BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780180|ref|YP_003064593.1| S-adenosylmethionine:tRNA
ribosyltransferase-isomerase [Candidatus Liberibacter asiaticus str.
psy62]
         (360 letters)

Database: nr 
           13,984,884 sequences; 4,792,584,752 total letters

Searching..................................................done


Results from round 1


>gi|254780180|ref|YP_003064593.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254039857|gb|ACT56653.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 360

 Score =  745 bits (1923), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/360 (100%), Positives = 360/360 (100%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV
Sbjct: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ
Sbjct: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
           DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY
Sbjct: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM
Sbjct: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG
Sbjct: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLFQKR 360
           YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLFQKR
Sbjct: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLFQKR 360


>gi|315122778|ref|YP_004063267.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313496180|gb|ADR52779.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 359

 Score =  602 bits (1553), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 285/359 (79%), Positives = 321/359 (89%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           MMVKEFDF LP SRIALRPV PRDSARLMVV+PNLSC  +ISD+ V DLP FLNSNDAIV
Sbjct: 1   MMVKEFDFHLPSSRIALRPVSPRDSARLMVVYPNLSCSQMISDYSVRDLPIFLNSNDAIV 60

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FNNTKVI AQL G R    N  E  ISCTLHMR+S NSWS Y RP K+I++GD ++FFSQ
Sbjct: 61  FNNTKVIAAQLRGRRLRRTNDSEHWISCTLHMRISSNSWSAYVRPGKIIRQGDTIYFFSQ 120

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
           DGQS+LEA VI+K +TGEILLVF +SG EL+RQI+L+GT+PLPPYIA+KRPID RDYVDY
Sbjct: 121 DGQSKLEANVIEKRDTGEILLVFPLSGTELDRQIALIGTMPLPPYIAKKRPIDERDYVDY 180

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QTTYA IQGSVAAPTAGLHFTS+LLS+L+S+G+ VYF+TLHVGAGTFMPV+VEDTDDHIM
Sbjct: 181 QTTYASIQGSVAAPTAGLHFTSDLLSKLVSMGVAVYFITLHVGAGTFMPVRVEDTDDHIM 240

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSEIGFIDA TAQ LN+VK RGGRIV+VGTTSLRLLETATTEDGII P SG+TNIFITPG
Sbjct: 241 HSEIGFIDAQTAQDLNAVKLRGGRIVAVGTTSLRLLETATTEDGIIMPLSGYTNIFITPG 300

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLFQK 359
           YRFRAVD+L+SNFHLPKSTLLMLVSAFCG+EETK MYQHAI+++YRFYSYGD SL+F+K
Sbjct: 301 YRFRAVDVLLSNFHLPKSTLLMLVSAFCGVEETKTMYQHAIANSYRFYSYGDASLIFKK 359


>gi|325293064|ref|YP_004278928.1| S-adenosylmethionine tRNA ribosyltransferase [Agrobacterium sp.
           H13-3]
 gi|325060917|gb|ADY64608.1| S-adenosylmethionine tRNA ribosyltransferase [Agrobacterium sp.
           H13-3]
          Length = 374

 Score =  445 bits (1144), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 224/363 (61%), Positives = 267/363 (73%), Gaps = 8/363 (2%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  FDFDLP + IALRP  PRDSARL+VV PN      + D +VSDL +FL   DA+V
Sbjct: 15  MRVDLFDFDLPEANIALRPANPRDSARLLVVDPNADH---MEDRIVSDLTSFLKPGDALV 71

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHF-FS 119
           FN+T+VI AQL GVR       E  +S TLHMR   + W  +ARP K IK+GD + F + 
Sbjct: 72  FNDTRVIPAQLEGVRLRE-GAPETAVSATLHMRADQSRWKAFARPGKRIKQGDRIRFGYE 130

Query: 120 QD---GQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARD 176
           +D   G + LEATV +K   GEI L+F +SG  L+  I+ VG IPLPPYIA KRP DA+D
Sbjct: 131 RDNACGLAHLEATVEEKGEEGEITLLFDVSGPVLDEAIASVGHIPLPPYIAAKRPEDAQD 190

Query: 177 YVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTD 236
             DYQT YA+ +G+VAAPTAGLHFT +L + L   GI+ +FVTLHVGAGTF+PVK +DTD
Sbjct: 191 QTDYQTIYAREKGAVAAPTAGLHFTPDLFAALDEAGIERHFVTLHVGAGTFLPVKADDTD 250

Query: 237 DHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIF 296
           DH MH EIG +   TA  LN+VK+RGGRIVSVGTTSLRL+E+AT E+G+I PWSG T IF
Sbjct: 251 DHKMHFEIGHVSQETAAKLNAVKARGGRIVSVGTTSLRLIESATDENGVIQPWSGATGIF 310

Query: 297 ITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           ITPGYRFRAVDILM+NFHLPKSTL MLVSAFCG+E  +  Y HAI   YRFYSYGD+SLL
Sbjct: 311 ITPGYRFRAVDILMTNFHLPKSTLFMLVSAFCGLETMRAAYAHAIETGYRFYSYGDSSLL 370

Query: 357 FQK 359
           F+K
Sbjct: 371 FRK 373


>gi|222148799|ref|YP_002549756.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Agrobacterium vitis S4]
 gi|254764261|sp|B9JWX0|QUEA_AGRVS RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|221735785|gb|ACM36748.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Agrobacterium vitis S4]
          Length = 352

 Score =  442 bits (1136), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 221/359 (61%), Positives = 265/359 (73%), Gaps = 9/359 (2%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  FDFDLP   IALRP  PRD AR ++V P+ S  L++ D  V +LP+FL + DA+V
Sbjct: 1   MRVDLFDFDLPDENIALRPANPRDQARFLIVRPDGS--LMLEDRRVFELPSFLRAGDALV 58

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FN+TKVI AQL GVR      R   +SCTLHMRV+ N W  +ARP K IK+GD++ F   
Sbjct: 59  FNDTKVIPAQLEGVRIREGAER-TPVSCTLHMRVAANRWKAFARPGKRIKQGDVIDF--- 114

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
           DG   L A V +K   GEI L F+ SG +L+R I+ VG IPLPPYIA KRP D++D  DY
Sbjct: 115 DG---LSANVAEKGEAGEIDLEFAASGPDLDRAIAGVGHIPLPPYIAAKRPEDSQDRTDY 171

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YA+ +G+VAAPTAGLHFT  L   L   GI+ +FVTLHVGAGTF+PVK +DTDDH M
Sbjct: 172 QTIYAREEGAVAAPTAGLHFTPALFEALDKAGIERHFVTLHVGAGTFLPVKADDTDDHKM 231

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           H EIG + A TA+ALN+VK+RGGRIVSVGTTSLRLLE+A +EDG + PWS  T IFITPG
Sbjct: 232 HQEIGHVSAETAEALNAVKARGGRIVSVGTTSLRLLESAASEDGRLLPWSDATGIFITPG 291

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLFQK 359
           YRF+AVD+LM+NFHLPKSTL MLVSAF G+E  +  Y HAI   YRFYSYGD+SLLF+K
Sbjct: 292 YRFKAVDVLMTNFHLPKSTLFMLVSAFAGLETMRAAYAHAIETGYRFYSYGDSSLLFRK 350


>gi|327193336|gb|EGE60240.1| S-adenosylmethionine: tRNA ribosyltransferase-isomerase (Queuosine
           biosynthesis) protein [Rhizobium etli CNPAF512]
          Length = 366

 Score =  441 bits (1134), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 219/366 (59%), Positives = 265/366 (72%), Gaps = 9/366 (2%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPN---LSCPLVISDHLVSDLPAFLNSND 57
           M V  FDFDLP  RIALRP  PRDSARL+VV+P+   +     +SDH V DLP+FL + D
Sbjct: 1   MRVDLFDFDLPDERIALRPAEPRDSARLLVVNPHAESVHAESALSDHHVYDLPSFLRAGD 60

Query: 58  AIVFNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHF 117
           A+VFN+TKVI AQL G+R        +++S TLHMR+ PN W  +A+P K IK+GD +  
Sbjct: 61  ALVFNDTKVIPAQLEGIRH-RDGAGGQQVSATLHMRIGPNRWKAFAKPGKRIKEGDRI-A 118

Query: 118 FSQDGQS----RLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPID 173
           F   G+S     L+ATV +K   GE+ L F ++G  LE  I+ VG IPLPPYIA KRP D
Sbjct: 119 FGHSGESCFLGSLDATVEEKGEAGEVTLAFDLTGPALEEAIAAVGHIPLPPYIAAKRPED 178

Query: 174 ARDYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVE 233
            RD  DYQT YA+ +G+VAAPTAGLHFT +L + L   GI+ +FVTLHVGAGTF+PVK +
Sbjct: 179 ERDRADYQTIYAREEGAVAAPTAGLHFTPDLFAALDKAGIERHFVTLHVGAGTFLPVKAD 238

Query: 234 DTDDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFT 293
           DTDDH MH E G++ A  A  LN+VK+RGGRIV VGTTSLRLLE+A  EDG I PW+G T
Sbjct: 239 DTDDHKMHLESGYVSAEIAARLNAVKARGGRIVCVGTTSLRLLESAAGEDGKIKPWAGAT 298

Query: 294 NIFITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDT 353
            IFITPGYRF+AVD+LM+NFHLP+STL MLVSAF G E     Y+HAIS  YRFYSYGD 
Sbjct: 299 GIFITPGYRFKAVDMLMTNFHLPRSTLFMLVSAFSGFETMHAAYEHAISTGYRFYSYGDA 358

Query: 354 SLLFQK 359
           SLLF+K
Sbjct: 359 SLLFRK 364


>gi|159184871|ref|NP_354665.2| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Agrobacterium tumefaciens str. C58]
 gi|22096020|sp|Q8UES7|QUEA_AGRT5 RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|159140152|gb|AAK87450.2| S-adenosylmethionine tRNA ribosyltransferase-isomerase
           [Agrobacterium tumefaciens str. C58]
          Length = 366

 Score =  440 bits (1131), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 224/369 (60%), Positives = 266/369 (72%), Gaps = 14/369 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  FDFDLP   IALRP  PRDSARL+VV PN +    + DH V DLP+FL   DA+V
Sbjct: 1   MRVDLFDFDLPEENIALRPANPRDSARLLVVDPNEN---RMEDHRVFDLPSFLRPGDALV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHF-FS 119
           FN+T+VI AQL GVR       E  +S TLHMR   + W  +ARP K IK+GD + F + 
Sbjct: 58  FNDTRVIPAQLEGVRLRE-GAPETAVSATLHMRADQSRWKAFARPGKRIKEGDRIRFGYD 116

Query: 120 QD---------GQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKR 170
           +D         G + LEATV +K   GEI L+F ISG  L+  I+ VG IPLPPYIA KR
Sbjct: 117 RDTVNSSSGACGLAHLEATVEEKGEEGEITLLFDISGPVLDEAIASVGHIPLPPYIAAKR 176

Query: 171 PIDARDYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPV 230
           P D +D  DYQT YA+ +G+VAAPTAGLHFT +L   L S GI+ +FVTLHVGAGTF+PV
Sbjct: 177 PEDQQDQTDYQTIYAREKGAVAAPTAGLHFTPDLFEALDSAGIERHFVTLHVGAGTFLPV 236

Query: 231 KVEDTDDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWS 290
           K +DTDDH MH EIG++   TA  LN+VK+RGGRIV VGTTSLRL+E+A TEDG I+PWS
Sbjct: 237 KSDDTDDHKMHFEIGYVSQETADRLNAVKARGGRIVCVGTTSLRLIESAATEDGTIHPWS 296

