RPSBLAST alignment of GI: 254780172 and MMDB domain: 3d31_C_

>3d31_C (C:) Sulfate/molybdate ABC transporter, permease protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans}Length = 295
 Score = 64.4 bits (156), Expect = 3e-11
 Identities = 37/261 (14%), Positives = 88/261 (33%), Gaps = 11/261 (4%)

Query: 112 PMAQRWRPILVFLTGSILLTPMLIPSFPRKFLNSILLFGLFPIFSFFVLYGGLGLSIVET 171
            M  + R    F   + + + +L+  F    L   L             + GL  +    
Sbjct: 23  HMKAKNRKTRKFEPLTFVFSFLLLVLF----LFIFLTLSNMIFEQITEDFSGLVKAAGNR 78

Query: 172 SLWGGLLVTLVISFFGIIISMPLGILLALGRNSNIPVLRYACITFIELFRGVPLVTVLFM 231
           S+   + ++L   F   ++++ LG              +    + I++   VP       
Sbjct: 79  SVISSIFLSLYAGFLATLLALLLGAPTGYILARFDFPGKRLVESIIDVPVVVPHTVAGIA 138

Query: 232 ASIMLPLFLPDTWDVDKLLR-------ALLGVSAFASAYIAEVLRGGLQSISKGQFEAAN 284
              +          ++  ++        ++ +   +  Y+A   R G +S+      AA 
Sbjct: 139 LLTVFGSRGLIGEPLESYIQFRDALPGIVVAMLFVSMPYLANSAREGFKSVDPRLENAAR 198

Query: 285 SLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINMFDLLGIVRVNFSEST 344
           SLG    +    + +P   + ++ G V T+     +   + I+  + ++G   +     +
Sbjct: 199 SLGAPLWKAFFFVTLPLSARYLLIGSVMTWARAISEFGAVVILAYYPMVGPTLIYDRFIS 258

Query: 345 WISSVTPTTGLIFIGFVFWIF 365
           +  S +    ++ I     IF
Sbjct: 259 YGLSASRPIAVLLILVTLSIF 279