RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780176|ref|YP_003064589.1| hypothetical protein CLIBASIA_00295 [Candidatus Liberibacter asiaticus str. psy62] (119 letters) >2rfw_A Cellulose 1,4-beta-cellobiosidase; hydrolase, glycosidase; 1.60A {Melanocarpus albomyces} PDB: 2rfy_A* 2rfz_A* 2rg0_A* (A:1-37,A:78-164,A:206-430) Length = 349 Score = 24.5 bits (53), Expect = 4.7 Identities = 12/39 (30%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Query: 2 AELETAQAEADAKIAE---AKAKDSGNQAEIDIARSNAK 37 + L E D +A +A AEID+ SNA Sbjct: 102 SALYFVAMEEDGGMASYPSNQAGYGSCCAEIDVWESNAY 140 >3c6l_A TCR 2W20 alpha chain; TCR-PMHC complex; 3.40A {Mus musculus} (A:112-185) Length = 74 Score = 24.0 bits (52), Expect = 6.9 Identities = 10/32 (31%), Positives = 18/32 (56%) Query: 88 NESKDAATIITTATVENTKVVETKEAGKTARS 119 ++ ++ T IT TV + K +++K G A S Sbjct: 32 PKTMESGTFITDKTVLDMKAMDSKSNGAIAWS 63 >1mwa_A 2C alpha chain, 2C T cell receptor alpha chain; IG domain, antigen recognition, complementarity determining region, immune system; HET: NAG BMA; 2.40A {Mus musculus} (A:115-202) Length = 88 Score = 23.7 bits (51), Expect = 8.9 Identities = 11/32 (34%), Positives = 19/32 (59%) Query: 88 NESKDAATIITTATVENTKVVETKEAGKTARS 119 ++ ++ T IT ATV + K +++K G A S Sbjct: 32 PKTMESGTFITDATVLDMKAMDSKSNGAIAWS 63 >2q86_A Valpha14 TCR; INKT cells, TCR, glycolipid recognition, innate immunity, immune system; HET: NAG BMA MAN FUC; 1.85A {Mus musculus} PDB: 3he7_C* 3he6_C* (A:114-229) Length = 116 Score = 23.6 bits (51), Expect = 9.9 Identities = 9/31 (29%), Positives = 17/31 (54%) Query: 89 ESKDAATIITTATVENTKVVETKEAGKTARS 119 ++ ++ T IT V + K +++K G A S Sbjct: 33 KTMESGTFITDKCVLDMKAMDSKSNGAIAWS 63 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.302 0.116 0.279 Gapped Lambda K H 0.267 0.0636 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 679,387 Number of extensions: 24543 Number of successful extensions: 44 Number of sequences better than 10.0: 1 Number of HSP's gapped: 44 Number of HSP's successfully gapped: 16 Length of query: 119 Length of database: 4,956,049 Length adjustment: 71 Effective length of query: 48 Effective length of database: 2,555,894 Effective search space: 122682912 Effective search space used: 122682912 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 17 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 43 (21.9 bits) S2: 50 (23.2 bits)