BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780174|ref|YP_003064587.1| putative oxidoreductase protein [Candidatus Liberibacter asiaticus str. psy62] (78 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780174|ref|YP_003064587.1| putative oxidoreductase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 78 Score = 163 bits (413), Expect = 5e-43, Method: Compositional matrix adjust. Identities = 78/78 (100%), Positives = 78/78 (100%) Query: 1 MLEFEKITPPYIEPLLGYTSSKDTLQQVKLFFPSLEAAEKYASDHGIQYCVIPSCKESQK 60 MLEFEKITPPYIEPLLGYTSSKDTLQQVKLFFPSLEAAEKYASDHGIQYCVIPSCKESQK Sbjct: 1 MLEFEKITPPYIEPLLGYTSSKDTLQQVKLFFPSLEAAEKYASDHGIQYCVIPSCKESQK 60 Query: 61 ELSYQRNFSYDRLEPWTH 78 ELSYQRNFSYDRLEPWTH Sbjct: 61 ELSYQRNFSYDRLEPWTH 78 >537021.9.peg.233_1 Length = 72 Score = 24.3 bits (51), Expect = 0.37, Method: Compositional matrix adjust. Identities = 10/48 (20%), Positives = 22/48 (45%) Query: 8 TPPYIEPLLGYTSSKDTLQQVKLFFPSLEAAEKYASDHGIQYCVIPSC 55 TPP P + ++++ V + F ++ ++GI +I +C Sbjct: 9 TPPKAHPNILSSNTERIRIGVLIIFNKIDTTVNIIKNNGIIVIIIATC 56 >gi|255764511|ref|YP_003065518.2| S-adenosyl-methyltransferase MraW [Candidatus Liberibacter asiaticus str. psy62] Length = 341 Score = 23.5 bits (49), Expect = 0.68, Method: Composition-based stats. Identities = 14/59 (23%), Positives = 23/59 (38%) Query: 17 GYTSSKDTLQQVKLFFPSLEAAEKYASDHGIQYCVIPSCKESQKELSYQRNFSYDRLEP 75 G + +D +Q LF + + Y D G+ V S + R FS+ + P Sbjct: 74 GQETMRDYKEQFSLFQATFSQLQDYVPDKGVDGVVFDLGVSSMQIDCGDRGFSFQKSGP 132 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.317 0.133 0.406 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,846 Number of Sequences: 1233 Number of extensions: 1594 Number of successful extensions: 4 Number of sequences better than 100.0: 4 Number of HSP's better than 100.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of query: 78 length of database: 328,796 effective HSP length: 48 effective length of query: 30 effective length of database: 269,612 effective search space: 8088360 effective search space used: 8088360 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (20.7 bits) S2: 31 (16.5 bits)