKTMQKVILPQAVRLMLPNFINQFVISLKDTTIVSAIGLVELFQTGKIIIA-----RN 694

Query: 349 VTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
                    +  ++ +    ++  +  +EK L 
Sbjct: 695 YQSFRMYAILAIMYLVIITLLTRLAKRLEKRLK 727


>gi|76788581|ref|YP_330104.1| polar amino acid ABC transporter permease/substrate-binding protein
           [Streptococcus agalactiae A909]
 gi|76563638|gb|ABA46222.1| polar amino acid uptake (PAAT) family ABC transporter,
           substrate-binding/permease protein [Streptococcus
           agalactiae A909]
          Length = 727

 Score =  167 bits (424), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 52/213 (24%), Positives = 108/213 (50%), Gaps = 9/213 (4%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPL-VTVLFM 231
           L  G+  TL ++     I+M +GI+  +   S    LR   + F+++ RG+PL +   F+
Sbjct: 520 LLSGIGTTLSLTLISFAIAMVIGIIFGMMSVSPSNTLRTISMIFVDVVRGIPLMIVAAFI 579

Query: 232 ASIMLPLFLP---DTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGL 288
              +  L          ++  + A + +S    AYIAE++RGG++++  GQ EA+ SLG+
Sbjct: 580 FWGIPNLIESITGHQSPINDFVAATIALSLNGGAYIAEIVRGGIEAVPSGQMEASRSLGI 639

Query: 289 SYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISS 348
           SY + M+ +I+PQ ++ ++P  +N F+   KD++++S I + +L    ++  +      +
Sbjct: 640 SYGKTMQKVILPQAVRLMLPNFINQFVISLKDTTIVSAIGLVELFQTGKIIIA-----RN 694

Query: 349 VTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
                    +  ++ +    ++  +  +EK L 
Sbjct: 695 YQSFRMYAILAIMYLVIITLLTRLAKRLEKRLK 727


>gi|77411077|ref|ZP_00787431.1| amino acid ABC transporter, amino acid-binding/permease protein
           [Streptococcus agalactiae CJB111]
 gi|77162900|gb|EAO73857.1| amino acid ABC transporter, amino acid-binding/permease protein
           [Streptococcus agalactiae CJB111]
          Length = 727

 Score =  167 bits (424), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 52/213 (24%), Positives = 108/213 (50%), Gaps = 9/213 (4%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPL-VTVLFM 231
           L  G+  TL ++     I+M +GI+  +   S    LR   + F+++ RG+PL +   F+
Sbjct: 520 LLSGIGTTLSLTLISFAIAMVIGIIFGMMSVSPSNTLRTISMIFVDVVRGIPLMIVAAFI 579

Query: 232 ASIMLPLFLP---DTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGL 288
              +  L          ++  + A + +S    AYIAE++RGG++++  GQ EA+ SLG+
Sbjct: 580 FWGIPNLIESITGHQSPINDFVAATIALSLNGGAYIAEIVRGGIEAVPSGQMEASRSLGI 639

Query: 289 SYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISS 348
           SY + M+ +I+PQ ++ ++P  +N F+   KD++++S I + +L    ++  +      +
Sbjct: 640 SYGKTMQKVILPQAVRLMLPNFINQFVISLKDTTIVSAIGLVELFQTGKIIIA-----RN 694

Query: 349 VTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
                    +  ++ +    ++  +  +EK L 
Sbjct: 695 YQSFRMYAILAIMYLVIITLLTRLAKRLEKRLK 727


>gi|111022633|ref|YP_705605.1| glutamine transport system permease protein [Rhodococcus jostii
           RHA1]
 gi|110822163|gb|ABG97447.1| probable glutamine transport system permease protein [Rhodococcus
           jostii RHA1]
          Length = 489

 Score =  167 bits (424), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 66/210 (31%), Positives = 119/210 (56%), Gaps = 7/210 (3%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
           L  GL +T+V++   I I++ LG +  L R S   VLR    T++++FRG PL+   F  
Sbjct: 287 LLEGLWLTIVLTVVSIAIALVLGAIFGLFRVSTNIVLRGIGTTYVDVFRGTPLLVQAFFI 346

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
              +P      + +      ++ +S  A AY+AE++RGG+ S+ KGQ EA+ SLG+SYL+
Sbjct: 347 YFGIP--AALDFQMSAFTAGIITLSLNAGAYMAEIVRGGILSVDKGQMEASRSLGISYLK 404

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPT 352
            M+ ++MPQ ++ +IP  +N F+   KD+S++S+I + +L    R+  +      +    
Sbjct: 405 SMQKVVMPQAVRTMIPSYINQFVITLKDTSILSVIGLAELTQTGRIIIA-----RNFQSF 459

Query: 353 TGLIFIGFVFWIFCFSISLYSVFIEKTLHK 382
              + IG +++I   +++  S  +EK ++K
Sbjct: 460 NMWLIIGVMYFIIIMALTKLSNRLEKRINK 489


>gi|70726105|ref|YP_253019.1| hypothetical protein SH1104 [Staphylococcus haemolyticus JCSC1435]
 gi|68446829|dbj|BAE04413.1| unnamed protein product [Staphylococcus haemolyticus JCSC1435]
          Length = 484

 Score =  167 bits (424), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 64/214 (29%), Positives = 107/214 (50%), Gaps = 7/214 (3%)

Query: 171 TSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLF 230
           T    GL  T++IS  G++    +G  +AL + S   ++      +IE  RG P++  +F
Sbjct: 278 TFFLKGLQNTIIISLIGVVCGAIIGSFIALAKLSKFKIISLPATIYIEFLRGTPMLVQVF 337

Query: 231 MASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSY 290
           +             D+  L+   + +   +SAYIAE++R G+ ++ KGQ EAA  LGL+Y
Sbjct: 338 IVF--FGTTALLGLDISALICGTIALVINSSAYIAEIIRAGINAVDKGQTEAAQCLGLNY 395

Query: 291 LQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVT 350
            + M  II+PQ  K ++P + N F+ L K+SS+IS I + +++   +V    S       
Sbjct: 396 SKTMIHIILPQAFKNILPALGNEFVTLIKESSIISTIGVGEIMFNAQVVQGIS-----FD 450

Query: 351 PTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
           P T LI    ++++  F +S     IE  L    
Sbjct: 451 PFTPLIIAACMYFVLTFLLSRLMSLIEGRLKASD 484


>gi|300763939|ref|ZP_07073935.1| His/Glu/Gln/Arg/opine family amino acid ABC transporter [Listeria
           monocytogenes FSL N1-017]
 gi|300515280|gb|EFK42331.1| His/Glu/Gln/Arg/opine family amino acid ABC transporter [Listeria
           monocytogenes FSL N1-017]
          Length = 486

 Score =  167 bits (424), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 63/227 (27%), Positives = 114/227 (50%), Gaps = 8/227 (3%)

Query: 158 FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFI 217
            +   G            G L+T+ ++  G++    LG LLAL + +    LR+    +I
Sbjct: 268 LMFQDGSFYEKYGNYFITGTLITIALAAIGVLCGAILGSLLALMKLAKTRWLRWPAACYI 327

