RPSBLAST alignment for GI: 254780173 and conserved domain: COG0419

>gnl|CDD|30768 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair]. Length = 908
 Score = 46.6 bits (110), Expect = 7e-06
 Identities = 22/92 (23%), Positives = 40/92 (43%), Gaps = 9/92 (9%)

Query: 128 DAEELAMHYLNKVKIADK-SHRSSSLLSGGESQRAAIARSLCMQPKI--------MLFDE 178
                  +    V + D    R    LSGGE   A++A  L +   +        +  DE
Sbjct: 790 LTIRKDGNGGLVVVVYDGGEVRPIKTLSGGERFLASLALRLALSDLLQGRARLELLFLDE 849

Query: 179 PTSALDPEMVKEVLDIMIELAEEGMTMVCVTH 210
           P   LD E ++++ +I+ EL  +G  ++ ++H
Sbjct: 850 PFGTLDEERLEKLAEILEELLSDGRQIIIISH 881