RPS-BLAST 2.2.22 [Sep-27-2009]

Database: CddA 
           21,609 sequences; 6,263,737 total letters

Searching..................................................done

Query= gi|254780174|ref|YP_003064587.1| putative oxidoreductase
protein [Candidatus Liberibacter asiaticus str. psy62]
         (78 letters)



>gnl|CDD|113566 pfam04800, ETC_C1_NDUFA4, ETC complex I subunit conserved region.
           Family of pankaryotic NADH-ubiquinone oxidoreductase
           subunits (EC:1.6.5.3) (EC:1.6.99.3) from complex I of
           the electron transport chain initially identified in
           Neurospora crassa as a 21 kDa protein.
          Length = 101

 Score = 56.4 bits (136), Expect = 2e-09
 Identities = 27/78 (34%), Positives = 42/78 (53%), Gaps = 2/78 (2%)

Query: 2   LEFEKITPPYIEPLLGYTSSKDTL-QQVKLFFPSLEAAEKYASDHGIQYCVIPSCKESQK 60
           LEF++ +  +  PL+G+TS+ D L  Q++L FP+ EAA  +A   G +Y V        K
Sbjct: 25  LEFDR-SARWENPLMGWTSTGDPLSNQMELTFPTKEAAIAFAERQGWEYDVEEPNAPKAK 83

Query: 61  ELSYQRNFSYDRLEPWTH 78
             +Y  NFS++R      
Sbjct: 84  PKAYSDNFSWNRRTRLEV 101


>gnl|CDD|38599 KOG3389, KOG3389, KOG3389, NADH:ubiquinone oxidoreductase,
           NDUFS4/18 kDa subunit [Energy production and
           conversion].
          Length = 178

 Score = 37.0 bits (85), Expect = 0.001
 Identities = 22/61 (36%), Positives = 31/61 (50%), Gaps = 2/61 (3%)

Query: 14  PLLGYTSSKDTLQQVK--LFFPSLEAAEKYASDHGIQYCVIPSCKESQKELSYQRNFSYD 71
           PL+G+TS+ D L  V   L F + E A+ +A  +G  Y V        K  SY  NFS++
Sbjct: 111 PLMGWTSTADPLSNVGMALAFDTKEDAKSFAEKNGWDYDVEEPNTPKLKVKSYGDNFSWN 170

Query: 72  R 72
            
Sbjct: 171 G 171


>gnl|CDD|107250 cd01537, PBP1_Repressors_Sugar_Binding_like, Ligand-binding
          domain of the LacI-GalR family of transcription
          regulators and the sugar-binding domain of ABC-type
          transport systems.  Ligand-binding domain of the
          LacI-GalR family of transcription regulators and the
          sugar-binding domain of ABC-type transport systems, all
          of which contain the type I periplasmic binding
          protein-like fold. Their specific ligands include
          lactose, ribose, fructose, xylose, arabinose,
          galactose/glucose, and other sugars. The LacI family of
          proteins consists of transcriptional regulators related
          to the lac repressor; in general the sugar binding
          domain in this family binds a sugar, which in turn
          changes the DNA binding activity of the repressor
          domain.  The core structure of the periplasmic binding
          proteins is classified into two types and they differ
          in number and order of beta strands in each domain:
          type I, which has six beta strands, and type II, which
          has five beta strands. These two distinct structural
          arrangements may have originated from a common
          ancestor.
          Length = 264

 Score = 29.3 bits (66), Expect = 0.22
 Identities = 10/34 (29%), Positives = 17/34 (50%)

Query: 35 LEAAEKYASDHGIQYCVIPSCKESQKELSYQRNF 68
          L+  E+ A   G Q  +  S  +++K+LS   N 
Sbjct: 18 LKGIEEAAKAAGYQVLLANSQNDAEKQLSALENL 51


>gnl|CDD|146062 pfam03243, MerB, Alkylmercury lyase.  Alkylmercury lyase
           (EC:4.99.1.2) cleaves the carbon-mercury bond of
           organomercurials such as phenylmercuric acetate.
          Length = 128

 Score = 27.3 bits (61), Expect = 1.1
 Identities = 9/17 (52%), Positives = 10/17 (58%)

Query: 31  FFPSLEAAEKYASDHGI 47
           FF S EAAE + S H  
Sbjct: 89  FFASEEAAEAWLSTHPE 105


>gnl|CDD|35265 KOG0042, KOG0042, KOG0042, Glycerol-3-phosphate dehydrogenase
           [Energy production and conversion].
          Length = 680

 Score = 24.2 bits (52), Expect = 8.0
 Identities = 13/53 (24%), Positives = 22/53 (41%), Gaps = 8/53 (15%)

Query: 24  TLQQVKLFFPSLEAAEKYASDHGIQYCVIP------SCKESQKELSYQRNFSY 70
             +++   FP LEA  +Y      +Y   P        +E +K++ Y R F  
Sbjct: 518 VGKRLHPEFPYLEAEVRYGVVR--EYACTPVDVIARRLREKKKQIEYARTFLN 568


  Database: CddA
    Posted date:  Feb 4, 2011  9:38 PM
  Number of letters in database: 6,263,737
  Number of sequences in database:  21,609
  
Lambda     K      H
   0.317    0.133    0.406 

Gapped
Lambda     K      H
   0.267   0.0625    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 21609
Number of Hits to DB: 967,986
Number of extensions: 37781
Number of successful extensions: 95
Number of sequences better than 10.0: 1
Number of HSP's gapped: 93
Number of HSP's successfully gapped: 7
Length of query: 78
Length of database: 6,263,737
Length adjustment: 48
Effective length of query: 30
Effective length of database: 5,226,505
Effective search space: 156795150
Effective search space used: 156795150
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 51 (23.6 bits)