Query: 218 ELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISK 277
           E  RG PL+  +F+      +      DV   +   + +S  ++AY+AE++R G+ +++K
Sbjct: 328 EFVRGTPLLIQIFIVFFGTQII---GMDVSAFVSGCIALSLNSAAYVAEIIRAGISAVNK 384

Query: 278 GQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVR 337
           GQ EAA SLG++    MR II+PQ +K ++P + N F+ + K+SS++S+I + +L+ +  
Sbjct: 385 GQMEAARSLGMTQGASMRYIILPQAVKNILPALGNEFVTVIKESSIVSVIGVTELMFMTG 444

Query: 338 VNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
           V    S       P   LI    ++++  FS+S      E+ +    
Sbjct: 445 VVQGAS-----FKPFIPLIITSLIYFVLTFSLSRLLGVAERRMRTSD 486


>gi|308067589|ref|YP_003869194.1| Glutamine transport system permease protein glnP [Paenibacillus
           polymyxa E681]
 gi|305856868|gb|ADM68656.1| Glutamine transport system permease protein glnP [Paenibacillus
           polymyxa E681]
          Length = 482

 Score =  167 bits (424), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 61/222 (27%), Positives = 113/222 (50%), Gaps = 7/222 (3%)

Query: 162 GGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFR 221
               +S    SL  G+  TL+ +   ++++  LG++    + S+  V R     F+++FR
Sbjct: 268 RWGLISASLPSLIKGMGNTLLYTLVSLLVAFILGLVFGFMKVSHNKVFRGIATVFVDIFR 327

Query: 222 GVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFE 281
           G+PL+ + F     +P      + +   + A+L +S  A AY+ E++RGG+QSI  GQ E
Sbjct: 328 GIPLIVLAFFIYFGIPQ--ALDFKMPLFVAAVLTLSLNAGAYVTEIIRGGIQSIDPGQME 385

Query: 282 AANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFS 341
           AA SLGL Y   M  II+PQ +K +IP  +N  +   KD+S++S+I + +L    ++  +
Sbjct: 386 AARSLGLPYRTAMLKIILPQAVKIMIPSFINQLVITLKDTSILSVIGLVELTQSGKIIIA 445

Query: 342 ESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKG 383
            +            + +  ++ I    ++  S  +E  + +G
Sbjct: 446 RT-----FQSFDIWLVVAVMYLIVITVLTKISNRLEGRVRRG 482


>gi|306833827|ref|ZP_07466952.1| glutamine ABC superfamily ATP binding cassette transporter,
           membrane protein [Streptococcus bovis ATCC 700338]
 gi|304424021|gb|EFM27162.1| glutamine ABC superfamily ATP binding cassette transporter,
           membrane protein [Streptococcus bovis ATCC 700338]
          Length = 739

 Score =  167 bits (424), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 56/223 (25%), Positives = 111/223 (49%), Gaps = 9/223 (4%)

Query: 163 GLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRG 222
              L    + L  GL  TL ++     I+M +GI+  +   +   VLR     F+++ RG
Sbjct: 522 WGLLKNNYSQLLAGLGKTLSLTLISFAIAMVIGIIFGMMAVAPNKVLRTISAVFVDIVRG 581

Query: 223 VPL-VTVLFMASIMLPLFLP---DTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKG 278
           +PL +   F+   +  L          ++  + A + +S    AYIAE++RGG++++ +G
Sbjct: 582 IPLMIVAAFIFWGIPNLLESITGRQSPINDFVAATIALSLNGGAYIAEIVRGGIEAVPQG 641

Query: 279 QFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRV 338
           Q EA+ SLG+SY + M+ II+PQ I+ ++P  +N F+   KD++++S I + +L    ++
Sbjct: 642 QMEASRSLGISYGKTMQKIILPQAIRLMLPNFINQFVISLKDTTIVSAIGLVELFQTGKI 701

Query: 339 NFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
             +      +         +  ++ +    ++  +  +EK L 
Sbjct: 702 IIA-----RNYQSFRVYAILAVIYLVMITLLTRLAKRLEKRLK 739


>gi|329724901|gb|EGG61404.1| ABC transporter, permease protein [Staphylococcus epidermidis
           VCU144]
          Length = 487

 Score =  167 bits (424), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 64/212 (30%), Positives = 114/212 (53%), Gaps = 7/212 (3%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
              G+  T++IS  G+++   LG  +AL + S I  L+     +IE  RG P++  +F+ 
Sbjct: 281 FIKGIKNTILISLVGVVLGSILGSFIALLKISKIRPLQLIASIYIEFLRGTPMLVQVFIV 340

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
                       D+  L+   + +   +SAYIAE++R G+ ++ KGQ EAA SLGL+Y Q
Sbjct: 341 F--FGTTAALGLDISALICGTIALVINSSAYIAEIIRAGINAVDKGQTEAARSLGLNYRQ 398

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPT 352
            M+ ++MPQ IK+++P + N F+ L K+SS++S I + +++   +V    S       P 
Sbjct: 399 TMQSVVMPQAIKKILPALGNEFVTLIKESSIVSTIGVSEIMFNAQVVQGIS-----FDPF 453

Query: 353 TGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
           T L+    ++++  F+++    FIE  +    
Sbjct: 454 TPLLVAALLYFLLTFALTRVMNFIEGRMSASD 485


>gi|154248468|ref|YP_001419426.1| polar amino acid ABC transporter, inner membrane subunit
           [Xanthobacter autotrophicus Py2]
 gi|154162553|gb|ABS69769.1| polar amino acid ABC transporter, inner membrane subunit
           [Xanthobacter autotrophicus Py2]
          Length = 473

 Score =  167 bits (424), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 125/237 (52%), Positives = 170/237 (71%)

Query: 149 FGLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPV 208
             +      F +   +GL  VET LWGGLLVTLVI+  GI +S+P GILLALGR S +P+
Sbjct: 236 VFVLLGLVIFAMDIDVGLPQVETRLWGGLLVTLVIAVTGITVSLPFGILLALGRRSKLPL 295

Query: 209 LRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVL 268
           ++   I FIE +RGVPL+TVLF A+ MLPLFLP    +D LLRAL+GV+ FASAY+AEV+
Sbjct: 296 VKALSIIFIEFWRGVPLITVLFFATYMLPLFLPGRLTIDGLLRALVGVALFASAYMAEVV 355

Query: 269 RGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIIN 328
           RGGLQ+I KGQ+E A ++GL     +RL+++PQ +K VIPGIVN FIGLFKD++L+ I++
Sbjct: 356 RGGLQAIPKGQYEGAMAVGLPSSLMLRLVVLPQALKLVIPGIVNNFIGLFKDTTLVLIVS 415

Query: 329 MFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSK 385
           +FDLLG +R  F++  W S  T  TG  F G ++++FCF +S YS+ +EK L +  +
Sbjct: 416 IFDLLGSMRAAFTDPNWASPTTLFTGFGFAGIIYFVFCFGMSRYSMALEKRLDRAQR 472



 Score =  102 bits (253), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 56/151 (37%), Positives = 85/151 (56%), Gaps = 5/151 (3%)

Query: 9   PYVRKRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDA 68
            YV   L +    PV  RG + W+ K+  G+   +LLT   I L+  ++P +I +  +DA
Sbjct: 18  AYVSTTLREQEPAPVATRGPVLWVRKHLVGSVPQVLLTLFGIWLVYVTVPPMIKFFLIDA 77

