RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780176|ref|YP_003064589.1| hypothetical protein CLIBASIA_00295 [Candidatus Liberibacter asiaticus str. psy62] (119 letters) >gnl|CDD|179919 PRK05035, PRK05035, electron transport complex protein RnfC; Provisional. Length = 695 Score = 34.5 bits (80), Expect = 0.007 Identities = 26/99 (26%), Positives = 39/99 (39%) Query: 8 QAEADAKIAEAKAKDSGNQAEIDIARSNAKDKTDLVRIAEAKYKYRSDIVMAIEKSKADA 67 +A A IA AKAK + QA A K V A A+ K + A + Sbjct: 547 KAAVAAAIARAKAKKAAQQAANAEAEEEVDPKKAAVAAAIARAKAKKAAQQAASAEPEEQ 606 Query: 68 IKTMEDRKAKVGVARQERKANESKDAATIITTATVENTK 106 + ++ +KA V A KA +++ A V+ K Sbjct: 607 VAEVDPKKAAVAAAIARAKAKKAEQQANAEPEEPVDPRK 645 Score = 25.3 bits (56), Expect = 4.5 Identities = 25/104 (24%), Positives = 42/104 (40%), Gaps = 1/104 (0%) Query: 3 ELETAQAEADAKIAEAKAKDSGNQAEIDIARSNAKDKTDLVRIAEAKYKYRSDIVMAIEK 62 E++ +A A IA AKAK + Q + D + A A R+ A ++ Sbjct: 574 EVDPKKAAVAAAIARAKAKKA-AQQAASAEPEEQVAEVDPKKAAVAAAIARAKAKKAEQQ 632 Query: 63 SKADAIKTMEDRKAKVGVARQERKANESKDAATIITTATVENTK 106 + A+ + ++ RKA V A KA ++ E+ K Sbjct: 633 ANAEPEEPVDPRKAAVAAAIARAKARKAAQQQANAEPEEAEDPK 676 >gnl|CDD|184222 PRK13665, PRK13665, hypothetical protein; Provisional. Length = 316 Score = 31.8 bits (73), Expect = 0.043 Identities = 13/19 (68%), Positives = 17/19 (89%) Query: 2 AELETAQAEADAKIAEAKA 20 A+L+T QAEAD +IA+AKA Sbjct: 232 AKLQTDQAEADKRIAQAKA 250 >gnl|CDD|152562 pfam12127, YdfA_immunity, SigmaW regulon antibacterial. This protein is found in bacteria. Proteins in this family are about 330 amino acids in length. The operon from which this protein is derived confers immunity for the host species to a broad range of antibacterial compounds, unlike the specific immunity proteins that are linked to and co-regulated with their antibiotic-synthesis proteins. Length = 321 Score = 28.8 bits (65), Expect = 0.30 Identities = 13/19 (68%), Positives = 16/19 (84%) Query: 2 AELETAQAEADAKIAEAKA 20 A L+T QAEAD +IA+AKA Sbjct: 231 ARLQTDQAEADKRIAQAKA 249 >gnl|CDD|161925 TIGR00553, pabB, aminodeoxychorismate synthase, component I, bacterial clade. Members of this family, aminodeoxychorismate synthase, component I (PabB), were designated para-aminobenzoate synthase component I until it was recognized that PabC, a lyase, completes the pathway of PABA synthesis. This family is closely related to anthranilate synthase component I (trpE), and both act on chorismate. The clade of PabB enzymes represented by this model includes sequences from Gram-positive and alpha and gamma Proteobacteria as well as Chlorobium, Nostoc, Fusobacterium and Arabidopsis. A closely related clade of fungal PabB enzymes is identified by TIGR01823, while another bacterial clade of potential PabB enzymes is more closely related to TrpE (TIGR01824). Length = 328 Score = 27.3 bits (61), Expect = 1.0 Identities = 15/46 (32%), Positives = 23/46 (50%), Gaps = 10/46 (21%) Query: 7 AQAEADAKIAEAKAKDSGNQAE----IDIARSNAKDKTDLVRIAEA 48 A + D A A A+ + ++AE +D+ R+ DL RIAE Sbjct: 162 ADPQEDRAQASALAESAKDRAENLMIVDLLRN------DLGRIAEV 201 >gnl|CDD|181007 PRK07508, PRK07508, aminodeoxychorismate synthase; Provisional. Length = 378 Score = 25.7 bits (57), Expect = 3.1 Identities = 15/45 (33%), Positives = 22/45 (48%), Gaps = 10/45 (22%) Query: 7 AQAEADAKIAEAKAKDSGNQAE----IDIARSNAKDKTDLVRIAE 47 A DA++ A D NQAE +D+ R+ D+ RI+E Sbjct: 203 ATPAEDARLRAALLNDEKNQAENRMIVDLLRN------DISRISE 241 >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional. Length = 2084 Score = 25.5 bits (55), Expect = 3.1 Identities = 31/106 (29%), Positives = 47/106 (44%), Gaps = 2/106 (1%) Query: 8 QAEADAKIAEAKAKDSGNQAEIDIARSNAKDKTDLVRIAEAKYKYRSDIVMAIEKSKADA 67 +AE K EAK K + + D A+ A++ A+A+ + +D A E+ A Sbjct: 1310 KAEEAKKADEAKKKAEEAKKKADAAKKKAEEAKKAAEAAKAEAEAAADEAEAAEEKAEAA 1369 Query: 68 IKTMEDRKAKVGVARQERKANESKDAATIITTATVENTKVVETKEA 113 K E+ K K A+ +KA E K A A + K E K+A Sbjct: 1370 EKKKEEAKKKADAAK--KKAEEKKKADEAKKKAEEDKKKADELKKA 1413 >gnl|CDD|185024 PRK15064, PRK15064, ABC transporter ATP-binding protein; Provisional. Length = 530 Score = 24.5 bits (54), Expect = 6.3 Identities = 10/19 (52%), Positives = 12/19 (63%) Query: 2 AELETAQAEADAKIAEAKA 20 A+LE AE D AEA+A Sbjct: 117 ADLEVKFAEMDGYTAEARA 135 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.302 0.116 0.279 Gapped Lambda K H 0.267 0.0564 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,627,733 Number of extensions: 91538 Number of successful extensions: 260 Number of sequences better than 10.0: 1 Number of HSP's gapped: 226 Number of HSP's successfully gapped: 97 Length of query: 119 Length of database: 5,994,473 Length adjustment: 81 Effective length of query: 38 Effective length of database: 4,244,225 Effective search space: 161280550 Effective search space used: 161280550 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 17 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 43 (21.9 bits) S2: 51 (23.8 bits)