Query gi|254780176|ref|YP_003064589.1| hypothetical protein CLIBASIA_00295 [Candidatus Liberibacter asiaticus str. psy62] Match_columns 119 No_of_seqs 1 out of 3 Neff 1.0 Searched_HMMs 39220 Date Mon May 23 02:07:28 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 254780176.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 pfam12127 YdfA_immunity SigmaW 80.4 0.65 1.6E-05 23.8 0.8 21 2-22 231-251 (321) 2 PRK13665 hypothetical protein; 77.4 0.92 2.3E-05 23.0 0.8 21 2-22 232-252 (327) 3 COG4864 Uncharacterized protei 49.9 6.6 0.00017 18.8 0.8 19 3-21 232-250 (328) 4 TIGR00553 pabB para-aminobenzo 22.0 23 0.00058 16.2 -0.3 37 7-49 191-231 (368) 5 KOG1748 consensus 17.3 33 0.00085 15.4 -0.3 20 55-74 92-119 (131) 6 pfam03008 DUF234 Archaea bacte 13.0 1.1E+02 0.0027 12.9 1.5 27 24-53 64-90 (97) 7 cd05839 BR140_related The PWWP 12.6 99 0.0025 13.0 1.1 48 32-79 47-98 (111) 8 TIGR01945 rnfC electron transp 9.5 1.4E+02 0.0037 12.2 1.8 20 54-73 200-219 (444) 9 COG4449 Predicted protease of 6.9 1.9E+02 0.0049 11.6 0.9 16 20-35 178-193 (827) 10 TIGR00430 Q_tRNA_tgt queuine t 6.4 2E+02 0.0052 11.5 0.7 15 47-61 162-176 (415) No 1 >pfam12127 YdfA_immunity SigmaW regulon antibacterial. This protein is found in bacteria. Proteins in this family are about 330 amino acids in length. The operon from which this protein is derived confers immunity for the host species to a broad range of antibacterial compounds, unlike the specific immunity proteins that are linked to and co-regulated with their antibiotic-synthesis proteins. Probab=80.43 E-value=0.65 Score=23.79 Aligned_cols=21 Identities=62% Similarity=0.775 Sum_probs=16.4 Q ss_pred CCHHHHHHHHHHHHHHHHHCC Q ss_conf 501222322111344321013 Q gi|254780176|r 2 AELETAQAEADAKIAEAKAKD 22 (119) Q Consensus 2 aeletaqaeadakiaeakakd 22 (119) |.|.+.|||||-+||.|||.. T Consensus 231 A~Lq~dQAeADk~vAqAkAE~ 251 (321) T pfam12127 231 ARLQTDQAEADKRIAQAKAEE 251 (321) T ss_pred HHHHHHHHHHHHHHHHHHHHH T ss_conf 455177887878999877888 No 2 >PRK13665 hypothetical protein; Provisional Probab=77.40 E-value=0.92 Score=23.05 Aligned_cols=21 Identities=62% Similarity=0.757 Sum_probs=16.5 Q ss_pred CCHHHHHHHHHHHHHHHHHCC Q ss_conf 501222322111344321013 Q gi|254780176|r 2 AELETAQAEADAKIAEAKAKD 22 (119) Q Consensus 2 aeletaqaeadakiaeakakd 22 (119) |.|.+.|||||-++|.+||.. T Consensus 232 A~Lq~dQAeADk~vAqAkAE~ 252 (327) T PRK13665 232 AKLQTDQAEADKNIAQAKAEE 252 (327) T ss_pred HHHHHHHHHHHHHHHHHHHHH T ss_conf 344067776778999987888 No 3 >COG4864 Uncharacterized protein conserved in bacteria [Function unknown] Probab=49.86 E-value=6.6 Score=18.81 Aligned_cols=19 Identities=63% Similarity=0.753 Sum_probs=8.8 Q ss_pred CHHHHHHHHHHHHHHHHHC Q ss_conf 0122232211134432101 Q gi|254780176|r 3 ELETAQAEADAKIAEAKAK 21 (119) Q Consensus 3 eletaqaeadakiaeakak 21 (119) .|.|-|+++|-+|+.