Query: 69  VWIGSNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSI 128
           VW G+NR  C     G         ACW F++ + +Q I+G YP ++RWR  +V+  G I
Sbjct: 78  VWTGANREACLPEKVGRAV-----GACWPFVWAKLDQLIYGFYPASERWRVNVVYALGVI 132

Query: 129 LLTPMLIPSFPRKFLNSILLFGLFPIFSFFV 159
           LL P+LI   P K LN+IL FG++P+ +F +
Sbjct: 133 LLLPLLIQKLPGKRLNAILFFGIYPVVAFVL 163


>gi|290893601|ref|ZP_06556583.1| His/Glu/Gln/Arg/opine ABC transporter permease [Listeria
           monocytogenes FSL J2-071]
 gi|290556803|gb|EFD90335.1| His/Glu/Gln/Arg/opine ABC transporter permease [Listeria
           monocytogenes FSL J2-071]
          Length = 486

 Score =  167 bits (424), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 63/227 (27%), Positives = 114/227 (50%), Gaps = 8/227 (3%)

Query: 158 FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFI 217
            +   G            G L+T+ ++  G++    LG LLAL + +    LR+    +I
Sbjct: 268 LMFQDGSFYEKYGNYFITGTLITIALAAIGVLCGAILGSLLALMKLAKTRWLRWPAACYI 327

Query: 218 ELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISK 277
           E  RG PL+  +F+      +      DV   +   + +S  ++AY+AE++R G+ +++K
Sbjct: 328 EFVRGTPLLIQIFIVFFGTQII---GMDVSAFVSGCIALSLNSAAYVAEIIRAGISAVNK 384

Query: 278 GQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVR 337
           GQ EAA SLG++    MR II+PQ +K ++P + N F+ + K+SS++S+I + +L+ +  
Sbjct: 385 GQMEAARSLGMTQGASMRYIILPQAVKNILPALGNEFVTVIKESSIVSVIGVTELMFMTG 444

Query: 338 VNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
           V    S       P   LI    ++++  FS+S      E+ +    
Sbjct: 445 VVQGAS-----FKPFIPLIITSLIYFVLTFSLSRLLGVAERRMRTSD 486


>gi|14211227|gb|AAK57382.1|AF372619_1 GlnP [Streptococcus agalactiae COH1]
          Length = 727

 Score =  167 bits (424), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 52/213 (24%), Positives = 108/213 (50%), Gaps = 9/213 (4%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPL-VTVLFM 231
           L  G+  TL ++     I+M +GI+  +   S    LR   + F+++ RG+PL +   F+
Sbjct: 520 LLSGIGTTLSLTLISFAIAMVIGIIFGMMSVSPSNTLRTISMIFVDIVRGIPLMIVAAFI 579

Query: 232 ASIMLPLFLP---DTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGL 288
              +  L          ++  + A + +S    AYIAE++RGG++++  GQ EA+ SLG+
Sbjct: 580 FWGIPNLIESITGHQSPINDFVAATIALSLNGGAYIAEIVRGGIEAVPSGQMEASRSLGI 639

Query: 289 SYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISS 348
           SY + M+ +I+PQ ++ ++P  +N F+   KD++++S I + +L    ++  +      +
Sbjct: 640 SYGKTMQKVILPQAVRLMLPNFINQFVISLKDTTIVSAIGLVELFQTGKIIIA-----RN 694

Query: 349 VTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
                    +  ++ +    ++  +  +EK L 
Sbjct: 695 YQSFRMYAILAIMYLVIITLLTRLAKRLEKRLK 727


>gi|313607306|gb|EFR83728.1| His/Glu/Gln/Arg/opine ABC transporter permease [Listeria
           monocytogenes FSL F2-208]
          Length = 486

 Score =  167 bits (423), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 63/227 (27%), Positives = 114/227 (50%), Gaps = 8/227 (3%)

Query: 158 FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFI 217
            +   G            G L+T+ ++  G++    LG LLAL + +    LR+    +I
Sbjct: 268 LMFQDGSFYEKYGNYFITGTLITIALAAIGVLCGAILGSLLALMKLAKTRWLRWPAACYI 327

Query: 218 ELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISK 277
           E  RG PL+  +F+      +      DV   +   + +S  ++AY+AE++R G+ +++K
Sbjct: 328 EFVRGTPLLIQIFIVFFGTQII---GMDVSAFVSGCIALSLNSAAYVAEIIRAGISAVNK 384

Query: 278 GQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVR 337
           GQ EAA SLG++    MR II+PQ +K ++P + N F+ + K+SS++S+I + +L+ +  
Sbjct: 385 GQMEAARSLGMTQGASMRYIILPQAVKNILPALGNEFVTVIKESSIVSVIGVTELMFMTG 444

Query: 338 VNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
           V    S       P   LI    ++++  FS+S      E+ +    
Sbjct: 445 VVQGAS-----FKPFIPLIITSLIYFVLTFSLSRLLGVAERRMRTSD 486


>gi|312869117|ref|ZP_07729291.1| ABC transporter, permease protein [Lactobacillus oris PB013-T2-3]
 gi|311095363|gb|EFQ53633.1| ABC transporter, permease protein [Lactobacillus oris PB013-T2-3]
          Length = 502

 Score =  167 bits (423), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 62/214 (28%), Positives = 107/214 (50%), Gaps = 8/214 (3%)

Query: 171 TSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLF 230
           T    G+  TL+I+   +I    LG L AL R S   +L    I +IE  RG P++  + 
Sbjct: 297 TFFAKGVEYTLIITVISVIFGFLLGTLFALMRLSQSKLLHGIAICYIEFIRGTPMLVQIM 356

Query: 231 MASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSY 290
                +   +     +  L+  ++ VS  + AY+AEV+R G+QS+  GQ EAA SLG++ 
Sbjct: 357 FVYFGIGAII---QSMPALVAGIIAVSVNSGAYVAEVIRSGIQSLPIGQTEAARSLGMTK 413

Query: 291 LQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVT 350
            Q  R I++PQ ++ + P + N FI L KDSSL+S I + +L+   ++  +++       
Sbjct: 414 KQTFRFIVLPQALRNIWPALGNEFITLLKDSSLVSTIGVGELMYQTQLVQADT-----YK 468

Query: 351 PTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
               L     +++I  F+++    + E  +    
Sbjct: 469 GVLPLFITMMIYFILTFTLTRILNYFEGRMQHAH 502


>gi|325978626|ref|YP_004288342.1| amino acid ABC transporter amino acid-binding/permease
           [Streptococcus gallolyticus subsp. gallolyticus ATCC
           BAA-2069]
 gi|325178554|emb|CBZ48598.1| amino acid ABC transporter, amino acid-binding/permease protein
           [Streptococcus gallolyticus subsp. gallolyticus ATCC
           BAA-2069]
          Length = 745

 Score =  167 bits (423), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 55/223 (24%), Positives = 111/223 (49%), Gaps = 9/223 (4%)

Query: 163 GLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRG 222
              L    + L  GL  TL ++     I+M +GI+  +   +   VLR     F+++ RG
Sbjct: 528 WGLLKNNYSQLLSGLGKTLSLTLISFAIAMVIGIIFGMMAVAPNKVLRTISAVFVDIVRG 587

