RPSBLAST alignment for GI: 254780172 and conserved domain: PRK10782

>gnl|CDD|182726 PRK10782, PRK10782, DL-methionine transporter permease subunit; Provisional. Length = 217
 Score = 52.0 bits (125), Expect = 2e-07
 Identities = 39/144 (27%), Positives = 72/144 (50%), Gaps = 10/144 (6%)

Query: 172 SLWGGLLVTLVISFFGIIISMPLGILLALGRNSNI---PVLRYACITFIELFRGVPLVTV 228
            +W  L +T V  FFG +I +P+G+LL + R   I     L       + +FR +P + +
Sbjct: 12  GVWETLAMTFVSGFFGFVIGLPVGVLLYVTRPGQIIANAKLYRTLSALVNIFRSIPFIIL 71

Query: 229 LFMASIMLPLFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGL 288
           L     M+P           L  A++ ++  A+ +IA ++   L  I  G  EA+ ++G 
Sbjct: 72  LVW---MIPFTRVIVGTSIGLQAAIVPLTVGAAPFIARMVENALLEIPTGLIEASRAMGA 128

Query: 289 SYLQKMRLIIMPQVIKRVIPGIVN 312
           + +Q +R +++P+     +PG+VN
Sbjct: 129 TPMQIVRKVLLPE----ALPGLVN 148