Query: 291 GFTNIFITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSY 350
             T IFITPGYRFRAVD+LM+NFHLPKSTL MLVSAFCG+E  +  Y+HAI   YRFYSY
Sbjct: 297 DATGIFITPGYRFRAVDMLMTNFHLPKSTLFMLVSAFCGLETMRDAYRHAIETGYRFYSY 356

Query: 351 GDTSLLFQK 359
           GD+SLLF+K
Sbjct: 357 GDSSLLFRK 365


>gi|227822132|ref|YP_002826103.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Sinorhizobium fredii NGR234]
 gi|227341132|gb|ACP25350.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Sinorhizobium fredii NGR234]
          Length = 366

 Score =  436 bits (1122), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 221/367 (60%), Positives = 268/367 (73%), Gaps = 16/367 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  FDFDLP + IALRP  PRDSAR++VV P     L  SD  V DLP+FL+  DA+V
Sbjct: 6   MRVDLFDFDLPETSIALRPASPRDSARMLVVRPQREPAL--SDFGVLDLPSFLSPGDALV 63

Query: 61  FNNTKVITAQLNGVRFCHINRREK----EISCTLHMRVSPNSWSVYARPSKVIKKGDILH 116
           FN+TKVI AQL G+R     RR +    ++S TLHMRV+P+ W  +ARP++ +K GD + 
Sbjct: 64  FNDTKVIPAQLEGIR-----RRGEDVATQVSLTLHMRVAPDRWKAFARPARRLKPGDRIS 118

Query: 117 FFSQDGQS----RLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPI 172
           F    G +     L+ATV +K   GE+ L F +SG  L+  I  VG IPLPPYIA KR  
Sbjct: 119 F-GHGGNACLLGSLDATVEEKGEAGEVTLRFELSGPVLDEAIMSVGHIPLPPYIASKRSE 177

Query: 173 DARDYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKV 232
           DARD  DYQT YA+ +G+VAAPTAGLHFT  L  +L   GI+ +FVTLHVGAGTF+PVK 
Sbjct: 178 DARDRADYQTVYAREEGAVAAPTAGLHFTDRLFGKLDEAGIERHFVTLHVGAGTFLPVKA 237

Query: 233 EDTDDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGF 292
           +DTDDH+MH EIG +DA TA+ LN+V++RGGRIV VGTTSLRL+E+A TEDG I+PWSG 
Sbjct: 238 DDTDDHVMHEEIGHVDAVTAEKLNAVRARGGRIVCVGTTSLRLIESAATEDGKIHPWSGT 297

Query: 293 TNIFITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           T IFITPGYRFRAVD+LM+NFHLPKSTL MLVSAF G+E  +  Y HAI+  YRFYSYGD
Sbjct: 298 TGIFITPGYRFRAVDMLMTNFHLPKSTLFMLVSAFAGLETMRGAYTHAIAAGYRFYSYGD 357

Query: 353 TSLLFQK 359
            SLLF+K
Sbjct: 358 ASLLFRK 364


>gi|190891762|ref|YP_001978304.1| S-adenosylmethionine: tRNA ribosyltransferase-isomerase (Queuosine
           biosynthesis) protein [Rhizobium etli CIAT 652]
 gi|238692548|sp|B3PZR1|QUEA_RHIE6 RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|190697041|gb|ACE91126.1| S-adenosylmethionine: tRNA ribosyltransferase-isomerase (Queuosine
           biosynthesis) protein [Rhizobium etli CIAT 652]
          Length = 373

 Score =  434 bits (1117), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 218/373 (58%), Positives = 267/373 (71%), Gaps = 16/373 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNL-------SCP---LVISDHLVSDLP 50
           M V  FDFDLP  RIALRP  PRDSARL+VV+P+        S P     +SDH V DLP
Sbjct: 1   MRVDLFDFDLPDERIALRPAEPRDSARLLVVNPHAESGPHAESVPHAESALSDHHVYDLP 60

Query: 51  AFLNSNDAIVFNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIK 110
           +FL + DA+VFN+TKVI AQL G+R        +++S TLHMR+ P+ W  +A+P K IK
Sbjct: 61  SFLRAGDALVFNDTKVIPAQLEGIRH-RDGAGGQQVSATLHMRIGPSRWKAFAKPGKRIK 119

Query: 111 KGDILHFFSQDGQS----RLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYI 166
           +GD +  F   G+S     L+ATV +K   GE+ L F ++G  L+  I+ VG IPLPPYI
Sbjct: 120 EGDRI-AFGHSGESCFLGALDATVEEKGEAGEVTLAFDLTGPALDEAIAAVGHIPLPPYI 178

Query: 167 ARKRPIDARDYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGT 226
           A KRP D RD  DYQT YA+ +G+VAAPTAGLHFT +L + L   GI+ +FVTLHVGAGT
Sbjct: 179 AAKRPEDERDRADYQTIYAREEGAVAAPTAGLHFTPDLFAALDKAGIERHFVTLHVGAGT 238

Query: 227 FMPVKVEDTDDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGII 286
           F+PVK +DTDDH MH E G++ A  A  LN+VK+RGGRIV VGTTSLRL+E+A  EDG I
Sbjct: 239 FLPVKADDTDDHKMHLESGYVSAEIAARLNAVKARGGRIVCVGTTSLRLIESAAGEDGKI 298

Query: 287 NPWSGFTNIFITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYR 346
            PW+G T IFITPGYRF+AVD+LM+NFHLP+STL MLVSAF G E  +  Y+HAIS  YR
Sbjct: 299 KPWAGATGIFITPGYRFKAVDMLMTNFHLPRSTLFMLVSAFSGFETMRAAYEHAISTGYR 358

Query: 347 FYSYGDTSLLFQK 359
           FYSYGD SLLF+K
Sbjct: 359 FYSYGDASLLFRK 371


>gi|86357735|ref|YP_469627.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Rhizobium
           etli CFN 42]
 gi|123511943|sp|Q2K8D6|QUEA_RHIEC RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|86281837|gb|ABC90900.1| S-adenosylmethionine: tRNA ribosyltransferase-isomerase (Queuosine
           biosynthesis)protein [Rhizobium etli CFN 42]
          Length = 361

 Score =  433 bits (1113), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 216/363 (59%), Positives = 259/363 (71%), Gaps = 8/363 (2%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  FDFDLP  RIALRP  PRDSARL+VV P+    L  SDH V DLP+FL + DA+V
Sbjct: 1   MRVDLFDFDLPDERIALRPAEPRDSARLLVVDPDAESAL--SDHHVCDLPSFLRAGDALV 58

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FN+TKVI AQL G+R        +++S TLHMR+ P+ W  +A+P K IK+GD + F   
Sbjct: 59  FNDTKVIPAQLEGIRH-RDGAGGQQVSATLHMRIGPSRWKAFAKPGKRIKEGDRIAF-GH 116

Query: 121 DGQS----RLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARD 176
            G+S     L+ATV +K   GE+ L F +SG  L+  I+ VG IPLPPYIA KRP D RD
Sbjct: 117 SGESCMIGSLDATVEEKGEAGEVTLAFDLSGPVLDEAIAAVGHIPLPPYIAAKRPEDERD 176

Query: 177 YVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTD 236
             DYQT YA+ +G+VAAPTAGLHFT  L   L   GI+ +FVTLHVGAGTF+PVK +DTD
Sbjct: 177 RADYQTIYAREEGAVAAPTAGLHFTPALFEALDKAGIERHFVTLHVGAGTFLPVKADDTD 236

Query: 237 DHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIF 296
           DH MH E G++    A  LN+VK+RGGRIV VGTTSLRL+E+A  E G I PW+G T IF
Sbjct: 237 DHKMHLESGYVSGEIAAGLNAVKARGGRIVCVGTTSLRLIESAAGESGEIKPWAGATGIF 296

Query: 297 ITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           ITPGYRF+AVD+LM+NFHLP+STL MLVSAF G E     Y+HAIS  YRFYSYGD SLL
Sbjct: 297 ITPGYRFKAVDMLMTNFHLPRSTLFMLVSAFSGFETMHAAYKHAISTGYRFYSYGDASLL 356

Query: 357 FQK 359
           F+K
Sbjct: 357 FRK 359


>gi|222085994|ref|YP_002544526.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Agrobacterium radiobacter K84]
 gi|254764260|sp|B9JFA8|QUEA_AGRRK RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|221723442|gb|ACM26598.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Agrobacterium radiobacter K84]
          Length = 360

 Score =  431 bits (1109), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 215/366 (58%), Positives = 263/366 (71%), Gaps = 14/366 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  FDFDLP  RIALRP  PRDSARL+VV PN    +V+SD  + DL ++L   DAIV
Sbjct: 1   MRVDLFDFDLPDERIALRPAEPRDSARLLVVDPN--AEMVLSDRQIRDLSSYLRPGDAIV 58

Query: 61  FNNTKVITAQLNGVRFCHINRRE----KEISCTLHMRVSPNSWSVYARPSKVIKKGDILH 116
           FN+TKVI AQL G+R      RE    +++S TLHMR +P+ W  +A+P K IK GD + 
Sbjct: 59  FNDTKVIPAQLEGIR-----HREGAPGQQVSATLHMRAAPDRWKAFAKPGKRIKIGDRIQ 113

Query: 117 FFSQD---GQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPID 173
           F   +       L+A V +K   GEI L F +SG  L+  I+ VG IPLPPYIA KRP D
Sbjct: 114 FGHGENVCALGALDAVVEEKGEGGEITLRFDLSGPALDEAIAAVGHIPLPPYIAAKRPED 173

Query: 174 ARDYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVE 233
            RD  DYQT YA+ +G+VAAPTAGLHFT +L + L ++G++ +FVTLHVGAGTF+PVK +
Sbjct: 174 ERDRADYQTIYAREEGAVAAPTAGLHFTPSLFATLDAMGVERHFVTLHVGAGTFLPVKAD 233

Query: 234 DTDDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFT 293
           DT+DH MH EIG +DA TA+ LN+VK+RGGRIV VGTTSLRLLE+A  EDG I PWSG T
Sbjct: 234 DTEDHKMHFEIGHVDAATAEKLNAVKARGGRIVCVGTTSLRLLESAAAEDGTIKPWSGAT 293

Query: 294 NIFITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDT 353
            IFITPGYRF+ VD+LM+NFHLP+STL MLVSAF G++  +  Y HAI   YRFYSYGD 
Sbjct: 294 GIFITPGYRFKTVDLLMTNFHLPRSTLFMLVSAFAGLDTMRAAYTHAIETGYRFYSYGDG 353

Query: 354 SLLFQK 359
           SLL +K
Sbjct: 354 SLLHRK 359


>gi|241204662|ref|YP_002975758.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|240858552|gb|ACS56219.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 361

 Score =  429 bits (1104), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 215/363 (59%), Positives = 257/363 (70%), Gaps = 8/363 (2%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  FDFDLP  RIALRP  PRDSARL+VV PN    L  SDH V DL +FL + DA+V
Sbjct: 1   MRVDLFDFDLPDERIALRPAEPRDSARLLVVDPNAESHL--SDHRVGDLTSFLRAGDALV 58

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FN+TKVI AQL G+R        +++S TLHMR  PN W  +A+P K IK+GD + F   
Sbjct: 59  FNDTKVIPAQLEGIRH-RDGAGGQQVSATLHMRTGPNRWKAFAKPGKRIKQGDRISF-GH 116