Query: 223 VPL-VTVLFMASIMLPLFLPD---TWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKG 278
           +PL +   F+   +  L          ++  + A + +S    AYIAE++RGG++++ +G
Sbjct: 588 IPLMIVAAFIFWGIPNLLESITGKQSPINDFVAATIALSLNGGAYIAEIVRGGIEAVPQG 647

Query: 279 QFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRV 338
           Q EA+ SLG+SY + M+ II+PQ ++ ++P  +N F+   KD++++S I + +L    ++
Sbjct: 648 QMEASRSLGISYSKTMQKIILPQAVRLMLPNFINQFVISLKDTTIVSAIGLVELFQTGKI 707

Query: 339 NFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
             +      +         +  ++ +    ++  +  +EK L 
Sbjct: 708 IIA-----RNYQSFRMYAILAVIYLVMITLLTRLAKRLEKRLK 745


>gi|319946946|ref|ZP_08021180.1| glutamine ABC superfamily ATP binding cassette transporter,
           membrane protein [Streptococcus australis ATCC 700641]
 gi|319746994|gb|EFV99253.1| glutamine ABC superfamily ATP binding cassette transporter,
           membrane protein [Streptococcus australis ATCC 700641]
          Length = 754

 Score =  167 bits (423), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 59/223 (26%), Positives = 110/223 (49%), Gaps = 9/223 (4%)

Query: 163 GLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRG 222
              L      L  GL VT+ ++     I+M +GI+  +   S    LR+    F+++ RG
Sbjct: 537 WGLLQNNYKQLLSGLGVTIALALLSFAIAMVIGIIFGMFSVSPYKWLRWTAEIFVDVIRG 596

Query: 223 VPL-VTVLFMASIMLPLFLP---DTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKG 278
           +PL +   F+   +  L          ++  L   + +S  A+AYIAE++RGG+Q++  G
Sbjct: 597 IPLMILAAFIFWGIPNLIESMTGHQSPINDFLAGTIALSLNAAAYIAEIVRGGIQAVPAG 656

Query: 279 QFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRV 338
           Q EA+ SLG+SY + MR II+PQ  K ++P  VN F+   KD++++S I + +L    ++
Sbjct: 657 QMEASRSLGISYSKTMRKIILPQATKLMLPNFVNQFVIALKDTTIVSAIGLVELFQTGKI 716

Query: 339 NFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
             +      +         +   + +    ++ ++  +EK  +
Sbjct: 717 IIA-----RNYQSFKMYAILAVFYLVIITLLTRFAKRLEKRAN 754


>gi|293568103|ref|ZP_06679440.1| glutamine ABC transporter, permease/substrate-binding protein
           [Enterococcus faecium E1071]
 gi|294617429|ref|ZP_06697063.1| glutamine ABC transporter, permease/substrate-binding protein
           [Enterococcus faecium E1679]
 gi|291589185|gb|EFF20996.1| glutamine ABC transporter, permease/substrate-binding protein
           [Enterococcus faecium E1071]
 gi|291596335|gb|EFF27594.1| glutamine ABC transporter, permease/substrate-binding protein
           [Enterococcus faecium E1679]
          Length = 500

 Score =  167 bits (423), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 59/209 (28%), Positives = 114/209 (54%), Gaps = 7/209 (3%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
           L  GL  T++++     +++ +G++  L   + I  LR     ++++ RG+P++ + F  
Sbjct: 299 LLKGLWRTILLTLISFALAIVIGVIFGLFSVAPIRALRTIASIYVDIIRGIPMMVLAFFI 358

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
              LP      + +   L  ++ ++  ASAYIAE++RGG+ ++  GQ EA+ SLGLSY +
Sbjct: 359 FFGLP--GIVGFTIPDFLAGVITLTLNASAYIAEIVRGGINAVPVGQMEASRSLGLSYNR 416

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPT 352
            M+ II+PQ I+ +IP  VN F+   KD+++IS I + +LL   ++  + +        T
Sbjct: 417 TMQKIILPQAIRIMIPSFVNQFVISLKDTTIISAIGVVELLQTGKIIVART-----TQST 471

Query: 353 TGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
              + I  ++ I   +++  +  +EK + 
Sbjct: 472 YVYLIIAIMYLILITALTKLAKVLEKKVK 500


>gi|16801415|ref|NP_471683.1| hypothetical protein lin2352 [Listeria innocua Clip11262]
 gi|16414875|emb|CAC97579.1| lin2352 [Listeria innocua Clip11262]
          Length = 486

 Score =  167 bits (423), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 63/227 (27%), Positives = 114/227 (50%), Gaps = 8/227 (3%)

Query: 158 FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFI 217
            +   G            G L+T+ ++  G++    LG LLAL + +    LR+    +I
Sbjct: 268 LMFQDGSFYEKYGNYFITGTLITIALAAIGVLCGAILGSLLALMKLAKTRWLRWPAACYI 327

Query: 218 ELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISK 277
           E  RG PL+  +F+      +      DV   +   + +S  ++AY+AE++R G+ +++K
Sbjct: 328 EFVRGTPLLIQIFIVFFGTQII---GMDVSAFVSGCIALSLNSAAYVAEIIRAGISAVNK 384

Query: 278 GQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVR 337
           GQ EAA SLG++    MR II+PQ +K ++P + N F+ + K+SS++S+I + +L+ +  
Sbjct: 385 GQMEAARSLGMTQGASMRYIILPQAVKNILPALGNEFVTVIKESSIVSVIGVTELMFMTG 444

Query: 338 VNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
           V    S       P   LI    ++++  FS+S      E+ +    
Sbjct: 445 VVQGAS-----FKPFIPLIITSLIYFVLTFSLSRLLGVAERRMRTSD 486


>gi|69248956|ref|ZP_00604829.1| Amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine [Enterococcus faecium DO]
 gi|258615978|ref|ZP_05713748.1| amino acid ABC transporter, amino acid-binding/permease protein
           [Enterococcus faecium DO]
 gi|293557298|ref|ZP_06675844.1| glutamine ABC transporter, permease/substrate-binding protein
           [Enterococcus faecium E1039]
 gi|293560170|ref|ZP_06676672.1| glutamine ABC transporter, permease/substrate-binding protein
           [Enterococcus faecium E1162]
 gi|294616498|ref|ZP_06696279.1| glutamine ABC transporter, permease/substrate-binding protein
           [Enterococcus faecium E1636]
 gi|294621567|ref|ZP_06700733.1| glutamine ABC transporter, permease/substrate-binding protein
           [Enterococcus faecium U0317]
 gi|68194329|gb|EAN08842.1| Amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine [Enterococcus faecium DO]
 gi|291590646|gb|EFF22374.1| glutamine ABC transporter, permease/substrate-binding protein
           [Enterococcus faecium E1636]
 gi|291598872|gb|EFF29923.1| glutamine ABC transporter, permease/substrate-binding protein
           [Enterococcus faecium U0317]
 gi|291600550|gb|EFF30856.1| glutamine ABC transporter, permease/substrate-binding protein
           [Enterococcus faecium E1039]
 gi|291605842|gb|EFF35274.1| glutamine ABC transporter, permease/substrate-binding protein
           [Enterococcus faecium E1162]
          Length = 500

