RPSBLAST alignment for GI: 254780173 and conserved domain: PRK10253

>gnl|CDD|182336 PRK10253, PRK10253, iron-enterobactin transporter ATP-binding protein; Provisional. Length = 265
 Score =  103 bits (259), Expect = 4e-23
 Identities = 70/238 (29%), Positives = 120/238 (50%), Gaps = 14/238 (5%)

Query: 27  YGNFHALRDINLNVLRGERVIIAGPSGSGKSTLIRCINHIEKHQAGEIIINGIPLNDDIR 86
           YG +    ++ + +  G    I GP+G GKSTL+R ++ +     G + ++G    + I+
Sbjct: 17  YGKYTVAENLTVEIPDGHFTAIIGPNGCGKSTLLRTLSRLMTPAHGHVWLDG----EHIQ 72

Query: 87  NI--HEVRRDVGMVFQHFNLFSNLSVLENCTLG-----PIWVRKMPKKDAEELAMHYLNK 139
           +    EV R +G++ Q+     +++V E    G     P++ R   +K+ EE     +  
Sbjct: 73  HYASKEVARRIGLLAQNATTPGDITVQELVARGRYPHQPLFTRW--RKEDEEAVTKAMQA 130

Query: 140 VKIADKSHRSSSLLSGGESQRAAIARSLCMQPKIMLFDEPTSALDPEMVKEVLDIMIEL- 198
             I   + +S   LSGG+ QRA IA  L  +  IML DEPT+ LD     ++L+++ EL 
Sbjct: 131 TGITHLADQSVDTLSGGQRQRAWIAMVLAQETAIMLLDEPTTWLDISHQIDLLELLSELN 190

Query: 199 AEEGMTMVCVTHEMGFARQVADRVVFMDQGQIVEQNSPEEFFNNPQHERTQAFLSQII 256
            E+G T+  V H++  A + A  ++ + +G+IV Q +P+E       ER       II
Sbjct: 191 REKGYTLAAVLHDLNQACRYASHLIALREGKIVAQGAPKEIVTAELIERIYGLRCMII 248