Query: 121 DGQS----RLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARD 176
            G+S     L+A V +K   GE+ L+F +SG  L+  I+ VG IPLPPYIA KRP D RD
Sbjct: 117 SGESCFLGSLDAAVEEKGEAGEVTLLFDLSGPALDEAIAAVGHIPLPPYIAAKRPEDERD 176

Query: 177 YVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTD 236
             DYQT YA+ +G+VAAPTAGLHFT  L   L   GI+ +FVTLHVGAGTF+PVK +DTD
Sbjct: 177 RADYQTIYAREEGAVAAPTAGLHFTPALFEALDKAGIERHFVTLHVGAGTFLPVKADDTD 236

Query: 237 DHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIF 296
           DH MH E G++ A  A  LN+V+ RGGRIV VGTTSLRL+E+A  E G I PW+G T IF
Sbjct: 237 DHKMHLESGYVSAEIAARLNAVRERGGRIVCVGTTSLRLVESAAEEGGEIMPWAGATGIF 296

Query: 297 ITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           ITPGYRF+AVD+LM+NFHLP+STL MLV+AF G E     Y+HAIS  YRFYSYGD SLL
Sbjct: 297 ITPGYRFKAVDMLMTNFHLPRSTLFMLVAAFAGFETMHAAYKHAISTGYRFYSYGDASLL 356

Query: 357 FQK 359
           F+K
Sbjct: 357 FRK 359


>gi|116252158|ref|YP_767996.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|166216743|sp|Q1MGM3|QUEA_RHIL3 RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|115256806|emb|CAK07896.1| putative S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Rhizobium leguminosarum bv. viciae 3841]
          Length = 361

 Score =  428 bits (1100), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 215/363 (59%), Positives = 258/363 (71%), Gaps = 8/363 (2%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  FDFDLP  RIALRP  PRDSARL+V+ PN    L  SDH V DL +FL + DA+V
Sbjct: 1   MRVDLFDFDLPDERIALRPAEPRDSARLLVIDPNAENSL--SDHRVGDLTSFLRAGDALV 58

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FN+TKVI AQL G+R        +++S TLHMR SP+ W  +A+P K IK+GD + F   
Sbjct: 59  FNDTKVIPAQLEGIRH-RDGAGGQQVSATLHMRTSPSRWKAFAKPGKRIKQGDRISF-GH 116

Query: 121 DGQS----RLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARD 176
            G+S     L+ATV +K   GE+ L+F +SG  L+  I+ VG IPLPPYIA KRP D RD
Sbjct: 117 SGESCFLGSLDATVEEKGEAGEVTLLFDLSGPALDEAIAAVGHIPLPPYIAAKRPEDERD 176

Query: 177 YVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTD 236
             DYQT YA+ +G+VAAPTAGLHFT  L   L   GI+ +FVTLHVGAGTF+PVK +DT 
Sbjct: 177 RADYQTIYAREEGAVAAPTAGLHFTPGLFEALDRAGIERHFVTLHVGAGTFLPVKADDTA 236

Query: 237 DHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIF 296
           DH MH E G++ A  A  LN+V+ RGGRIV VGTTSLRL+E+A  E G I PW+G T IF
Sbjct: 237 DHKMHLESGYVSAEIAARLNAVRERGGRIVCVGTTSLRLIESAAEESGEIMPWAGATGIF 296

Query: 297 ITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           ITPGYRF+AVD+LM+NFHLP+STL MLVSAF G E     Y+HAIS  YRFYSYGD SLL
Sbjct: 297 ITPGYRFKAVDMLMTNFHLPRSTLFMLVSAFAGFETMHAAYKHAISTGYRFYSYGDASLL 356

Query: 357 FQK 359
           F+K
Sbjct: 357 FRK 359


>gi|307317196|ref|ZP_07596637.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Sinorhizobium meliloti AK83]
 gi|306897284|gb|EFN28029.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Sinorhizobium meliloti AK83]
          Length = 360

 Score =  428 bits (1100), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 219/366 (59%), Positives = 262/366 (71%), Gaps = 14/366 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  FDFDLP + IALRP  PRDSAR++VV P+   P V+ D  V DLP+FL   DA+V
Sbjct: 1   MRVDLFDFDLPENSIALRPASPRDSARMLVVRPD-GAP-VLEDRGVLDLPSFLRPGDALV 58

Query: 61  FNNTKVITAQLNGVRFCHINRREK---EISCTLHMRVSPNSWSVYARPSKVIKKGDILHF 117
           FN+TKVI AQL GVR+    R E     +S TLHMRV+P+ W  +ARP++ +K GD + F
Sbjct: 59  FNDTKVIPAQLEGVRY----RGEDISTPVSLTLHMRVAPSRWKAFARPARRLKPGDRISF 114

Query: 118 FSQDGQS----RLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPID 173
               G +     LEA V +K + GE+ L F +SG  L+  I  VG IPLPPYIA KR  D
Sbjct: 115 -GHGGNACLLGSLEAVVEEKGDAGEVTLRFDLSGPSLDEAIMAVGHIPLPPYIASKRADD 173

Query: 174 ARDYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVE 233
            RD  DYQT YA+ +G+VAAPTAGLHFT  L ++L   GI+ YFVTLHVGAGTF+PVK +
Sbjct: 174 ERDRTDYQTVYAREEGAVAAPTAGLHFTDRLFAKLDEGGIERYFVTLHVGAGTFLPVKAD 233

Query: 234 DTDDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFT 293
           DT DH+MH EIG +D  TA  LN+V+ RGGRIV VGTTSLRL+E+A  EDG I PWSG T
Sbjct: 234 DTADHVMHEEIGHVDPVTAAKLNAVRERGGRIVCVGTTSLRLIESAAAEDGNIRPWSGAT 293

Query: 294 NIFITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDT 353
            IFITPGYRFRAVD+LM+NFHLPKSTL MLVSAF G+E     Y HAI+  YRFYSYGD+
Sbjct: 294 GIFITPGYRFRAVDMLMTNFHLPKSTLFMLVSAFAGLETMHAAYAHAIATGYRFYSYGDS 353

Query: 354 SLLFQK 359
           SLLF+K
Sbjct: 354 SLLFRK 359


>gi|15965338|ref|NP_385691.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Sinorhizobium meliloti 1021]
 gi|21263893|sp|Q92PY5|QUEA_RHIME RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|15074518|emb|CAC46164.1| Probable S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase(queuosine biosynthesis
           protein QueA) [Sinorhizobium meliloti 1021]
          Length = 360

 Score =  427 bits (1099), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 219/366 (59%), Positives = 262/366 (71%), Gaps = 14/366 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  FDFDLP + IALRP  PRDSAR++VV P+   P V+ D  V DLP+FL   DA+V
Sbjct: 1   MRVDLFDFDLPENSIALRPASPRDSARMLVVRPD-GAP-VLEDRGVLDLPSFLRPGDALV 58

Query: 61  FNNTKVITAQLNGVRFCHINRREK---EISCTLHMRVSPNSWSVYARPSKVIKKGDILHF 117
           FN+TKVI AQL GVR+    R E     +S TLHMRV+P+ W  +ARP++ +K GD + F
Sbjct: 59  FNDTKVIPAQLEGVRY----RGEDISTPVSLTLHMRVAPSRWKAFARPARRLKPGDRISF 114

Query: 118 FSQDGQS----RLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPID 173
               G +     LEA V +K + GE+ L F +SG  L+  I  VG IPLPPYIA KR  D
Sbjct: 115 -GHGGSACLLGSLEAVVEEKGDAGEVTLRFDLSGPSLDEAIMAVGHIPLPPYIASKRADD 173

Query: 174 ARDYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVE 233
            RD  DYQT YA+ +G+VAAPTAGLHFT  L ++L   GI+ YFVTLHVGAGTF+PVK +
Sbjct: 174 ERDRTDYQTVYAREEGAVAAPTAGLHFTDRLFAKLDEGGIERYFVTLHVGAGTFLPVKAD 233

Query: 234 DTDDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFT 293
           DT DH+MH EIG +D  TA  LN+V+ RGGRIV VGTTSLRL+E+A  EDG I PWSG T
Sbjct: 234 DTADHVMHEEIGHVDPVTAAKLNAVRERGGRIVCVGTTSLRLIESAAAEDGNIRPWSGAT 293

Query: 294 NIFITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDT 353
            IFITPGYRFRAVD+LM+NFHLPKSTL MLVSAF G+E     Y HAI+  YRFYSYGD+
Sbjct: 294 GIFITPGYRFRAVDMLMTNFHLPKSTLFMLVSAFAGLETMHAAYAHAIATGYRFYSYGDS 353

Query: 354 SLLFQK 359
           SLLF+K
Sbjct: 354 SLLFRK 359


>gi|307312710|ref|ZP_07592341.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Sinorhizobium meliloti BL225C]
 gi|306899435|gb|EFN30067.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Sinorhizobium meliloti BL225C]
          Length = 360

 Score =  427 bits (1097), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 219/366 (59%), Positives = 261/366 (71%), Gaps = 14/366 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  FDFDLP + IALRP  PRDSAR++VV P+   P V  D  V DLP+FL   DA+V
Sbjct: 1   MRVDLFDFDLPENSIALRPASPRDSARMLVVRPD-GAP-VFEDRGVLDLPSFLRPGDALV 58

Query: 61  FNNTKVITAQLNGVRFCHINRREK---EISCTLHMRVSPNSWSVYARPSKVIKKGDILHF 117
           FN+TKVI AQL GVR+    R E     +S TLHMRV+P+ W  +ARP++ +K GD + F
Sbjct: 59  FNDTKVIPAQLEGVRY----RGEDISTPVSLTLHMRVAPSRWKAFARPARRLKPGDRISF 114

Query: 118 FSQDGQS----RLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPID 173
               G +     LEA V +K + GE+ L F +SG  L+  I  VG IPLPPYIA KR  D
Sbjct: 115 -GHGGSACLLGSLEAVVEEKGDAGEVTLRFDLSGPSLDEAIMAVGHIPLPPYIASKRADD 173

Query: 174 ARDYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVE 233
            RD  DYQT YA+ +G+VAAPTAGLHFT  L ++L   GI+ YFVTLHVGAGTF+PVK +
Sbjct: 174 ERDRTDYQTVYAREEGAVAAPTAGLHFTDRLFAKLDEGGIERYFVTLHVGAGTFLPVKAD 233

Query: 234 DTDDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFT 293
           DT DH+MH EIG +D  TA  LN+V+ RGGRIV VGTTSLRL+E+A  EDG I PWSG T
Sbjct: 234 DTADHVMHEEIGHVDPVTAAKLNAVRERGGRIVCVGTTSLRLIESAAAEDGNIRPWSGAT 293

Query: 294 NIFITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDT 353
            IFITPGYRFRAVD+LM+NFHLPKSTL MLVSAF G+E     Y HAI+  YRFYSYGD+
Sbjct: 294 GIFITPGYRFRAVDMLMTNFHLPKSTLFMLVSAFAGLETMHAAYAHAIATGYRFYSYGDS 353

Query: 354 SLLFQK 359
           SLLF+K
Sbjct: 354 SLLFRK 359


>gi|150396485|ref|YP_001326952.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Sinorhizobium medicae WSM419]
 gi|166218742|sp|A6U8Y7|QUEA_SINMW RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|150028000|gb|ABR60117.1| Queuosine biosynthesis protein [Sinorhizobium medicae WSM419]
          Length = 360

