BLAST/PSIBLAST alignment of GI: 254780174 and GI: 209549151 at iteration 1
>gi|209549151|ref|YP_002281068.1| ETC complex subunit I [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 101
>gi|209534907|gb|ACI54842.1| ETC complex I subunit conserved region [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 101
 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 38/78 (48%), Positives = 53/78 (67%)

Query: 1   MLEFEKITPPYIEPLLGYTSSKDTLQQVKLFFPSLEAAEKYASDHGIQYCVIPSCKESQK 60
           +LEF++ +P  I+P++GYTSS DT QQVKL F + E AE YA  +GI+Y VI      ++
Sbjct: 24  VLEFDQESPRKIDPIMGYTSSGDTRQQVKLTFETQELAEAYAQRNGIEYRVIAPKDPVRQ 83

Query: 61  ELSYQRNFSYDRLEPWTH 78
            ++Y  NF Y R +PWTH
Sbjct: 84  VVAYPDNFRYTRTQPWTH 101