RPS-BLAST 2.2.22 [Sep-27-2009]

Database: pdb70 
           24,244 sequences; 5,693,230 total letters

Searching..................................................done

Query= gi|254780174|ref|YP_003064587.1| putative oxidoreductase
protein [Candidatus Liberibacter asiaticus str. psy62]
         (78 letters)



>2jya_A AGR_C_3324P, uncharacterized protein ATU1810; protein with unknown
           function ATU1810, ontario centre for structural
           proteomics; NMR {Agrobacterium tumefaciens str}
          Length = 106

 Score =  100 bits (252), Expect = 6e-23
 Identities = 38/77 (49%), Positives = 51/77 (66%)

Query: 2   LEFEKITPPYIEPLLGYTSSKDTLQQVKLFFPSLEAAEKYASDHGIQYCVIPSCKESQKE 61
           LEF+   P  I+P++GYTSS D  QQVKL F + E AE YA   GI+Y VI   + ++K 
Sbjct: 28  LEFDAEVPRKIDPIMGYTSSSDMKQQVKLTFETQEQAEAYAQRKGIEYRVILPKEATRKV 87

Query: 62  LSYQRNFSYDRLEPWTH 78
           +SY  NF ++R +PWTH
Sbjct: 88  VSYTDNFRFNRTQPWTH 104


>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-; fatty
           acid synthase, acyl-carrier-protein, beta-ketoacyl
           reductase, beta-ketoacyl synthase, dehydratase; 4.00A
           {Saccharomyces cerevisiae}
          Length = 1688

 Score = 29.8 bits (66), Expect = 0.17
 Identities = 25/79 (31%), Positives = 34/79 (43%), Gaps = 17/79 (21%)

Query: 12  IEPLL--GYT-SSKDTLQQVKL------FFPSLEAAEKYASDHG--IQYCVIPSCKE-SQ 59
           IEP L  GY    K+ +Q+V +      F  S E AE++   HG  +    IP   E S 
Sbjct: 907 IEPELFNGYNPEKKEMIQEVIVEEDLEPFEASKETAEQFKHQHGDKVDIFEIPETGEYSV 966

Query: 60  K-----ELSYQRNFSYDRL 73
           K      L   +   +DRL
Sbjct: 967 KLLKGATLYIPKALRFDRL 985


>1vp8_A Hypothetical protein AF0103; NP_068944.1, structural genomics,
          JCSG, joint center for structural genomics, PSI; HET:
          MSE FMN; 1.30A {Archaeoglobus fulgidus dsm 4304} SCOP:
          c.49.1.2
          Length = 201

 Score = 28.2 bits (63), Expect = 0.47
 Identities = 7/22 (31%), Positives = 12/22 (54%)

Query: 35 LEAAEKYASDHGIQYCVIPSCK 56
          L  A + A + GI++ V+ S  
Sbjct: 32 LRLAVERAKELGIKHLVVASSY 53


>1t57_A Conserved protein MTH1675; structural genomics, FMN,
          methanobacterium thermoautotrophicum, PSI; HET: FMN;
          2.30A {Methanothermobacterthermautotrophicus} SCOP:
          c.49.1.2
          Length = 206

 Score = 28.2 bits (63), Expect = 0.53
 Identities = 7/22 (31%), Positives = 10/22 (45%)

Query: 35 LEAAEKYASDHGIQYCVIPSCK 56
          LE   + A   GI+  V+ S  
Sbjct: 40 LELVGERADQLGIRNFVVASVS 61


>1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding,
           hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1
           c.19.1.2 PDB: 1bci_A
          Length = 749

 Score = 24.9 bits (54), Expect = 4.6
 Identities = 8/32 (25%), Positives = 14/32 (43%)

Query: 32  FPSLEAAEKYASDHGIQYCVIPSCKESQKELS 63
           F  L  AEK+A  + + +  I      ++ L 
Sbjct: 587 FKELLLAEKWAKMNKLPFPKIDPYVFDREGLK 618


>2wbn_A G2P, terminase large subunit; large terminase, nuclease, viral
           protein, DNA packaging; 1.90A {Bacillus phage SPP1} PDB:
           2wc9_A
          Length = 212

 Score = 24.7 bits (53), Expect = 6.0
 Identities = 6/40 (15%), Positives = 11/40 (27%), Gaps = 3/40 (7%)

Query: 33  PSLEAAEKYASDHGIQYCVIPSCKESQKELSYQRNFSYDR 72
            S+E  E++  +               +E     N  Y  
Sbjct: 138 DSVEHGERWLDELDAIVIDPLRTPNIAREF---ENIDYQT 174


>3f2g_A Alkylmercury lyase; MERB, organomercurial lyase, mercury
           resistance, mercuric resistance, plasmid; 1.78A
           {Escherichia coli} PDB: 3f2h_A 3fn8_A 1s6l_A 3f0o_A
           3f0p_A 3f2f_A
          Length = 220

 Score = 24.4 bits (53), Expect = 6.6
 Identities = 8/16 (50%), Positives = 10/16 (62%)

Query: 30  LFFPSLEAAEKYASDH 45
            FF S+  AE +AS H
Sbjct: 163 HFFASVPTAEDWASKH 178


  Database: pdb70
    Posted date:  Jan 26, 2011 11:21 AM
  Number of letters in database: 5,693,230
  Number of sequences in database:  24,244
  
Lambda     K      H
   0.317    0.133    0.406 

Gapped
Lambda     K      H
   0.267   0.0532    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 24244
Number of Hits to DB: 668,109
Number of extensions: 23145
Number of successful extensions: 84
Number of sequences better than 10.0: 1
Number of HSP's gapped: 84
Number of HSP's successfully gapped: 10
Length of query: 78
Length of database: 5,693,230
Length adjustment: 47
Effective length of query: 31
Effective length of database: 4,553,762
Effective search space: 141166622
Effective search space used: 141166622
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 50 (23.5 bits)