 Score =  424 bits (1091), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 214/365 (58%), Positives = 261/365 (71%), Gaps = 12/365 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  FDFDLP   +ALRP  PRDSAR++VV P      V+ D  V DLP+FL   DA+V
Sbjct: 1   MRVDLFDFDLPEDSVALRPASPRDSARMLVVRPGGEP--VLEDRGVLDLPSFLRQGDALV 58

Query: 61  FNNTKVITAQLNGVRF--CHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFF 118
           FN+TKVI AQL GVR+   HI+     +S TLHMRV+P+ W  +ARP++ +K GD + F 
Sbjct: 59  FNDTKVIPAQLEGVRYRGEHIS---TPVSLTLHMRVAPDRWKAFARPARRLKPGDRVSF- 114

Query: 119 SQDGQS----RLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDA 174
              G +     L+A V +K + GE+ L F +SG  L+  I  VG IPLPPYIA KR  DA
Sbjct: 115 GHGGNACLLGSLDAMVEEKGDAGEVTLRFDLSGPSLDEAIMSVGHIPLPPYIASKRADDA 174

Query: 175 RDYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVED 234
           RD  DYQT YA+ +G+VAAPTAGLHFT  L + L   GI+ +FVTLHVGAGTF+PVK +D
Sbjct: 175 RDRTDYQTVYAREEGAVAAPTAGLHFTDRLFAMLDEAGIERHFVTLHVGAGTFLPVKADD 234

Query: 235 TDDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTN 294
           TDDH+MH EIG +DA TA  LN+V+ RGGR+V VGTTSLRL+E+A  EDG I+ WSG T 
Sbjct: 235 TDDHVMHEEIGHVDAVTAAKLNAVRERGGRVVCVGTTSLRLVESAAAEDGTIHAWSGATG 294

Query: 295 IFITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTS 354
           IFITPGYRFRA  +LM+NFHLPKSTL MLVSAF G+E  +  Y HAI+  YRFYSYGD+S
Sbjct: 295 IFITPGYRFRAAHMLMTNFHLPKSTLFMLVSAFAGLETMRDAYAHAIATGYRFYSYGDSS 354

Query: 355 LLFQK 359
           LLF+K
Sbjct: 355 LLFRK 359


>gi|209549347|ref|YP_002281264.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|226713846|sp|B5ZPR8|QUEA_RHILW RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|209535103|gb|ACI55038.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 379

 Score =  424 bits (1089), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 219/379 (57%), Positives = 260/379 (68%), Gaps = 22/379 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNL-------SCP---------LVISDH 44
           M V  FDFDLP  RIALRP  PRDSARL+VV+P+        S P            SDH
Sbjct: 1   MRVDLFDFDLPDERIALRPAEPRDSARLLVVNPHAESRPHAESVPHAESRPHAESAFSDH 60

Query: 45  LVSDLPAFLNSNDAIVFNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYAR 104
            V DLP+FL + DA+VFN+TKVI AQL G+R        +++S TLHMRV P+ W  +A+
Sbjct: 61  RVGDLPSFLRAGDALVFNDTKVIPAQLEGIRH-RDGAGGQQVSATLHMRVGPSRWKAFAK 119

Query: 105 PSKVIKKGDILHFFSQDGQS----RLEATVIDKWNTGEILLVFSISGIELERQISLVGTI 160
           P K IK+GD +  F   G+S     L+ATV +K   GE+ L F +SG  L+  I+ VG I
Sbjct: 120 PGKRIKEGDRI-AFGHSGESCLLGSLDATVEEKGEAGEVTLAFDLSGPALDEAIAAVGHI 178

Query: 161 PLPPYIARKRPIDARDYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTL 220
           PLPPYIA KRP D RD  DYQT YA+ +G+VAAPTAGLHFT  L   L   GI+ +FVTL
Sbjct: 179 PLPPYIAAKRPEDERDRADYQTIYAREEGAVAAPTAGLHFTPALFEALDRAGIERHFVTL 238

Query: 221 HVGAGTFMPVKVEDTDDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETAT 280
           HVGAGTF+PVK +DT DH MH E G + A TA  LN+VK+RGGRIV VGTTSLRL+E+A 
Sbjct: 239 HVGAGTFLPVKADDTADHKMHLESGTVSAETAARLNAVKARGGRIVCVGTTSLRLIESAA 298

Query: 281 TEDGIINPWSGFTNIFITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHA 340
            E G I  WSG T IFITPGYRF+AVD+LM+NFHLP+STL MLVSAF G E     Y+HA
Sbjct: 299 EESGEIRGWSGATGIFITPGYRFKAVDMLMTNFHLPRSTLFMLVSAFSGFETMHAAYKHA 358

Query: 341 ISHAYRFYSYGDTSLLFQK 359
           IS  YRFYSYGD SLLF+K
Sbjct: 359 ISTGYRFYSYGDASLLFRK 377


>gi|254719159|ref|ZP_05180970.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           sp. 83/13]
 gi|265984153|ref|ZP_06096888.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           sp. 83/13]
 gi|306838150|ref|ZP_07471006.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           sp. NF 2653]
 gi|264662745|gb|EEZ33006.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           sp. 83/13]
 gi|306406740|gb|EFM62963.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           sp. NF 2653]
          Length = 363

 Score =  418 bits (1074), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 212/360 (58%), Positives = 257/360 (71%), Gaps = 11/360 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  FDFDLP  RIALRPV PRD A+L+ V P         D  V DLP  L   DA+V
Sbjct: 1   MRVDLFDFDLPEERIALRPVEPRDHAKLLHVRPGQP----FEDRHVYDLPDLLQPGDALV 56

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FN+TKVI AQL G+R    N    ++S TLHMRV P+ W  + RP+K +K+GD + F   
Sbjct: 57  FNDTKVIPAQLEGMRERTGNI--SQVSATLHMRVGPDRWKAFLRPAKRVKEGDRIRF-GH 113

Query: 121 DGQS----RLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARD 176
            G S     L+ATV +K + GE LLVF +SG  L+  I+ VG IPLPPYIA KRP D RD
Sbjct: 114 SGTSCFLGTLDATVAEKGDAGEALLVFDLSGAVLDEAIAAVGHIPLPPYIASKRPEDERD 173

Query: 177 YVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTD 236
             DYQT YA+ +G+VAAPTAGLHFT +LL ++ + GI+ +FVTLHVGAGTF+PVK +DT 
Sbjct: 174 RKDYQTVYAREEGAVAAPTAGLHFTPDLLEKIKARGIEEHFVTLHVGAGTFLPVKADDTG 233

Query: 237 DHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIF 296
           DH MH+EIG +   TA ALN+V  RGGRI+ VGTTSLRL+E+AT EDGI+ PWSG T+IF
Sbjct: 234 DHKMHAEIGHVSQRTASALNAVHERGGRIICVGTTSLRLIESATGEDGIVRPWSGATDIF 293

Query: 297 ITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           ITPGYRFRAVD+LM+NFHLP+STL MLVSAF G++     Y +AI+  YRFYSYGD SLL
Sbjct: 294 ITPGYRFRAVDLLMTNFHLPRSTLFMLVSAFSGLDTMHAAYNYAIADGYRFYSYGDASLL 353


>gi|17987172|ref|NP_539806.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           melitensis bv. 1 str. 16M]
 gi|23501970|ref|NP_698097.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           suis 1330]
 gi|62290007|ref|YP_221800.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           abortus bv. 1 str. 9-941]
 gi|82699935|ref|YP_414509.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           melitensis biovar Abortus 2308]
 gi|148560477|ref|YP_001259016.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           ovis ATCC 25840]
 gi|161619043|ref|YP_001592930.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           canis ATCC 23365]
 gi|163843359|ref|YP_001627763.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           suis ATCC 23445]
 gi|189024248|ref|YP_001935016.1| Queuosine biosynthesis protein [Brucella abortus S19]
 gi|237815515|ref|ZP_04594512.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           abortus str. 2308 A]
 gi|254689322|ref|ZP_05152576.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           abortus bv. 6 str. 870]
 gi|254697454|ref|ZP_05159282.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           abortus bv. 2 str. 86/8/59]
 gi|254701839|ref|ZP_05163667.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           suis bv. 5 str. 513]
 gi|254704384|ref|ZP_05166212.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           suis bv. 3 str. 686]
 gi|254706720|ref|ZP_05168548.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           pinnipedialis M163/99/10]
 gi|254710173|ref|ZP_05171984.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           pinnipedialis B2/94]
 gi|254714171|ref|ZP_05175982.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           ceti M644/93/1]
 gi|254717606|ref|ZP_05179417.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           ceti M13/05/1]
 gi|254730352|ref|ZP_05188930.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           abortus bv. 4 str. 292]
 gi|256031667|ref|ZP_05445281.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           pinnipedialis M292/94/1]
 gi|256044752|ref|ZP_05447656.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           melitensis bv. 1 str. Rev.1]
 gi|256061179|ref|ZP_05451331.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           neotomae 5K33]
 gi|256113652|ref|ZP_05454463.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           melitensis bv. 3 str. Ether]
 gi|256159818|ref|ZP_05457555.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           ceti M490/95/1]
 gi|256255069|ref|ZP_05460605.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           ceti B1/94]
 gi|256257569|ref|ZP_05463105.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           abortus bv. 9 str. C68]
 gi|256369519|ref|YP_003107029.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           microti CCM 4915]
 gi|260546562|ref|ZP_05822301.1| queuosine biosynthesis protein [Brucella abortus NCTC 8038]
 gi|260565646|ref|ZP_05836130.1| queuosine biosynthesis protein [Brucella melitensis bv. 1 str. 16M]
 gi|260566370|ref|ZP_05836840.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           suis bv. 4 str. 40]
 gi|260754835|ref|ZP_05867183.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           abortus bv. 6 str. 870]
 gi|260758052|ref|ZP_05870400.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           abortus bv. 4 str. 292]
 gi|260761877|ref|ZP_05874220.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           abortus bv. 2 str. 86/8/59]
 gi|260883847|ref|ZP_05895461.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           abortus bv. 9 str. C68]
 gi|261219439|ref|ZP_05933720.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           ceti M13/05/1]
 gi|261222259|ref|ZP_05936540.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           ceti B1/94]
 gi|261314184|ref|ZP_05953381.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           pinnipedialis M163/99/10]
 gi|261317727|ref|ZP_05956924.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           pinnipedialis B2/94]
 gi|261321935|ref|ZP_05961132.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           ceti M644/93/1]
 gi|261325182|ref|ZP_05964379.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           neotomae 5K33]
 gi|261752398|ref|ZP_05996107.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           suis bv. 5 str. 513]
 gi|261755058|ref|ZP_05998767.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           suis bv. 3 str. 686]
 gi|265988758|ref|ZP_06101315.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           pinnipedialis M292/94/1]
 gi|265991173|ref|ZP_06103730.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           melitensis bv. 1 str. Rev.1]
 gi|265995009|ref|ZP_06107566.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           melitensis bv. 3 str. Ether]
 gi|265998224|ref|ZP_06110781.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           ceti M490/95/1]
 gi|294852432|ref|ZP_06793105.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           sp. NVSL 07-0026]
 gi|297248409|ref|ZP_06932127.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           abortus bv. 5 str. B3196]
 gi|54038975|sp|P65949|QUEA_BRUSU RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|54041779|sp|P65948|QUEA_BRUME RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|75496776|sp|Q57D45|QUEA_BRUAB RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|91207414|sp|Q2YPY7|QUEA_BRUA2 RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|166216704|sp|A5VQL9|QUEA_BRUO2 RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|189038511|sp|A9M5A4|QUEA_BRUC2 RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|189038512|sp|B0CGP2|QUEA_BRUSI RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|238689369|sp|B2S5U5|QUEA_BRUA1 RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|17982839|gb|AAL52070.1| s-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           melitensis bv. 1 str. 16M]
 gi|23347918|gb|AAN30012.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           suis 1330]
 gi|62196139|gb|AAX74439.1| QueA, S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Brucella abortus bv. 1 str. 9-941]
 gi|82616036|emb|CAJ11072.1| Queuosine biosynthesis protein [Brucella melitensis biovar Abortus
           2308]
 gi|148371734|gb|ABQ61713.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           ovis ATCC 25840]
 gi|161335854|gb|ABX62159.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           canis ATCC 23365]
 gi|163674082|gb|ABY38193.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           suis ATCC 23445]
 gi|189019820|gb|ACD72542.1| Queuosine biosynthesis protein [Brucella abortus S19]
 gi|237788813|gb|EEP63024.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           abortus str. 2308 A]
 gi|255999681|gb|ACU48080.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           microti CCM 4915]
 gi|260095612|gb|EEW79489.1| queuosine biosynthesis protein [Brucella abortus NCTC 8038]
 gi|260151714|gb|EEW86808.1| queuosine biosynthesis protein [Brucella melitensis bv. 1 str. 16M]
 gi|260155888|gb|EEW90968.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           suis bv. 4 str. 40]
 gi|260668370|gb|EEX55310.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           abortus bv. 4 str. 292]
 gi|260672309|gb|EEX59130.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           abortus bv. 2 str. 86/8/59]
 gi|260674943|gb|EEX61764.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           abortus bv. 6 str. 870]
 gi|260873375|gb|EEX80444.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           abortus bv. 9 str. C68]
 gi|260920843|gb|EEX87496.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           ceti B1/94]
 gi|260924528|gb|EEX91096.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           ceti M13/05/1]
 gi|261294625|gb|EEX98121.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           ceti M644/93/1]
 gi|261296950|gb|EEY00447.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           pinnipedialis B2/94]
 gi|261301162|gb|EEY04659.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           neotomae 5K33]
 gi|261303210|gb|EEY06707.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           pinnipedialis M163/99/10]
 gi|261742151|gb|EEY30077.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           suis bv. 5 str. 513]
 gi|261744811|gb|EEY32737.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           suis bv. 3 str. 686]
 gi|262552692|gb|EEZ08682.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           ceti M490/95/1]
 gi|262766122|gb|EEZ11911.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           melitensis bv. 3 str. Ether]
 gi|263001957|gb|EEZ14532.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           melitensis bv. 1 str. Rev.1]
 gi|264660955|gb|EEZ31216.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           pinnipedialis M292/94/1]
 gi|294821021|gb|EFG38020.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           sp. NVSL 07-0026]
 gi|297175578|gb|EFH34925.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           abortus bv. 5 str. B3196]
          Length = 363