 Score =  167 bits (423), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 59/209 (28%), Positives = 114/209 (54%), Gaps = 7/209 (3%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
           L  GL  T++++     +++ +G++  L   + I  LR     ++++ RG+P++ + F  
Sbjct: 299 LLKGLWRTILLTLISFALAIVIGVIFGLFSVAPIRALRTIASIYVDIIRGIPMMVLAFFI 358

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
              LP      + +   L  ++ ++  ASAYIAE++RGG+ ++  GQ EA+ SLGLSY +
Sbjct: 359 FFGLP--GIVGFTIPDFLAGVITLTLNASAYIAEIVRGGINAVPVGQMEASRSLGLSYNR 416

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPT 352
            M+ II+PQ I+ +IP  VN F+   KD+++IS I + +LL   ++  + +        T
Sbjct: 417 TMQKIILPQAIRIMIPSFVNQFVISLKDTTIISAIGVVELLQTGKIIVART-----TQST 471

Query: 353 TGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
              + I  ++ I   +++  +  +EK + 
Sbjct: 472 YVYLIIAIMYLILITALTKLAKVLEKKVK 500


>gi|217963588|ref|YP_002349266.1| amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine
           family [Listeria monocytogenes HCC23]
 gi|217332858|gb|ACK38652.1| amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine
           family [Listeria monocytogenes HCC23]
 gi|307571836|emb|CAR85015.1| amino acid ABC transporter, amino acid-binding/permease protein
           [Listeria monocytogenes L99]
          Length = 486

 Score =  167 bits (423), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 63/227 (27%), Positives = 114/227 (50%), Gaps = 8/227 (3%)

Query: 158 FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFI 217
            +   G            G L+T+ ++  G++    LG LLAL + +    LR+    +I
Sbjct: 268 LMFQDGSFYEKYGNYFITGTLITIALAAIGVLCGAILGSLLALMKLAKTRWLRWPAACYI 327

Query: 218 ELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISK 277
           E  RG PL+  +F+      +      DV   +   + +S  ++AY+AE++R G+ +++K
Sbjct: 328 EFVRGTPLLIQIFIVFFGTQII---GMDVSAFVSGCIALSLNSAAYVAEIIRAGISAVNK 384

Query: 278 GQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVR 337
           GQ EAA SLG++    MR II+PQ +K ++P + N F+ + K+SS++S+I + +L+ +  
Sbjct: 385 GQMEAARSLGMTQGASMRYIILPQAVKNILPALGNEFVTVIKESSIVSVIGVTELMFMTG 444

Query: 338 VNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
           V    S       P   LI    ++++  FS+S      E+ +    
Sbjct: 445 VVQGAS-----FKPFIPLIITSLIYFVLTFSLSRLLGVAERRMRTSD 486


>gi|241895266|ref|ZP_04782562.1| amino acid ABC superfamily ATP binding cassette transporter,
           membrane protein [Weissella paramesenteroides ATCC
           33313]
 gi|241871572|gb|EER75323.1| amino acid ABC superfamily ATP binding cassette transporter,
           membrane protein [Weissella paramesenteroides ATCC
           33313]
          Length = 494

 Score =  167 bits (423), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 65/213 (30%), Positives = 110/213 (51%), Gaps = 8/213 (3%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
              G   ++ ++  G+   + LG+L AL + S+I  L++  + +IE  RGVPL+  +F+ 
Sbjct: 287 FIKGTEYSVGLAVIGVFFGIVLGVLFALMKMSSIKPLKWIAVAYIEAVRGVPLLIQVFIV 346

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
                +       V   L   + +   ++AY+AE++R G+Q++  GQ EAA SLG +  Q
Sbjct: 347 YFGTQVI---GIHVSSFLAGAIAMFLNSAAYVAEIIRSGIQAVPDGQTEAARSLGFTKNQ 403

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPT 352
            MR +I+PQ IK ++P + N F+ + K+ S++S+I + +L     V    S       P 
Sbjct: 404 TMRYMILPQAIKNILPALGNEFVTVIKEGSVVSVIGVGELTFQASVVQGAS-----FKPF 458

Query: 353 TGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSK 385
             L+    +++I  F IS      EK LHK  K
Sbjct: 459 LPLVITAAIYFILTFGISRLLNLFEKKLHKSDK 491


>gi|312869289|ref|ZP_07729456.1| ABC transporter, permease protein [Lactobacillus oris PB013-T2-3]
 gi|311095163|gb|EFQ53440.1| ABC transporter, permease protein [Lactobacillus oris PB013-T2-3]
          Length = 502

 Score =  167 bits (423), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 62/211 (29%), Positives = 108/211 (51%), Gaps = 8/211 (3%)

Query: 171 TSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLF 230
           T    G+  TL+I+   +I+   +G+L AL R S+  +L    I +IE  RG P++  + 
Sbjct: 298 TFFVKGVKYTLLITVLAVIVGFLIGVLFALMRLSDNKLLHGIAICYIEFIRGTPMLVQIM 357

Query: 231 MASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSY 290
                +   +     +  L+  ++ V+  + AY+AE++R G+QS+  GQ EAA SLG++ 
Sbjct: 358 FVYFGIGAII---QSMPALVAGIIAVAINSGAYVAEIIRSGIQSLPLGQTEAARSLGMTK 414

Query: 291 LQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVT 350
            Q  R IIMPQ +K + P + N FI L KDSSL+S I + +L+   ++  +++       
Sbjct: 415 QQTFRYIIMPQALKNIWPALGNEFITLLKDSSLVSTIGVTELMYQTQLVQADT-----YK 469

Query: 351 PTTGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
               L     +++   F+++      EK   
Sbjct: 470 GVLPLFITMMIYFFLTFTLTRILNHFEKKFK 500


>gi|241895264|ref|ZP_04782560.1| amino acid ABC superfamily ATP binding cassette transporter,
           membrane protein [Weissella paramesenteroides ATCC
           33313]
 gi|241871570|gb|EER75321.1| amino acid ABC superfamily ATP binding cassette transporter,
           membrane protein [Weissella paramesenteroides ATCC
           33313]
          Length = 493

 Score =  167 bits (423), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 67/213 (31%), Positives = 107/213 (50%), Gaps = 8/213 (3%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
              G L T+ ++  G+   + LGIL AL + S+I   ++    +IE  RGVPL+  +F+ 
Sbjct: 286 FVKGTLYTIGLAVIGVFFGIILGILFALMKLSSIKPFKWLASAYIEAVRGVPLLIQVFIV 345

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
                        V   L   + +   ++AY+AE++R G+Q++  GQ EAA SLG +  Q
Sbjct: 346 YFG---TQAIGVHVSSFLAGAIAMFLNSAAYVAEIIRSGIQAVPTGQTEAARSLGFTKNQ 402

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPT 352
            MR +I+PQ IK ++P + N F+ + K+ S++S+I + +L     V    S       P 
Sbjct: 403 TMRYMILPQAIKNILPALGNEFVTVIKEGSVVSVIGVGELTFQTSVVQGAS-----FKPF 457