+|+. T Consensus 232 ~lqteqa~adk~iaqakae 250 (328) T COG4864 232 KLQTEQAEADKNIAQAKAE 250 (328) T ss_pred CCCHHHHHHHHHHHHHHHH T ss_conf 1235666543679987788 No 4 >TIGR00553 pabB para-aminobenzoate synthase, component I; InterPro: IPR005802 Para-aminobenzoate synthase component I (pabB) is closely related to anthranilate synthase component I (trpE). The apparent orthologs of pabB in Aquifex aeolicus and Helicobacter pylori score well below most TrpE proteins because of a different architecture, in which the less strongly conserved N-terminal domain is absent. The noise cut off is set to exclude most examples of TrpE.; GO: 0009396 folic acid and derivative biosynthetic process. Probab=22.04 E-value=23 Score=16.19 Aligned_cols=37 Identities=41% Similarity=0.511 Sum_probs=28.6 Q ss_pred HHHHHHHHHHHHHHCCCCCEEE----EEEEECCCCCCHHHEEEHHHC Q ss_conf 2322111344321013687014----654303564401200000101 Q gi|254780176|r 7 AQAEADAKIAEAKAKDSGNQAE----IDIARSNAKDKTDLVRIAEAK 49 (119) Q Consensus 7 aqaeadakiaeakakdsgnqae----idiarsnakdktdlvriaeak 49 (119) +..+.|.+++.+-++++-|.|| +|+-| .||.||++.- T Consensus 191 ~~p~eD~~~~~~L~~s~K~rAENlMIVDLlR------NDlgRi~~~G 231 (368) T TIGR00553 191 ADPQEDRAQASALAESEKDRAENLMIVDLLR------NDLGRIAEVG 231 (368) T ss_pred CCHHHHHHHHHHHHCCCCHHHHHHHHHHHHH------CCCCCCCCCC T ss_conf 7868889999997305411454200466635------4732141254 No 5 >KOG1748 consensus Probab=17.30 E-value=33 Score=15.37 Aligned_cols=20 Identities=55% Similarity=0.793 Sum_probs=13.6 Q ss_pred CEEEEEEC--------CCHHHHHHHHHH Q ss_conf 05655610--------001355555544 Q gi|254780176|r 55 DIVMAIEK--------SKADAIKTMEDR 74 (119) Q Consensus 55 divmaiek--------skadaiktmedr 74 (119) .||||||. ++||-|+|..|- T Consensus 92 EiVMAlEEEFgiEIpd~dAdki~t~~da 119 (131) T KOG1748 92 EIVMALEEEFGIEIPDEDADKIKTVRDA 119 (131) T ss_pred HHHHHHHHHHCCCCCCCHHHHHCCHHHH T ss_conf 1301007875972674145662799999 No 6 >pfam03008 DUF234 Archaea bacterial proteins of unknown function. Probab=13.05 E-value=1.1e+02 Score=12.86 Aligned_cols=27 Identities=30% Similarity=0.348 Sum_probs=18.5 Q ss_pred CCEEEEEEEECCCCCCHHHEEEHHHCCCCC Q ss_conf 870146543035644012000001011001 Q gi|254780176|r 24 GNQAEIDIARSNAKDKTDLVRIAEAKYKYR 53 (119) Q Consensus 24 gnqaeidiarsnakdktdlvriaeakykyr 53 (119) +.+.||||.--+..++ +-+.|.||+-+ T Consensus 64 ~k~~EIDiva~~~~~~---~l~gEcKw~n~ 90 (97) T pfam03008 64 HKGEEIDIVALDEDGK---ALFGEVKWKNL 90 (97) T ss_pred CCCCCEEEEEECCCCC---EEEEEEECCCC T ss_conf 8997677999868996---99999952403 No 7 >cd05839 BR140_related The PWWP domain is found in the BR140 family, which includes peregrin and BR140-like proteins 1 and 2. BR140 is the only family to contain the PWWP domain at the C terminus, with PHD and bromo domains in the N-terminal region. In myeloid leukemias, BR140 is disrupted by chromosomal translocations, similar to translocations of WHSC1 in lymphoid multiple myeloma. The PWWP domain, named for a conserved Pro-Trp-Trp-Pro motif, is a small domain consisting of 100-150 amino acids. The PWWP domain is found in numerous proteins that are involved in cell division, growth and differentiation. Most PWWP-domain proteins seem to be nuclear, often DNA-binding proteins, that function as transcription factors regulating a variety of developmental processes. Probab=12.62 E-value=99 Score=13.03 Aligned_cols=48 Identities=21% Similarity=0.218 Sum_probs=39.4 Q ss_pred EECCCCCCHHHEEEHHHCCCC----CCCEEEEEECCCHHHHHHHHHHHHHHH Q ss_conf 303564401200000101100----120565561000135555554443210 Q gi|254780176|r 32 ARSNAKDKTDLVRIAEAKYKY----RSDIVMAIEKSKADAIKTMEDRKAKVG 79 (119) Q Consensus 32 arsnakdktdlvriaeakyky----rsdivmaiekskadaiktmedrkakvg 79 (119) .