 Score =  417 bits (1073), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 211/360 (58%), Positives = 258/360 (71%), Gaps = 11/360 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  FDFDLP  RIALRPV PRD A+L+ V P         D  V DLP  L   DA+V
Sbjct: 1   MRVDLFDFDLPEERIALRPVEPRDHAKLLHVRPGEP----FEDRHVYDLPDLLQPGDALV 56

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FN+TKVI AQL G+R    N    ++S TLHMRV P+ W  + RP+K +K+GD + F   
Sbjct: 57  FNDTKVIPAQLEGMRERTGNI--SQVSATLHMRVGPDRWKAFLRPAKRVKEGDRIRF-GH 113

Query: 121 DGQS----RLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARD 176
            G S     L+ATV +K ++GE LLVF +SG  L+  I+ VG IPLPPYIA KRP D RD
Sbjct: 114 SGTSCFLGTLDATVAEKGDSGEALLVFDLSGAVLDEAIAAVGHIPLPPYIASKRPEDERD 173

Query: 177 YVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTD 236
             DYQT YA+ +G+VAAPTAGLHFT +LL ++ + GI+ +FVTLHVGAGTF+PVK +DT 
Sbjct: 174 RKDYQTVYAREEGAVAAPTAGLHFTPDLLEKIKARGIEEHFVTLHVGAGTFLPVKADDTG 233

Query: 237 DHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIF 296
           DH MH+EIG +   TA ALN+V  RGGRI+ VGTTSLRL+E+AT EDG++ PWSG T+IF
Sbjct: 234 DHKMHAEIGHVSQRTASALNAVHERGGRIICVGTTSLRLIESATGEDGVVRPWSGATDIF 293

Query: 297 ITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           ITPGYRFRAVD+LM+NFHLP+STL MLVSAF G++     Y +AI+  YRFYSYGD SLL
Sbjct: 294 ITPGYRFRAVDLLMTNFHLPRSTLFMLVSAFSGLDTMHAAYNYAIADGYRFYSYGDASLL 353


>gi|110633758|ref|YP_673966.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Mesorhizobium sp. BNC1]
 gi|123057977|sp|Q11IH4|QUEA_MESSB RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|110284742|gb|ABG62801.1| Queuosine biosynthesis protein [Chelativorans sp. BNC1]
          Length = 358

 Score =  417 bits (1072), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 209/366 (57%), Positives = 261/366 (71%), Gaps = 17/366 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  FDFDLP  RIALRP  PRDSAR++VV P       + D +V DLP FL   DA+V
Sbjct: 1   MRVDLFDFDLPEERIALRPASPRDSARMLVVRPGKP----LEDCIVRDLPQFLRPGDALV 56

Query: 61  FNNTKVITAQLNGVRFCHINRREK---EISCTLHMRVSPNSWSVYARPSKVIKKGDILHF 117
           FN+TKVI A+L+G+R     RR +   +I  TLHMR  P+ W  + +P+K +  G+ + F
Sbjct: 57  FNDTKVIPARLSGIR-----RRGETVAQIEATLHMRAGPDRWKAFLKPAKRVAVGERIQF 111

Query: 118 FSQDGQS----RLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPID 173
              DG+S     L+ATV +K   GE LLVF  SG  L+  I+  G +PLPPYIA KRP D
Sbjct: 112 -GHDGESCFLGSLDATVAEKGEGGEALLVFDFSGPVLDEAIAAAGHVPLPPYIASKRPDD 170

Query: 174 ARDYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVE 233
            RD  DYQT YA+ +G+VAAPTAGLHFT +L S L +IG++ +FVTLHVGAGTF+PVK E
Sbjct: 171 ERDRADYQTIYAREEGAVAAPTAGLHFTPDLFSALDTIGVERHFVTLHVGAGTFLPVKAE 230

Query: 234 DTDDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFT 293
           DT+ H MH+E G +D  TA ALN+V++RGG I++VGTTSLRLLE+A    G++  WSG T
Sbjct: 231 DTEAHRMHAEWGEVDGMTADALNAVRARGGCIIAVGTTSLRLLESAAEPSGLLKAWSGET 290

Query: 294 NIFITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDT 353
           +IFITPGYRFRA+DILM+NFHLP+STL MLVSAF G+E  K  Y HAI   YRFYSYGD+
Sbjct: 291 DIFITPGYRFRAIDILMTNFHLPRSTLFMLVSAFSGLETMKSAYSHAIDQGYRFYSYGDS 350

Query: 354 SLLFQK 359
           SLLF++
Sbjct: 351 SLLFRE 356


>gi|306841819|ref|ZP_07474502.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           sp. BO2]
 gi|306288100|gb|EFM59494.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           sp. BO2]
          Length = 363

 Score =  417 bits (1072), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 211/360 (58%), Positives = 256/360 (71%), Gaps = 11/360 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  FDFDLP  RIALRPV PRD A+L+ V P         D  V DLP  L   DA+V
Sbjct: 1   MRVDLFDFDLPEERIALRPVEPRDHAKLLHVRPGQP----FEDRHVYDLPDLLQPGDALV 56

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FN+TKVI AQL G+R         ++S TLHMRV P+ W  + RP+K +K+GD + F   
Sbjct: 57  FNDTKVIPAQLEGMR--ERTGSISQVSATLHMRVGPDRWKAFLRPAKRVKEGDRIRF-GH 113

Query: 121 DGQS----RLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARD 176
            G S     L+ATV +K + GE LLVF +SG  L+  I+ VG IPLPPYIA KRP D RD
Sbjct: 114 SGTSCFLGTLDATVAEKGDAGEALLVFDLSGAVLDEAIAAVGHIPLPPYIASKRPEDERD 173

Query: 177 YVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTD 236
             DYQT YA+ +G+VAAPTAGLHFT +LL ++ + GI+ +FVTLHVGAGTF+PVK +DT 
Sbjct: 174 RKDYQTVYAREEGAVAAPTAGLHFTPDLLEKIKARGIEEHFVTLHVGAGTFLPVKADDTG 233

Query: 237 DHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIF 296
           DH MH+EIG +   TA ALN+V  RGGRI+ VGTTSLRL+E+AT EDGI+ PWSG T+IF
Sbjct: 234 DHKMHAEIGHVSQRTASALNAVHERGGRIICVGTTSLRLIESATGEDGIVRPWSGATDIF 293

Query: 297 ITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           ITPGYRFRAVD+LM+NFHLP+STL MLVSAF G++     Y +AI+  YRFYSYGD SLL
Sbjct: 294 ITPGYRFRAVDLLMTNFHLPRSTLFMLVSAFSGLDTMHAAYNYAIADGYRFYSYGDASLL 353


>gi|225627567|ref|ZP_03785604.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           ceti str. Cudo]
 gi|260168801|ref|ZP_05755612.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           sp. F5/99]
 gi|261758283|ref|ZP_06001992.1| queuosine biosynthesis protein [Brucella sp. F5/99]
 gi|225617572|gb|EEH14617.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           ceti str. Cudo]
 gi|261738267|gb|EEY26263.1| queuosine biosynthesis protein [Brucella sp. F5/99]
          Length = 363

 Score =  416 bits (1069), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 210/360 (58%), Positives = 257/360 (71%), Gaps = 11/360 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  FDFDLP  RI LRPV PRD A+L+ V P         D  V DLP  L   DA+V
Sbjct: 1   MRVDLFDFDLPEERITLRPVEPRDHAKLLHVRPGEP----FEDRHVYDLPDLLQPGDALV 56

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FN+TKVI AQL G+R    N    ++S TLHMRV P+ W  + RP+K +K+GD + F   
Sbjct: 57  FNDTKVIPAQLEGMRERTGNI--SQVSATLHMRVGPDRWKAFLRPAKRVKEGDRIRF-GH 113

Query: 121 DGQS----RLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARD 176
            G S     L+ATV +K ++GE LLVF +SG  L+  I+ VG IPLPPYIA KRP D RD
Sbjct: 114 SGTSCFLGTLDATVAEKGDSGEALLVFDLSGAVLDEAIAAVGHIPLPPYIASKRPEDERD 173

Query: 177 YVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTD 236
             DYQT YA+ +G+VAAPTAGLHFT +LL ++ + GI+ +FVTLHVGAGTF+PVK +DT 
Sbjct: 174 RKDYQTVYAREEGAVAAPTAGLHFTPDLLEKIKARGIEEHFVTLHVGAGTFLPVKADDTG 233

Query: 237 DHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIF 296
           DH MH+EIG +   TA ALN+V  RGGRI+ VGTTSLRL+E+AT EDG++ PWSG T+IF
Sbjct: 234 DHKMHAEIGHVSQRTASALNAVHERGGRIICVGTTSLRLIESATGEDGVVRPWSGATDIF 293