Query: 353 TGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSK 385
             LI    +++I  F IS      EK L K  K
Sbjct: 458 IPLIITAAIYFILTFGISRLLNLFEKKLRKSDK 490


>gi|218438819|ref|YP_002377148.1| polar amino acid ABC transporter inner membrane protein [Cyanothece
           sp. PCC 7424]
 gi|218171547|gb|ACK70280.1| polar amino acid ABC transporter, inner membrane subunit
           [Cyanothece sp. PCC 7424]
          Length = 513

 Score =  167 bits (423), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 64/214 (29%), Positives = 115/214 (53%), Gaps = 9/214 (4%)

Query: 172 SLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFM 231
           +L+ G ++T++++ F +   +  G L+AL   S   +LR     +++ FRG P++  LF+
Sbjct: 291 NLFRGAVITVILTAFSVFFGLIGGTLVALALISPYQILRLLFRIYVDFFRGTPMLVQLFI 350

Query: 232 ASIMLPLFLPDT----WDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLG 287
               LP          W +D+   A++ +S   +AY+AE++RGG+QSI KGQ+EA  SLG
Sbjct: 351 IYFGLPALFQQYLGIEWSLDRFPAAVMALSLNVAAYLAEIIRGGIQSIDKGQWEACESLG 410

Query: 288 LSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWIS 347
           ++  Q M+ +I PQ  +R++P + N FI L KD+SL +II   +L    ++  + +    
Sbjct: 411 MTPFQTMQDVIFPQAFRRILPPLGNEFITLIKDTSLTAIIGFQELFREGQLIVAVT---- 466

Query: 348 SVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
                   I +  V+ I     S+   ++E  ++
Sbjct: 467 -YKAFEVYIAVALVYLILTTLSSIAFKWLETAMN 499


>gi|315302221|ref|ZP_07873138.1| glutamine ABC transporter, permease/substrate-binding protein
           [Listeria ivanovii FSL F6-596]
 gi|313629411|gb|EFR97627.1| glutamine ABC transporter, permease/substrate-binding protein
           [Listeria ivanovii FSL F6-596]
          Length = 480

 Score =  167 bits (423), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 59/209 (28%), Positives = 111/209 (53%), Gaps = 7/209 (3%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
           L  G+ +T+ ++   +II+  +GI     + SN  +LR     ++++FRG PL+   F  
Sbjct: 277 LLAGMWLTIRLAVVSLIIAFIIGITFGFMKVSNSKILRGIATVYVDIFRGTPLIVQAFFF 336

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
              +P      + +   L  ++ +S  A AY+ E++RGG+QS+ KGQ EAA SLGL + +
Sbjct: 337 YFGIP--AALDFRMPVFLAGVIALSLNAGAYMVEIVRGGIQSVDKGQMEAARSLGLPHKK 394

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPT 352
            M  +++PQ I+ +IP  +N F+   KD+S++S I + +L    ++  + +        T
Sbjct: 395 AMLKVVLPQAIRMMIPSFINQFVITLKDTSIMSAIGLVELTQSGKIIMART-----FEST 449

Query: 353 TGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
              + IG ++ I    ++  S  +E+ + 
Sbjct: 450 WTWLIIGIMYLIVITILTKVSDRLERRVR 478


>gi|313617589|gb|EFR89902.1| His/Glu/Gln/Arg/opine ABC transporter permease [Listeria innocua
           FSL S4-378]
          Length = 486

 Score =  167 bits (422), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 62/227 (27%), Positives = 114/227 (50%), Gaps = 8/227 (3%)

Query: 158 FVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFI 217
            +   G            G L+T+ ++  G++    LG LLAL + +    +R+    +I
Sbjct: 268 LMFQDGSFYEKYGNYFITGTLITIALAAIGVLCGAILGSLLALMKLAKTRWIRWPAACYI 327

Query: 218 ELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISK 277
           E  RG PL+  +F+      +      DV   +   + +S  ++AY+AE++R G+ +++K
Sbjct: 328 EFVRGTPLLIQIFIVFFGTQII---GMDVSAFVSGCIALSLNSAAYVAEIIRAGISAVNK 384

Query: 278 GQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVR 337
           GQ EAA SLG++    MR II+PQ +K ++P + N F+ + K+SS++S+I + +L+ +  
Sbjct: 385 GQMEAARSLGMTQGASMRYIILPQAVKNILPALGNEFVTVIKESSIVSVIGVTELMFMTG 444

Query: 338 VNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGS 384
           V    S       P   LI    ++++  FS+S      E+ +    
Sbjct: 445 VVQGAS-----FKPFIPLIITSLIYFVLTFSLSRLLGVAERRMRTSD 486


>gi|72382451|ref|YP_291806.1| amino acid ABC transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine [Prochlorococcus marinus str.
           NATL2A]
 gi|72002301|gb|AAZ58103.1| amino acid ABC transporter membrane protein 2, PAAT family
           [Prochlorococcus marinus str. NATL2A]
          Length = 344

 Score =  167 bits (422), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 104/350 (29%), Positives = 187/350 (53%), Gaps = 29/350 (8%)

Query: 32  IHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIGSNRTVCTTVSQGGIQPDGW 91
             K  F    + ++T LII  L  +      W+   A W                     
Sbjct: 16  ARKTLFSNLFNTIITLLIILFLSVACFNTFEWLIFKANW--------------------- 54

Query: 92  NAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTPMLIPSFPRK-FLNSILLFG 150
                  +      + FG++P  ++WRP    ++   L    L     +    + ++L+ 
Sbjct: 55  -----KVVISNLPLYAFGSFPSNEQWRPATWIISLLSLSIFTLYGPEWKWLRKHLLILWV 109

Query: 151 LFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLR 210
                  ++LYGG+GLS + +  WGGL +T++++    ++S+P+GI+LAL R+S++P+++
Sbjct: 110 GTIPLGLYLLYGGIGLSPIMSRQWGGLTLTILLTVCSSLLSLPIGIILALCRHSSLPIIQ 169

Query: 211 YACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRG 270
                FI++ R +PL+ VLF   +++PLFLP   ++D++ RA+   + F SAYIAE +RG
Sbjct: 170 KLSSIFIDVMRAIPLIAVLFFGQLLIPLFLPVEIEIDRVWRAIFAFTLFVSAYIAEDIRG 229

Query: 271 GLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMF 330
           GLQSI   Q EAANSLGL+  Q ++ I++PQ ++  +P + N  IGLF+++SL++I+ + 
Sbjct: 230 GLQSIPNTQIEAANSLGLNQYQIIQFILIPQALRIALPALTNQSIGLFQNTSLMAILGLV 289

Query: 331 DLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTL 380
           +LLGI R   +   +I         +++  V+WI C  +++ +  +E+ +
Sbjct: 290 ELLGIGRSILANPEFIGQY--IEVYVWLACVYWIVCTIMAVLARHLEQRM 337


>gi|288905601|ref|YP_003430823.1| amino acid ABC transporter, amino acid-binding/permease protein
           [Streptococcus gallolyticus UCN34]
 gi|288732327|emb|CBI13897.1| putative amino acid ABC transporter, amino acid-binding/permease
           protein [Streptococcus gallolyticus UCN34]
          Length = 741

 Score =  167 bits (422), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 54/223 (24%), Positives = 111/223 (49%), Gaps = 9/223 (4%)