++|.+++.-||+.-..|-.| |+-+..--+.+.-|..|.||.||..+- T Consensus 47 ~~~~~~e~~~LVlFFD~krTWqWLp~~Kl~pLG~D~~~D~~kl~e~rk~s~r 98 (111) T cd05839 47 RAQNADERLYLVLFFDNKRTWQWLPGDKLEPLGVDETLDKLKLKEGRKPSIR 98 (111) T ss_pred HCCCCCCEEEEEEEECCCCCEECCCHHHCHHCCCCHHHHHHHHHHCCCHHHH T ss_conf 3445687189999964886251358755402269735769998712667788 No 8 >TIGR01945 rnfC electron transport complex, RnfABCDGE type, C subunit; InterPro: IPR010208 The six subunit complex RnfABCDGE in Rhodobacter capsulatus encodes an apparent NADH oxidoreductase responsible for electron transport to nitrogenase, necessary for nitrogen fixation . A closely related complex in Escherichia coli, RsxABCDGE (Reducer of SoxR), reduces the 2Fe-2S-containing superoxide sensor SoxR, active as a transcription factor when oxidized . This family of putative NADH oxidoreductase complexes exists in many of the same species as the related NQR, a Na(+)-translocating NADH-quinone reductase (IPR003667 from INTERPRO), but is distinct. This entry describes the C subunit.; GO: 0051539 4 iron 4 sulfur cluster binding, 0006118 electron transport, 0016020 membrane. Probab=9.51 E-value=1.4e+02 Score=12.23 Aligned_cols=20 Identities=30% Similarity=0.607 Sum_probs=17.0 Q ss_pred CCEEEEEECCCHHHHHHHHH Q ss_conf 20565561000135555554 Q gi|254780176|r 54 SDIVMAIEKSKADAIKTMED 73 (119) Q Consensus 54 sdivmaiekskadaiktmed 73 (119) ..+|.+||..|-+||..|.. T Consensus 200 ~~~viGIEDNKpeAI~al~~ 219 (444) T TIGR01945 200 KKVVIGIEDNKPEAIAALKK 219 (444) T ss_pred CEEEEEEECCCHHHHHHHHH T ss_conf 86999865795799999999 No 9 >COG4449 Predicted protease of the Abi (CAAX) family [General function prediction only] Probab=6.92 E-value=1.9e+02 Score=11.62 Aligned_cols=16 Identities=44% Similarity=0.472 Sum_probs=12.3 Q ss_pred HCCCCCEEEEEEEECC Q ss_conf 0136870146543035 Q gi|254780176|r 20 AKDSGNQAEIDIARSN 35 (119) Q Consensus 20 akdsgnqaeidiarsn 35 (119) .+.||||++|.||..- T Consensus 178 ~~~~~nq~~~~~a~~p 193 (827) T COG4449 178 NVPVGNQAEIKLATMP 193 (827) T ss_pred ECCCCCCCEEEECCCC T ss_conf 1236986201413584 No 10 >TIGR00430 Q_tRNA_tgt queuine tRNA-ribosyltransferase; InterPro: IPR004803 The queuine tRNA-ribosyltransferase (tgt) 2.4.2.29 from EC catalyzes an exchange for the guanine base at position 34 of many tRNAs; this nucleotide is subsequently modified to queuosine. The archaea have a closely related enzyme (IPR004804 from INTERPRO) that catalyses a base exchange for guanine at position 15 in some tRNAs, a site that is subsequently converted to the archaeal-specific modified base archaeosine (7-formamidino-7-deazaguanosine), while Archaeoglobus fulgidus has both enzymes. ; GO: 0008479 queuine tRNA-ribosyltransferase activity, 0008616 queuosine biosynthetic process. Probab=6.37 E-value=2e+02 Score=11.48 Aligned_cols=15 Identities=47% Similarity=0.780 Sum_probs=0.0 Q ss_pred HHCCCCCCCEEEEEE Q ss_conf 101100120565561 Q gi|254780176|r 47 EAKYKYRSDIVMAIE 61 (119) Q Consensus 47 eakykyrsdivmaie 61 (119) |-.|..-|||+|+.. T Consensus 162 ~IQ~~LGSDIiM~fD 176 (415) T TIGR00430 162 EIQYALGSDIIMAFD 176 (415) T ss_pred HHHHHHCCCEEEECC T ss_conf 999862897798702 Done!