Query: 297 ITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           ITPGYRFRAVD+LM+NFHLP+STL MLVSAF G++     Y +AI+  YRFYSYGD SLL
Sbjct: 294 ITPGYRFRAVDLLMTNFHLPRSTLFMLVSAFSGLDTMHAAYNYAIADGYRFYSYGDASLL 353


>gi|254693807|ref|ZP_05155635.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           abortus bv. 3 str. Tulya]
 gi|261214086|ref|ZP_05928367.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           abortus bv. 3 str. Tulya]
 gi|260915693|gb|EEX82554.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           abortus bv. 3 str. Tulya]
          Length = 363

 Score =  416 bits (1068), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 211/360 (58%), Positives = 257/360 (71%), Gaps = 11/360 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  FDFDLP  RIALRPV PRD A+L+ V P         D  V DLP  L   DA+V
Sbjct: 1   MRVDLFDFDLPEERIALRPVEPRDHAKLLHVRPGEP----FEDRHVYDLPDLLQPGDALV 56

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FN+TKVI AQL G+R    N    ++S TLHMRV P+ W  + RP+K +K+GD + F   
Sbjct: 57  FNDTKVIPAQLEGMRERTGNI--SQVSATLHMRVGPDRWKAFLRPAKRVKEGDRIRF-GH 113

Query: 121 DGQS----RLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARD 176
            G S     L+ATV +K ++GE LLVF +SG  L+  I+ VG IPLPPYIA KRP D RD
Sbjct: 114 SGTSCFLGTLDATVAEKGDSGEALLVFDLSGAVLDEAIAAVGHIPLPPYIASKRPEDERD 173

Query: 177 YVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTD 236
             DYQT YA+ +G+VAAPTAGLHFT +LL ++ + GI+ +FVTLHVGAGTF+PVK +DT 
Sbjct: 174 RKDYQTVYAREEGAVAAPTAGLHFTPDLLEKIKARGIEEHFVTLHVGAGTFLPVKADDTG 233

Query: 237 DHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIF 296
           DH MH+EIG +   TA ALN+V  RGGRI+ VGTTSLRL+E+AT EDG++ PWSG T IF
Sbjct: 234 DHKMHAEIGHVSQRTASALNAVHERGGRIICVGTTSLRLIESATGEDGVVRPWSGATYIF 293

Query: 297 ITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           ITPGYRFRAVD+LM+NFHLP+STL MLVSAF G++     Y +AI+  YRFYSYGD SLL
Sbjct: 294 ITPGYRFRAVDLLMTNFHLPRSTLFMLVSAFSGLDTMHAAYNYAIADGYRFYSYGDASLL 353


>gi|306843960|ref|ZP_07476555.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           sp. BO1]
 gi|306275715|gb|EFM57439.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           sp. BO1]
          Length = 363

 Score =  415 bits (1067), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 210/360 (58%), Positives = 257/360 (71%), Gaps = 11/360 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  FDFDLP  RIALRPV PRD A+L+ + P         D  V DLP  L   DA+V
Sbjct: 1   MRVDLFDFDLPEERIALRPVEPRDHAKLLHIRPGQP----FEDRHVYDLPDLLQPGDALV 56

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FN+TKVI AQL G+R    N    ++S TLHMRV P+ W  + RP+K +K+GD + F   
Sbjct: 57  FNDTKVIPAQLEGMRERTGNI--SQVSATLHMRVGPDRWKAFLRPAKRVKEGDRIRF-GH 113

Query: 121 DGQS----RLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARD 176
            G S     L+ATV +K + GE LLVF +SG  L+  I+ VG IPLPPYIA KRP D RD
Sbjct: 114 SGTSCFLGTLDATVAEKGDAGEALLVFDLSGAVLDEAIAAVGHIPLPPYIASKRPEDERD 173

Query: 177 YVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTD 236
             DYQT YA+ +G+VAAPTAGLHFT +LL ++ + GI+ +FVTLHVGAGTF+PVK +DT 
Sbjct: 174 RKDYQTVYAREEGAVAAPTAGLHFTPDLLEKIKARGIEEHFVTLHVGAGTFLPVKADDTG 233

Query: 237 DHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIF 296
           DH MH+EIG +   TA ALN+V  RGGRI+ VGTTSLRL+E+A+ EDGI+ PWSG T+IF
Sbjct: 234 DHKMHAEIGHVSQRTASALNAVHERGGRIICVGTTSLRLIESASGEDGIVRPWSGATDIF 293

Query: 297 ITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           ITPGYRFRAVD+LM+NFHLP+STL MLVSAF G++     Y +AI+  YRFYSYGD SLL
Sbjct: 294 ITPGYRFRAVDLLMTNFHLPRSTLFMLVSAFSGLDTMHAAYNYAIADDYRFYSYGDASLL 353


>gi|153009507|ref|YP_001370722.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Ochrobactrum anthropi ATCC 49188]
 gi|166216733|sp|A6X0Y9|QUEA_OCHA4 RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|151561395|gb|ABS14893.1| Queuosine biosynthesis protein [Ochrobactrum anthropi ATCC 49188]
          Length = 363

 Score =  414 bits (1064), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 208/360 (57%), Positives = 253/360 (70%), Gaps = 11/360 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  FDFDLP   IALRP  PRD ARL+ V P         D  V +LP  L   DA+V
Sbjct: 1   MRVDLFDFDLPEESIALRPAEPRDHARLLRVRPGQP----FEDRQVFELPDLLQPGDALV 56

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FN+TKVI AQL G+R    N    ++S TLHMR  P+ W  + RP K +K+GD + F   
Sbjct: 57  FNDTKVIPAQLEGMRERDGNI--SQVSATLHMRTGPDRWKAFLRPGKRVKEGDRIRF-GH 113

Query: 121 DGQS----RLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARD 176
            G S     L+ATV +K + GE LLVF +SG  L+  I+ VG IPLPPYIA KR  D RD
Sbjct: 114 SGSSCFLGTLDATVAEKGDAGEALLVFDLSGAMLDEAIASVGHIPLPPYIASKRAEDERD 173

Query: 177 YVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTD 236
             DYQT YA+ +G+VAAPTAGLHFT +LL ++ + G++ +FVTLHVGAGTF+PVK +DT 
Sbjct: 174 RKDYQTVYAREEGAVAAPTAGLHFTPDLLEKIKAKGVEEHFVTLHVGAGTFLPVKADDTT 233

Query: 237 DHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIF 296
           DH MHSEIG++   TA ALN+V  RGG+I+ VGTTSLRL+E+A  EDGII PW+G T+IF
Sbjct: 234 DHKMHSEIGYVSQRTADALNAVHERGGKIICVGTTSLRLIESAAGEDGIIRPWAGATDIF 293

Query: 297 ITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           ITPGY+FRAVD+LM+NFHLP+STL MLVSAF G E     Y+HAIS+ YRFYSYGD SLL
Sbjct: 294 ITPGYKFRAVDLLMTNFHLPRSTLFMLVSAFSGFETMHAAYEHAISNGYRFYSYGDASLL 353


>gi|225852594|ref|YP_002732827.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           melitensis ATCC 23457]
 gi|256263912|ref|ZP_05466444.1| queuosine biosynthesis protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|254764268|sp|C0RJ65|QUEA_BRUMB RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|225640959|gb|ACO00873.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           melitensis ATCC 23457]
 gi|263094045|gb|EEZ17979.1| queuosine biosynthesis protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|326409115|gb|ADZ66180.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           melitensis M28]
 gi|326538822|gb|ADZ87037.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Brucella
           melitensis M5-90]
          Length = 363

 Score =  413 bits (1061), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 210/360 (58%), Positives = 257/360 (71%), Gaps = 11/360 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  FDFDLP  RIALRPV PRD A+L+ V P         D  V DL   L   DA+V
Sbjct: 1   MRVDLFDFDLPEERIALRPVEPRDHAKLLHVRPGEP----FEDRHVYDLFDLLQPGDALV 56

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FN+TKVI AQL G+R    N    ++S TLHMRV P+ W  + RP+K +K+GD + F   
Sbjct: 57  FNDTKVIPAQLEGMRERTGNI--SQVSATLHMRVGPDRWKAFLRPAKRVKEGDRIRF-GH 113

Query: 121 DGQS----RLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARD 176
            G S     L+ATV +K ++GE LLVF +SG  L+  I+ VG IPLPPYIA KRP D RD
Sbjct: 114 SGTSCFLGTLDATVAEKGDSGEALLVFDLSGAVLDEAIAAVGHIPLPPYIASKRPEDERD 173

Query: 177 YVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTD 236
             DYQT YA+ +G+VAAPTAGLHFT +LL ++ + GI+ +FVTLHVGAGTF+PVK +DT 
Sbjct: 174 RKDYQTVYAREEGAVAAPTAGLHFTPDLLEKIKARGIEEHFVTLHVGAGTFLPVKADDTG 233

Query: 237 DHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIF 296
           DH MH+EIG +   TA ALN+V  RGGRI+ VGTTSLRL+E+AT EDG++ PWSG T+IF
Sbjct: 234 DHKMHAEIGHVSQRTASALNAVHERGGRIICVGTTSLRLIESATGEDGVVRPWSGATDIF 293

Query: 297 ITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           ITPGYRFRAVD+LM+NFHLP+STL MLVSAF G++     Y +AI+  YRFYSYGD SLL
Sbjct: 294 ITPGYRFRAVDLLMTNFHLPRSTLFMLVSAFSGLDTMHAAYNYAIADGYRFYSYGDASLL 353


>gi|239831893|ref|ZP_04680222.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Ochrobactrum intermedium LMG 3301]
 gi|239824160|gb|EEQ95728.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Ochrobactrum intermedium LMG 3301]
          Length = 363

 Score =  410 bits (1055), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 208/360 (57%), Positives = 254/360 (70%), Gaps = 11/360 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  FDFDLP   IALRP+ PRD ARL+ V P         D  V +LP  L+  DA+V
Sbjct: 1   MRVDLFDFDLPEESIALRPIEPRDHARLLRVRPGQP----FEDRQVFELPDLLHPGDALV 56

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FN+TKVI AQL G+R    N    ++S TLHMR   + W  + RP+K +K+GD + F   
Sbjct: 57  FNDTKVIPAQLEGMRERDGNI--SQVSATLHMRSGADRWKAFLRPAKRVKEGDRIRF-GH 113

Query: 121 DGQS----RLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARD 176
            G S     L+ATV +K + GE LLVF +SG  L+  I+ VG IPLPPYIA KR  D RD
Sbjct: 114 SGSSCFLGTLDATVAEKGDAGEALLVFDLSGAMLDEAIASVGHIPLPPYIASKRAEDERD 173

Query: 177 YVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTD 236
             DYQT YA+ +G+VAAPTAGLHFT  LL ++ + G++ +FVTLHVGAGTF+PVK +DT 
Sbjct: 174 RKDYQTVYAREEGAVAAPTAGLHFTPELLEKIKAKGVEEHFVTLHVGAGTFLPVKADDTA 233

Query: 237 DHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIF 296
           DH MHSEIG +   TA ALN+V  RGGRIV VGTTSLRL+E+A  EDG+I PWSG T+IF
Sbjct: 234 DHKMHSEIGHVSQRTADALNAVHERGGRIVCVGTTSLRLIESAAGEDGVIRPWSGATDIF 293

Query: 297 ITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           ITPGY+FRAVD+LM+NFHLP+STL MLVSAF G++  +  Y HAIS+ YRFYSYGD SLL
Sbjct: 294 ITPGYKFRAVDLLMTNFHLPRSTLFMLVSAFSGLDTMRAAYDHAISNGYRFYSYGDGSLL 353


