RPSBLAST alignment for GI: 254780173 and conserved domain: cd03222

>gnl|CDD|72981 cd03222, ABC_RNaseL_inhibitor, The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids. RLI's are not transport proteins, and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family. Structurally, RLI's have an N-terminal Fe-S domain and two nucleotide-binding domains, which are arranged to form two composite active sites in their interface cleft. RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity more than 48%. The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.. Length = 177
 Score = 50.4 bits (120), Expect = 6e-07
 Identities = 28/72 (38%), Positives = 39/72 (54%), Gaps = 1/72 (1%)

Query: 153 LSGGESQRAAIARSLCMQPKIMLFDEPTSALDPEMVKEVLDIMIELAEEGM-TMVCVTHE 211
           LSGGE QR AIA +L       LFDEP++ LD E        +  L+EEG  T + V H+
Sbjct: 72  LSGGELQRVAIAAALLRNATFYLFDEPSAYLDIEQRLNAARAIRRLSEEGKKTALVVEHD 131

Query: 212 MGFARQVADRVV 223
           +     ++DR+ 
Sbjct: 132 LAVLDYLSDRIH 143