RPSBLAST alignment for GI: 254780172 and conserved domain: COG1175

>gnl|CDD|31368 COG1175, UgpA, ABC-type sugar transport systems, permease components [Carbohydrate transport and metabolism]. Length = 295
 Score = 39.8 bits (93), Expect = 0.001
 Identities = 52/235 (22%), Positives = 87/235 (37%), Gaps = 26/235 (11%)

Query: 115 QRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVETSLW 174
           +R  P L+     +LL    +         S   + L    S FV          + + W
Sbjct: 8   RRLLPYLLLAPALLLLLVFFLYPLILTLYLSFTNYDLLGPPSTFVGLANYERLFSDPTFW 67

Query: 175 GGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFMASI 234
             L  TLV +   + + + LG+LLAL  N  +    +    F      +P      +A +
Sbjct: 68  NALKNTLVFTVISVPLQLVLGLLLALLLNRKLRGRGFFRTLFF-----LPWAISSVVAGL 122

Query: 235 MLPLFLPDTWDVDKLLRALLGV-----------SAFASAYIAEVLRG----------GLQ 273
           +       ++ +   L  LLG+           +A  +  I  V +G          GLQ
Sbjct: 123 IWKWLFNPSFGLLNSLLLLLGLIPDINWLSDPNTALFAVIIVSVWKGTGFVMLLFLAGLQ 182

Query: 274 SISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIIN 328
           SI K  +EAA   G S  Q+ R I +P +   +   ++   I  F+   LI ++ 
Sbjct: 183 SIPKELYEAARIDGASPWQRFRKITLPLLRPVIFFVLILRTIFAFQVFDLIYLLT 237