>gi|114707080|ref|ZP_01439979.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Fulvimarina
           pelagi HTCC2506]
 gi|114537630|gb|EAU40755.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Fulvimarina
           pelagi HTCC2506]
          Length = 358

 Score =  409 bits (1050), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 205/359 (57%), Positives = 257/359 (71%), Gaps = 9/359 (2%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  FDF+LPP RIALRP  PR+SA L+ V  +L+    +SD  ++DLPA +   D +V
Sbjct: 1   MRVDLFDFELPPERIALRPAEPRESAMLLGV--SLTG---LSDLRIADLPALIEPGDVLV 55

Query: 61  FNNTKVITAQLNGVRFCHINRREK---EISCTLHMRVSPNSWSVYARPSKVIKKGDILHF 117
           FN+TKVI AQL G R    +R  +   ++  TLHMR+SP SW+ + RP K IK GD L F
Sbjct: 56  FNDTKVIPAQLFGTRVREDSRDGEGVAQVEATLHMRLSPGSWAAFVRPGKRIKVGDTLVF 115

Query: 118 FSQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDY 177
            S D ++ L A V  +   GE  L F  SG +L+  I+ VG +PLPPYIA +R  DARD+
Sbjct: 116 ASDDAET-LAAEVTARGEGGEATLTFEHSGPDLDAAIAAVGHVPLPPYIAARRGDDARDW 174

Query: 178 VDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDD 237
            DYQT YA+  G+VAAPTAGLHFT NLL +L   G+   F+TLHVGAGTF+PVK +DT+D
Sbjct: 175 TDYQTIYAREAGAVAAPTAGLHFTDNLLEKLHERGVATEFLTLHVGAGTFLPVKADDTED 234

Query: 238 HIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFI 297
           H MH+EIG IDA  A  LN+ +S GGRI+SVGTTSLRLLE+A  +DG I P++G T+IFI
Sbjct: 235 HRMHAEIGTIDAAMADRLNAARSAGGRIISVGTTSLRLLESAAGDDGRIAPFTGPTDIFI 294

Query: 298 TPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           TPGYRF+AVD LM+NFHLP+STL MLVSAFCG+E  ++ Y+HAI + YRFYSYGD  LL
Sbjct: 295 TPGYRFKAVDRLMTNFHLPRSTLFMLVSAFCGLERMRRAYEHAIENGYRFYSYGDACLL 353


>gi|163760249|ref|ZP_02167332.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Hoeflea
           phototrophica DFL-43]
 gi|162282648|gb|EDQ32936.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Hoeflea
           phototrophica DFL-43]
          Length = 359

 Score =  402 bits (1032), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 213/364 (58%), Positives = 254/364 (69%), Gaps = 15/364 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  FDF LP   IALRP  PRDSAR++ V P+      +SD +V DL A L   DA+V
Sbjct: 1   MRVDLFDFHLPDESIALRPASPRDSARMLCVAPDGG----LSDAIVRDLAAQLQPGDALV 56

Query: 61  FNNTKVITAQLNGVRFCHINRREKEI--SCTLHMRVSPNSWSVYARPSKVIKKGDILHFF 118
           FN+T+VI AQL G R    NR + ++  S TLHMR  P+ W  + RP K IK GD L F 
Sbjct: 57  FNDTRVIPAQLEGFR----NRGDNQVRVSATLHMRSGPDRWKAFVRPGKRIKPGDRLSF- 111

Query: 119 SQDG----QSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDA 174
             DG    Q  L+AT  ++   GEI L+F +SG  L+  I   G IPLPPYIA KR  DA
Sbjct: 112 GGDGSACLQGVLDATAGERGEGGEIELIFDLSGPALDEAIMATGHIPLPPYIASKRGEDA 171

Query: 175 RDYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVED 234
           +D  DYQT YA+  G+VAAPTAGLHFT  L + L + GI  +FVTLHVGAGTF+PVK +D
Sbjct: 172 QDRKDYQTIYAREDGAVAAPTAGLHFTDALFASLDARGIVRHFVTLHVGAGTFLPVKADD 231

Query: 235 TDDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTN 294
           T +H MHSEIG + A TA ALN V++ GGRIVSVGTTSLRLLE+A  E+G I PWSG T+
Sbjct: 232 TAEHRMHSEIGHVSAETAAALNQVRASGGRIVSVGTTSLRLLESAADENGTIQPWSGPTD 291

Query: 295 IFITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTS 354
           IFITPGYRFRAVD+LM+NFHLP+STL MLVSAFCG+E  +  Y HAI   YRFYSYGD+S
Sbjct: 292 IFITPGYRFRAVDVLMTNFHLPRSTLFMLVSAFCGLETMRAAYDHAIETGYRFYSYGDSS 351

Query: 355 LLFQ 358
           LLF+
Sbjct: 352 LLFR 355


>gi|254469478|ref|ZP_05082883.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Pseudovibrio sp. JE062]
 gi|211961313|gb|EEA96508.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Pseudovibrio sp. JE062]
          Length = 375

 Score =  400 bits (1029), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 202/362 (55%), Positives = 256/362 (70%), Gaps = 7/362 (1%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M+V +FDFDLPP  IALRP  PRDS+RL+VV P+     +++D  V  LP  L   DA+V
Sbjct: 15  MLVDDFDFDLPPENIALRPAVPRDSSRLLVVRPD--GEQLLTDDQVLSLPDLLEPGDALV 72

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHF-FS 119
           FN+TKVI AQL G R    +    ++  TLH R S   W  + RP+K +K GD + F F 
Sbjct: 73  FNDTKVIPAQLLGFRTR--DGVTAKVGVTLHQRASAKEWRAFVRPAKKLKVGDTVRFAFD 130

Query: 120 QDGQ--SRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDY 177
           ++G+  + L A V +K   G+IL  F  S  +L+  I+ VG IPLPPYIA KR  D +D 
Sbjct: 131 EEGKDAAELSAVVTEKSEAGDILFEFDRSAGDLDAAIAQVGHIPLPPYIAAKRAEDDQDR 190

Query: 178 VDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDD 237
            DYQT YAK +G+VAAPTAGLHFT  L + L   GI+ +FVTLHVGAGTF+PVK + T+D
Sbjct: 191 KDYQTIYAKHEGAVAAPTAGLHFTDRLFAALEERGIEKHFVTLHVGAGTFLPVKADKTED 250

Query: 238 HIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFI 297
           H MH E G I   TA ALN+V++RG +IVSVGTTSLR+LE++ TEDG+INP S  T+IFI
Sbjct: 251 HKMHFEYGEISEETAAALNAVRARGNKIVSVGTTSLRILESSVTEDGVINPISQSTDIFI 310

Query: 298 TPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           TPGY+F+A+D LM+NFHLP+STL MLVSA  G+EE +  Y+HAIS  YRFYSYGD+SLLF
Sbjct: 311 TPGYQFKAIDALMTNFHLPRSTLFMLVSALSGMEEMRGAYEHAISSGYRFYSYGDSSLLF 370

Query: 358 QK 359
           +K
Sbjct: 371 KK 372


>gi|218531243|ref|YP_002422059.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Methylobacterium chloromethanicum CM4]
 gi|254764283|sp|B7KTS1|QUEA_METC4 RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|218523546|gb|ACK84131.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Methylobacterium chloromethanicum CM4]
          Length = 368

 Score =  399 bits (1026), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 199/364 (54%), Positives = 257/364 (70%), Gaps = 10/364 (2%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  FDF+LP + IALRP  PRD++RL+VV P    PL  +D  V DLPA L+  DA+V
Sbjct: 1   MRVDLFDFELPEAAIALRPASPRDASRLLVVRPG--DPL--ADRGVRDLPALLSPGDALV 56

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FN+T+VI A+L+G+R        +     LH+R +P+ W  +ARP+K +  GD + F S+
Sbjct: 57  FNDTRVIPARLSGIRH-RAGGSGQRCEAMLHLREAPDRWRAFARPAKRLAPGDRIRFGSE 115

Query: 121 DGQ-----SRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDAR 175
                   S L+ATV ++   GEILL F +SG  L+  I+ +G +PLPPYIA KRP DA+
Sbjct: 116 GASEVCALSGLDATVEERGEGGEILLRFDLSGPALDEAIAGLGALPLPPYIAGKRPTDAQ 175

Query: 176 DYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDT 235
           D  DYQT YA+  G+VAAPTAGLHF+  LL+ + + GI+   VTLHVGAGTF+PVK +DT
Sbjct: 176 DTTDYQTVYAREPGAVAAPTAGLHFSDALLAGIDAAGIERVHVTLHVGAGTFLPVKADDT 235

Query: 236 DDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNI 295
           D H MH+EIG +DA TA  LN+V++RG R+V+VGTT+LRLLE+A   DG I P+SG T+I
Sbjct: 236 DAHRMHAEIGILDAATAARLNAVRARGNRVVAVGTTALRLLESAADPDGTIRPFSGATDI 295

Query: 296 FITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSL 355
           FITPGYRFRAVD L++NFHLP+STL MLVSAF G++  +  Y HAI   YRFYSYGD SL
Sbjct: 296 FITPGYRFRAVDALVTNFHLPRSTLFMLVSAFAGLDTMRAAYAHAIQSGYRFYSYGDASL 355

Query: 356 LFQK 359
           LF +
Sbjct: 356 LFPE 359


>gi|163852486|ref|YP_001640529.1| S-adenosylmethionine--tRNA-ribosyltransferase-isomerase
           [Methylobacterium extorquens PA1]
 gi|226713844|sp|A9VX03|QUEA_METEP RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|163664091|gb|ABY31458.1| S-adenosylmethionine--tRNA-ribosyltransferase-isomerase
           [Methylobacterium extorquens PA1]
          Length = 368

 Score =  398 bits (1022), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 198/364 (54%), Positives = 257/364 (70%), Gaps = 10/364 (2%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  FDF+LP + IALRP  PRD++RL+VV P    PL  +D  V DLPA L+  DA+V
Sbjct: 1   MRVDLFDFELPEAAIALRPASPRDASRLLVVRPG--DPL--ADRGVRDLPALLSPGDALV 56

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FN+T+VI A+L+G+R        +     LH+R +P+ W  +ARP+K +  GD + F S+
Sbjct: 57  FNDTRVIPARLSGIRH-RAGGSGQRCEAMLHLREAPDRWRAFARPAKRLAPGDRIRFGSE 115

Query: 121 DGQ-----SRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDAR 175
                   S L+ATV ++   GEILL F +SG  L+  I+ +G +PLPPYIA KRP DA+
Sbjct: 116 GASEVCALSGLDATVEERGEGGEILLRFDLSGPALDEAIAGLGALPLPPYIAGKRPTDAQ 175

Query: 176 DYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDT 235
           D  DYQT YA+  G+VAAPTAGLHF+  LL+ + + GI+   VTLHVGAGTF+PVK +DT
Sbjct: 176 DTTDYQTVYAREPGAVAAPTAGLHFSDALLAGIDAAGIERVHVTLHVGAGTFLPVKADDT 235

Query: 236 DDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNI 295
           + H MH+EIG +DA TA  LN+V++RG R+V+VGTT+LRLLE+A   DG I P+SG T+I
Sbjct: 236 EAHRMHAEIGILDAATAARLNAVRARGNRVVAVGTTALRLLESAADPDGTIRPFSGATDI 295

