PSIBLAST alignment of GI: 254780174 and protein with PDB id: 2jya

>gi|163930881|pdb|2JYA|A Chain A, Nmr Solution Structure Of Protein Atu1810 From Agrobacterium Tumefaciens. Northeast Structural Genomics Consortium Target Atr23, Ontario Centre For Structural Proteomics Target Atc1776 Length = 106
 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 38/78 (48%), Positives = 52/78 (66%)

Query: 1   MLEFEKITPPYIEPLLGYTSSKDTLQQVKLFFPSLEAAEKYASDHGIQYCVIPSCKESQK 60
           +LEF+   P  I+P++GYTSS D  QQVKL F + E AE YA   GI+Y VI   + ++K
Sbjct: 27  VLEFDAEVPRKIDPIMGYTSSSDMKQQVKLTFETQEQAEAYAQRKGIEYRVILPKEATRK 86

Query: 61  ELSYQRNFSYDRLEPWTH 78
            +SY  NF ++R +PWTH
Sbjct: 87  VVSYTDNFRFNRTQPWTH 104