Query: 163 GLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRG 222
              L    + L  GL  TL ++     I+M +GI+  +   +   VLR     F+++ RG
Sbjct: 524 WGLLKNNYSQLLSGLGKTLSLTLISFAIAMVIGIIFGMMAVAPNKVLRTISAVFVDIVRG 583

Query: 223 VPL-VTVLFMASIMLPLFLPD---TWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKG 278
           +PL +   F+   +  L          ++  + A + +S    AYIAE++RGG++++ +G
Sbjct: 584 IPLMIVAAFIFWGIPNLLESITGKQSPINDFVAATIALSLNGGAYIAEIVRGGIEAVPQG 643

Query: 279 QFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRV 338
           Q EA+ SLG+SY + M+ +I+PQ ++ ++P  +N F+   KD++++S I + +L    ++
Sbjct: 644 QMEASRSLGISYGKTMQKVILPQAVRLMLPNFINQFVISLKDTTIVSAIGLVELFQTGKI 703

Query: 339 NFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
             +      +         +  ++ +    ++  +  +EK L 
Sbjct: 704 IIA-----RNYQSFRMYAILAVIYLVMITLLTRLAKRLEKRLK 741


>gi|309813087|ref|ZP_07706813.1| ABC transporter, permease protein [Dermacoccus sp. Ellin185]
 gi|308432971|gb|EFP56877.1| ABC transporter, permease protein [Dermacoccus sp. Ellin185]
          Length = 495

 Score =  167 bits (422), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 58/218 (26%), Positives = 102/218 (46%), Gaps = 8/218 (3%)

Query: 169 VETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTV 228
           +   L   L  T+ ++     I + L + +AL R S    L +    FI +FRG PL+  
Sbjct: 286 IGPMLVATLKGTIPLTAASFAIGLVLALGVALARMSANAALSWPARIFISIFRGTPLLVQ 345

Query: 229 LFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGL 288
           L +    +P        +     A++  S   +AY AE++R  + S+ KGQ+EAA ++G+
Sbjct: 346 LAIIFFGMPQL---GIKLSPWPSAIIAFSLNVAAYSAEIIRAAILSVPKGQWEAAETIGM 402

Query: 289 SYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISS 348
           +    +R II+PQ ++  +P + NT I L KD+SL S I + ++    ++  + S     
Sbjct: 403 NRATALRRIILPQALRVAVPPLSNTLISLVKDTSLASTILVTEMFRQAQIAAAPS----- 457

Query: 349 VTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
                       ++W  CF +SL    +E  L +   +
Sbjct: 458 GDFLELYGVAAAIYWALCFILSLVQGRLENRLGRHVAR 495


>gi|226365139|ref|YP_002782922.1| glutamine ABC transporter glutamine-binding/permease protein
           [Rhodococcus opacus B4]
 gi|226243629|dbj|BAH53977.1| putative glutamine ABC transporter glutamine-binding/permease
           protein [Rhodococcus opacus B4]
          Length = 489

 Score =  167 bits (422), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 65/209 (31%), Positives = 118/209 (56%), Gaps = 7/209 (3%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
           L  GL +T+V++   I I++ LG +  L R S   VLR    T++++FRG PL+   F  
Sbjct: 287 LLEGLWLTIVLTVVSIAIALVLGAIFGLFRVSTNIVLRGIGTTYVDVFRGTPLLVQAFFI 346

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
              +P      + +      ++ +S  A AY+AE++RGG+ S+ KGQ EA+ SLG+SYL+
Sbjct: 347 YFGIP--AALDFQMSAFTAGIITLSLNAGAYMAEIVRGGILSVDKGQMEASRSLGISYLK 404

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPT 352
            M+ ++MPQ ++ +IP  +N F+   KD+S++S+I + +L    R+  +      +    
Sbjct: 405 SMQKVVMPQAVRTMIPSYINQFVITLKDTSILSVIGLAELTQTGRIIIA-----RNFQSF 459

Query: 353 TGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
              + IG +++I   +++  S  +EK ++
Sbjct: 460 NMWLIIGVMYFIIIMALTKLSNRLEKRIN 488


>gi|310640366|ref|YP_003945124.1| glutamine transport system permease protein [Paenibacillus polymyxa
           SC2]
 gi|309245316|gb|ADO54883.1| Probable glutamine transport system permease protein [Paenibacillus
           polymyxa SC2]
          Length = 482

 Score =  167 bits (422), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 59/211 (27%), Positives = 110/211 (52%), Gaps = 7/211 (3%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
           L  G+  TL+ +   ++++  LG++    + S+  V R     F+++FRG+PL+ + F  
Sbjct: 279 LIKGMGNTLLYTLVSLLVAFLLGLVFGFMKVSHNKVFRGIATVFVDVFRGIPLIVLAFFI 338

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
              +P      + +   + A+L +S  A AY+ E++RGG+QSI  GQ EAA SLGL Y  
Sbjct: 339 YFGIPQ--ALDFKMPLFVAAVLTLSLNAGAYVTEIIRGGIQSIDPGQMEAARSLGLPYRT 396

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPT 352
            M  II+PQ +K +IP  +N  +   KD+S++S+I + +L    ++  + +         
Sbjct: 397 AMLKIILPQAVKIMIPSFINQLVITLKDTSILSVIGLVELTQSGKIIIART-----FQSF 451

Query: 353 TGLIFIGFVFWIFCFSISLYSVFIEKTLHKG 383
              + +  ++ I    ++  S  +E  + +G
Sbjct: 452 DIWLVVAVMYLIVITVLTKISNRLEGRVRRG 482


>gi|308126408|ref|ZP_07663750.1| general L-amino acid transport system permease protein AapM [Vibrio
           parahaemolyticus AQ4037]
 gi|308108543|gb|EFO46083.1| general L-amino acid transport system permease protein AapM [Vibrio
           parahaemolyticus AQ4037]
          Length = 262

 Score =  166 bits (421), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 103/265 (38%), Positives = 159/265 (60%), Gaps = 12/265 (4%)

Query: 13  KRLLQPSLPPVYQRGIIAWIHKNFFGTPKDILLTALIICLLLFSIPGIIHWVFLDAVWIG 72
            +      PP    G++ W+ KN F  P + ++T ++  ++  ++  I+ W F++A WIG
Sbjct: 4   HQFQPDLPPPSNTVGVVGWLRKNLFNGPVNSIVTLILAYIVFNALWHIVDWAFINADWIG 63

Query: 73  SNRTVCTTVSQGGIQPDGWNAACWAFIYDRYEQFIFGNYPMAQRWRPILVFLTGSILLTP 132
           S R  C+              ACW FI  R+EQF++G YP A+ WRP L ++T +I    
Sbjct: 64  STRDDCS-----------REGACWVFISVRWEQFMYGFYPEAELWRPRLFYITLAIFTVL 112

Query: 133 MLIPSFPRKFLNSILLFGLFPIFS-FFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIIS 191
           +     P++    +    ++P      +  G  GL +VET  WGGLLVTL+I+  GI++S
Sbjct: 113 LAYEKTPKRLWIWLFFVNIYPFIVAALLYGGVFGLEVVETHKWGGLLVTLIIALVGIVVS 172

