RPSBLAST alignment of GI: 254780174 and protein with PDBid: 2jya

>2jya_A AGR_C_3324P, uncharacterized protein ATU1810; protein with unknown function ATU1810, ontario centre for structural proteomics; NMR {Agrobacterium tumefaciens str} Length = 106
 Score =  100 bits (252), Expect = 6e-23
 Identities = 38/77 (49%), Positives = 51/77 (66%)

Query: 2   LEFEKITPPYIEPLLGYTSSKDTLQQVKLFFPSLEAAEKYASDHGIQYCVIPSCKESQKE 61
           LEF+   P  I+P++GYTSS D  QQVKL F + E AE YA   GI+Y VI   + ++K 
Sbjct: 28  LEFDAEVPRKIDPIMGYTSSSDMKQQVKLTFETQEQAEAYAQRKGIEYRVILPKEATRKV 87

Query: 62  LSYQRNFSYDRLEPWTH 78
           +SY  NF ++R +PWTH
Sbjct: 88  VSYTDNFRFNRTQPWTH 104