BLAST/PSIBLAST alignment of GI: 254780180 and GI: 190891762 at iteration 1
>gi|190891762|ref|YP_001978304.1| S-adenosylmethionine: tRNA ribosyltransferase-isomerase (Queuosine biosynthesis) protein [Rhizobium etli CIAT 652] Length = 373
>gi|238692548|sp|B3PZR1|QUEA_RHIE6 RecName: Full=S-adenosylmethionine:tRNA ribosyltransferase-isomerase; AltName: Full=Queuosine biosynthesis protein queA Length = 373
>gi|190697041|gb|ACE91126.1| S-adenosylmethionine: tRNA ribosyltransferase-isomerase (Queuosine biosynthesis) protein [Rhizobium etli CIAT 652] Length = 373
 Score =  434 bits (1117), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 218/373 (58%), Positives = 267/373 (71%), Gaps = 16/373 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNL-------SCP---LVISDHLVSDLP 50
           M V  FDFDLP  RIALRP  PRDSARL+VV+P+        S P     +SDH V DLP
Sbjct: 1   MRVDLFDFDLPDERIALRPAEPRDSARLLVVNPHAESGPHAESVPHAESALSDHHVYDLP 60

Query: 51  AFLNSNDAIVFNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIK 110
           +FL + DA+VFN+TKVI AQL G+R        +++S TLHMR+ P+ W  +A+P K IK
Sbjct: 61  SFLRAGDALVFNDTKVIPAQLEGIRH-RDGAGGQQVSATLHMRIGPSRWKAFAKPGKRIK 119

Query: 111 KGDILHFFSQDGQS----RLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYI 166
           +GD +  F   G+S     L+ATV +K   GE+ L F ++G  L+  I+ VG IPLPPYI
Sbjct: 120 EGDRI-AFGHSGESCFLGALDATVEEKGEAGEVTLAFDLTGPALDEAIAAVGHIPLPPYI 178

Query: 167 ARKRPIDARDYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGT 226
           A KRP D RD  DYQT YA+ +G+VAAPTAGLHFT +L + L   GI+ +FVTLHVGAGT
Sbjct: 179 AAKRPEDERDRADYQTIYAREEGAVAAPTAGLHFTPDLFAALDKAGIERHFVTLHVGAGT 238

Query: 227 FMPVKVEDTDDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGII 286
           F+PVK +DTDDH MH E G++ A  A  LN+VK+RGGRIV VGTTSLRL+E+A  EDG I
Sbjct: 239 FLPVKADDTDDHKMHLESGYVSAEIAARLNAVKARGGRIVCVGTTSLRLIESAAGEDGKI 298

Query: 287 NPWSGFTNIFITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYR 346
            PW+G T IFITPGYRF+AVD+LM+NFHLP+STL MLVSAF G E  +  Y+HAIS  YR
Sbjct: 299 KPWAGATGIFITPGYRFKAVDMLMTNFHLPRSTLFMLVSAFSGFETMRAAYEHAISTGYR 358

Query: 347 FYSYGDTSLLFQK 359
           FYSYGD SLLF+K
Sbjct: 359 FYSYGDASLLFRK 371