Query: 192 MPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASIMLPLFLPDTWDVDKLLR 251
           +P+G+ LALGR S++P++R  C  +IE++RGVPL+TVLFMAS+MLPLFL +  + DKL+R
Sbjct: 173 LPIGVALALGRRSDMPIIRSICTIYIEVWRGVPLITVLFMASVMLPLFLAEGSETDKLIR 232

Query: 252 ALLGVSAFASAYIAEVLRGGLQSIS 276
           AL+GV  F++AY+AEV      +  
Sbjct: 233 ALIGVVMFSAAYMAEVSGTWWFASH 257


>gi|329922367|ref|ZP_08278044.1| ABC transporter, permease protein [Paenibacillus sp. HGF5]
 gi|328942230|gb|EGG38501.1| ABC transporter, permease protein [Paenibacillus sp. HGF5]
          Length = 480

 Score =  166 bits (421), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 65/213 (30%), Positives = 115/213 (53%), Gaps = 8/213 (3%)

Query: 174 WGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMAS 233
             G+  TL+IS  G++    LG+++AL R S + +L++    +IE+ RG P++  LF+  
Sbjct: 276 AKGIQFTLLISALGVLFGFILGLIIALMRMSGVKILKFLATAYIEIIRGTPMLVQLFIIH 335

Query: 234 IMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQK 293
             L  F         +   +L +S  ++AY+AE+ R G+Q + +GQ EAA SLG++  + 
Sbjct: 336 YSLAAF---DIKFSPIQSGILTLSINSAAYLAEIFRAGIQGVDRGQLEAARSLGMTKGKA 392

Query: 294 MRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTT 353
           MR II+PQ +K V+P I N F+ + K+SS++S I +FD++   ++    +       P  
Sbjct: 393 MRHIILPQALKGVLPAIGNEFVVIIKESSIVSFIGVFDIMYQAQILRGST-----FAPLN 447

Query: 354 GLIFIGFVFWIFCFSISLYSVFIEKTLHKGSKK 386
            L+    +++I  F +S      E+ L     +
Sbjct: 448 PLLVAAMIYFILTFVLSKLLGVWERKLSASDNR 480


>gi|159029917|emb|CAO90296.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 503

 Score =  166 bits (420), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 65/239 (27%), Positives = 115/239 (48%), Gaps = 8/239 (3%)

Query: 150 GLFPIFSFFVLYGGLGLSIVETSLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVL 209
            + P              +    +  G+  T++++    +  +  G L+A+   S    L
Sbjct: 263 LVAPALKNLQESRFNWGELFYNLIVKGVPWTILLTVLSFLFGLIGGTLVAIALISPYKWL 322

Query: 210 RYACITFIELFRGVPLVTVLFMASIMLP-LFLPDTWDVD--KLLRALLGVSAFASAYIAE 266
           +  C  +++ FRG P++  LF+    LP LF     ++D  +L  AL  +S   +AY+AE
Sbjct: 323 KIICRIYVDFFRGTPMLVQLFLIYFGLPGLFREIGLNIDLDRLPAALFALSLNVAAYLAE 382

Query: 267 VLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISI 326
           ++RGG+QSI  GQ+EA +SLG+S +Q M  +I PQ  +R++P + N FI L KD+SL ++
Sbjct: 383 IMRGGIQSIDNGQWEACSSLGMSPVQTMHEVIFPQAFRRMLPPLGNEFITLIKDTSLAAV 442

Query: 327 INMFDLLGIVRVNFSESTWISSVTPTTGLIFIGFVFWIFCFSISLYSVFIEKTLHKGSK 385
           I   +L    ++  + +            I +  V+ +     SL    +E  +    K
Sbjct: 443 IGFEELFRQGQLMVATT-----YKAFEIYIAVALVYLVLTTLSSLVFKRLEIYMDPLHK 496


>gi|300768251|ref|ZP_07078156.1| glutamine ABC superfamily ATP binding cassette transporter,
           substrate binding and permease protein [Lactobacillus
           plantarum subsp. plantarum ATCC 14917]
 gi|300494315|gb|EFK29478.1| glutamine ABC superfamily ATP binding cassette transporter,
           substrate binding and permease protein [Lactobacillus
           plantarum subsp. plantarum ATCC 14917]
          Length = 491

 Score =  166 bits (420), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 62/207 (29%), Positives = 108/207 (52%), Gaps = 13/207 (6%)

Query: 179 VTLVISFFGIIISMPLGILLALGRNSNIPVL----RYACITFIELFRGVPLVTVLFMASI 234
            TL+I+   +     +GILLAL R +    L    R+    ++E  RG P++  +     
Sbjct: 292 YTLIITVCSVFFGFIIGILLALARMAKGNPLKTAIRWLATAYVEFIRGTPMMVQVMFVYF 351

Query: 235 MLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKM 294
            L LF     ++  L   ++ +S  + AY+AE +RGG+ S+  GQ EAA SLG+S  + M
Sbjct: 352 GLGLF----VNLPALTSGIIAISLNSGAYVAEYIRGGINSVDVGQTEAARSLGMSNGETM 407

Query: 295 RLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPTTG 354
           R +++PQ +K + P + N FI L KDSS++SII + +L+    +  S++           
Sbjct: 408 RYVVLPQALKNIWPSLGNEFITLIKDSSIVSIIGVTELIYQSNIVRSDT-----YRGVAP 462

Query: 355 LIFIGFVFWIFCFSISLYSVFIEKTLH 381
           ++ I  +++I  F+ S    + E+ + 
Sbjct: 463 IVVIMVLYFILTFTASRILNYFERRMQ 489


>gi|227551702|ref|ZP_03981751.1| glutamate ABC superfamily ATP binding cassette transporter,
           membrane protein [Enterococcus faecium TX1330]
 gi|227179143|gb|EEI60115.1| glutamate ABC superfamily ATP binding cassette transporter,
           membrane protein [Enterococcus faecium TX1330]
          Length = 487

 Score =  166 bits (420), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 58/209 (27%), Positives = 114/209 (54%), Gaps = 7/209 (3%)

Query: 173 LWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMA 232
           L  GL  T++++     +++ +G++  L   + I  LR     ++++ RG+P++ + F  
Sbjct: 286 LLKGLWRTILLTLISFALAIVIGVIFGLFSVAPIRALRTVASIYVDIIRGIPMMVLAFFI 345

Query: 233 SIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQ 292
              LP      + +   +  ++ ++  ASAYIAE++RGG+ ++  GQ EA+ SLGLSY +
Sbjct: 346 FFGLP--GIVGFTIPDFIAGVITLTLNASAYIAEIVRGGINAVPVGQMEASRSLGLSYNR 403

Query: 293 KMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSESTWISSVTPT 352
            M+ II+PQ I+ +IP  VN F+   KD+++IS I + +LL   ++  + +        T
Sbjct: 404 TMQKIILPQAIRIMIPSFVNQFVISLKDTTIISAIGVVELLQTGKIIVART-----TQST 458

Query: 353 TGLIFIGFVFWIFCFSISLYSVFIEKTLH 381
              + I  ++ I   +++  +  +EK + 
Sbjct: 459 YVYLIIAIMYLILITALTKLAKVLEKKVK 487


>gi|303256934|ref|ZP_07342948.1| glutamine ABC trans