BLAST/BLAST alignment of GI: 254780172 and GI: 254780171
>gi|254780171|ref|YP_003064584.1| ABC transporter membrane spanning protein (amino acid) [Candidatus Liberibacter asiaticus str. psy62] Length = 398
 Score = 70.1 bits (170), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 57/82 (69%)

Query: 254 LGVSAFASAYIAEVLRGGLQSISKGQFEAANSLGLSYLQKMRLIIMPQVIKRVIPGIVNT 313
           + +S + +A+IAE++R GL ++ +GQ EAA +LGL++ +  RL+++PQ ++ +IP + + 
Sbjct: 271 IALSCYTAAFIAEIVRSGLIAVPRGQMEAAIALGLTHRKATRLVLLPQAMRSIIPPLTSQ 330

Query: 314 FIGLFKDSSLISIINMFDLLGI 335
           ++ L K+SSL   +   DL+ +
Sbjct: 331 YLNLLKNSSLAVAVGFADLVSV 352