Query: 296 FITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSL 355
           FITPGYRFRAVD L++NFHLP+STL MLVSAF G++  +  Y HAI   YRFYSYGD SL
Sbjct: 296 FITPGYRFRAVDALVTNFHLPRSTLFMLVSAFAGLDTMRAAYAHAIQSGYRFYSYGDASL 355

Query: 356 LFQK 359
           LF +
Sbjct: 356 LFPE 359


>gi|188582509|ref|YP_001925954.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Methylobacterium populi BJ001]
 gi|238692892|sp|B1ZIL2|QUEA_METPB RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|179346007|gb|ACB81419.1| S-adenosylmethionine--tRNA-ribosyltransferase-isomerase
           [Methylobacterium populi BJ001]
          Length = 366

 Score =  397 bits (1020), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 196/369 (53%), Positives = 257/369 (69%), Gaps = 14/369 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  FDF+LP + IALRP  PRD++RL+VV P  +    ++D  V DLPA LN  DA+V
Sbjct: 1   MRVDLFDFELPEAAIALRPASPRDASRLLVVRPGET----LADRGVRDLPALLNPGDALV 56

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FN+T+VI A+L+G+R        +     LH+R +P+ W  +ARP+K +  GD + F  +
Sbjct: 57  FNDTRVIPARLSGIRH-RAGGTGQRCEAMLHLREAPDRWRAFARPAKRLAPGDRIRFGGE 115

Query: 121 DGQ---------SRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRP 171
                       S L+ATV ++   GEILL F ++G  L+  I+ +G +PLPPYIA KR 
Sbjct: 116 GANQGASEVCVLSGLDATVEERGEGGEILLRFDLAGPALDEAIAGLGALPLPPYIAGKRA 175

Query: 172 IDARDYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVK 231
            DARD  DYQT YA+  G+VAAPTAGLHF+  LL  + + GI+   VTLHVGAGTF+PVK
Sbjct: 176 TDARDTTDYQTVYAREPGAVAAPTAGLHFSDALLDGIDAAGIERIHVTLHVGAGTFLPVK 235

Query: 232 VEDTDDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSG 291
            +DT+ H MH+EIG +D  TA+ LN+V++RG RIV+VGTT+LRLLE+AT  DG + P+SG
Sbjct: 236 ADDTEAHRMHAEIGILDTATAERLNAVRARGNRIVAVGTTALRLLESATDPDGTVRPFSG 295

Query: 292 FTNIFITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYG 351
            T+IFITPGYRFRAVD L++NFHLP+STL MLVSAF G++  +  Y HAI+  YRFYSYG
Sbjct: 296 ATDIFITPGYRFRAVDALVTNFHLPRSTLFMLVSAFSGLDTMRAAYAHAIASGYRFYSYG 355

Query: 352 DTSLLFQKR 360
           D SLLF +R
Sbjct: 356 DASLLFPER 364


>gi|240139823|ref|YP_002964300.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase (Queuosine
           biosynthesis protein queA) [Methylobacterium extorquens
           AM1]
 gi|240009797|gb|ACS41023.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase (Queuosine
           biosynthesis protein queA) [Methylobacterium extorquens
           AM1]
          Length = 368

 Score =  397 bits (1019), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 198/364 (54%), Positives = 256/364 (70%), Gaps = 10/364 (2%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  FDF+LP + IALRP  PRD++RL+VV P    PL  +D  V DLPA L+  DA+V
Sbjct: 1   MRVDLFDFELPEAAIALRPASPRDASRLLVVRPG--DPL--ADRGVRDLPALLSPGDALV 56

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FN+T+VI A+L+G+R        +     LH+R +P+ W  +ARP+K +  GD + F S+
Sbjct: 57  FNDTRVIPARLSGIRH-RAGGSGQRCEAMLHLREAPDRWRAFARPAKRLAPGDRIRFGSE 115

Query: 121 DGQ-----SRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDAR 175
                   S L+ATV ++   GEILL F +SG  L+  I+ +G +PLPPYIA KR  DA+
Sbjct: 116 GASEVCALSGLDATVEERGEGGEILLRFDLSGPALDEAIAGLGALPLPPYIAGKRATDAQ 175

Query: 176 DYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDT 235
           D  DYQT YA+  G+VAAPTAGLHF+  LL+ + + GI+   VTLHVGAGTF+PVK +DT
Sbjct: 176 DTTDYQTVYAREPGAVAAPTAGLHFSDALLAGIDAAGIERVHVTLHVGAGTFLPVKADDT 235

Query: 236 DDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNI 295
           D H MH+EIG +DA TA  LN+V++RG R+V+VGTT+LRLLE+A   DG I P+SG T+I
Sbjct: 236 DAHRMHAEIGILDAATAARLNAVRARGNRVVAVGTTALRLLESAADPDGTIRPFSGATDI 295

Query: 296 FITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSL 355
           FITPGYRFRAVD L++NFHLP+STL MLVSAF G++  +  Y HAI   YRFYSYGD SL
Sbjct: 296 FITPGYRFRAVDALVTNFHLPRSTLFMLVSAFAGLDTMRAAYAHAIQSGYRFYSYGDASL 355

Query: 356 LFQK 359
           LF +
Sbjct: 356 LFPE 359


>gi|13470903|ref|NP_102472.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Mesorhizobium loti MAFF303099]
 gi|21263904|sp|Q98M55|QUEA_RHILO RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|14021646|dbj|BAB48258.1| S-adenosylmethionine tRNA ribosyltransferase [Mesorhizobium loti
           MAFF303099]
          Length = 361

 Score =  395 bits (1016), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 203/362 (56%), Positives = 255/362 (70%), Gaps = 11/362 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  FDF+LP  RIALRP  PRDSA+++VV    +    + D  V DLP+ L + D +V
Sbjct: 1   MRVDLFDFELPEERIALRPAEPRDSAKMLVVKSGEA----LDDRKVGDLPSLLRAGDVLV 56

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FN+TKVI AQL G+R       + ++  TLHMRV+P+ W  + RP K I  GD +HF   
Sbjct: 57  FNDTKVIPAQLKGIR--RRGEAQAQVEATLHMRVAPDRWLAFMRPGKRIAAGDRIHF-GH 113

Query: 121 DGQS----RLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARD 176
           DG S    +L+ATVI+K   GE LL F +SG  L+  +  VG IPLPPYIA KR  D RD
Sbjct: 114 DGNSCFLGQLDATVIEKGEGGEALLGFDLSGPFLDEALHAVGHIPLPPYIASKRDDDERD 173

Query: 177 YVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTD 236
             DYQT YA+ +G+VAAPTAGLHFT  L + L + G++ +FVTLHVGAGTF+PVK +DT 
Sbjct: 174 RADYQTIYAREEGAVAAPTAGLHFTPELFAALDAKGVERHFVTLHVGAGTFLPVKADDTA 233

Query: 237 DHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIF 296
           DH MH+EIG +   TA ALN+ K+RGGRI++VGTTSLRLLE+A  EDG +  WSG T+IF
Sbjct: 234 DHKMHAEIGSVSRETADALNAAKARGGRIIAVGTTSLRLLESAAREDGTVPAWSGPTDIF 293

Query: 297 ITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           ITPGYRFR  D+LM+NFHLP+STL MLVSAF G++     Y HAI++ YRFYSYGD SLL
Sbjct: 294 ITPGYRFRTADMLMTNFHLPRSTLFMLVSAFSGLDTMGAAYAHAIANRYRFYSYGDASLL 353

Query: 357 FQ 358
           ++
Sbjct: 354 YR 355


>gi|16125834|ref|NP_420398.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Caulobacter
           crescentus CB15]
 gi|221234595|ref|YP_002517031.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Caulobacter
           crescentus NA1000]
 gi|21263914|sp|Q9A7Y2|QUEA_CAUCR RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|254764271|sp|B8GVF3|QUEA_CAUCN RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|13422980|gb|AAK23566.1| S-adenosylmethionine tRNA ribosyltransferase-isomerase [Caulobacter
           crescentus CB15]
 gi|220963767|gb|ACL95123.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Caulobacter
           crescentus NA1000]
          Length = 366

 Score =  395 bits (1015), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 199/366 (54%), Positives = 257/366 (70%), Gaps = 12/366 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FDFDLP  RIALRP  PRDSAR +VV P  +    ++DH+VSDLP FL   DA+V
Sbjct: 1   MRLSDFDFDLPEDRIALRPAEPRDSARFLVVRPGQA----VADHIVSDLPDFLRPGDALV 56

Query: 61  FNNTKVITAQLNGVRFCHINRREK----EISCTLHMRVSPNSWSVYARPSKVIKKGDILH 116
           FN+T+VI A+L+G+R              +  TLH R++P+ WS + RP K +K GD + 
Sbjct: 57  FNDTRVIPARLSGLREGRTTGGADGTPVAVEATLHRRLAPDRWSAFMRPGKRLKVGDRVA 116

Query: 117 FFSQDGQ----SRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPI 172
           F   +G+     RL+A + +K + GE++L F +SG +L+  I+  G +PLPPYIA KR  
Sbjct: 117 FGGHEGRVGDLGRLDAVIAEKHDGGEVVLAFDLSGPDLDVGIAQHGDMPLPPYIAAKRGE 176

Query: 173 DARDYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKV 232
           D RD  DYQT YA+  GSVAAPTAGLHFT  LL RL + G+ ++FVTLHVGAGTF+PVK 
Sbjct: 177 DERDRADYQTVYAREDGSVAAPTAGLHFTPQLLERLKAKGVSLHFVTLHVGAGTFLPVKT 236

Query: 233 EDTDDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGF 292
           ++  +H MH+E G +    A ALN+ ++ GGRIV VGTTSLRLLE+AT EDGI+ P++  
Sbjct: 237 DEVSEHRMHAEYGQVTQEIADALNAARAAGGRIVCVGTTSLRLLESATGEDGIVRPFADE 296

Query: 293 TNIFITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           T IFITPGYRFR  D+LM+NFHLPKSTL MLVSAF G E  +  Y+HAI+  YRFYSYGD
Sbjct: 297 TAIFITPGYRFRTADVLMTNFHLPKSTLFMLVSAFAGTEAMRAAYEHAIATGYRFYSYGD 356

Query: 353 TSLLFQ 358
           +SLLF+
Sbjct: 357 SSLLFK 362


>gi|254562239|ref|YP_003069334.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Methylobacterium extorquens DM4]
 gi|254269517|emb|CAX25483.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase (Queuosine
           biosynthesis protein queA) [Methylobacterium extorquens
           DM4]
          Length = 368

 Score =  395 bits (1014), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 197/364 (54%), Positives = 256/364 (70%), Gaps = 10/364 (2%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  FDF+LP + IALRP  PRD++RL+VV P    PL  +D  V DLP+ L+  DA+V
Sbjct: 1   MRVDLFDFELPEAAIALRPASPRDASRLLVVRPG--DPL--ADRGVRDLPSLLSPGDALV 56

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FN+T+VI A+L+G+R        +     LH+R +P+ W  +ARP+K +  GD + F S+
Sbjct: 57  FNDTRVIPARLSGIRH-RAGGSGQRCEAMLHLREAPDRWRAFARPAKRLAPGDRIRFGSE 115

Query: 121 DGQ-----SRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDAR 175
                   S L+ATV ++   GEILL F +SG  L+  I+ +G +PLPPYIA KR  DA+
Sbjct: 116 GASEVCALSGLDATVEERGEGGEILLRFDLSGPALDEAIAGLGALPLPPYIAGKRATDAQ 175

Query: 176 DYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDT 235
           D  DYQT YA+  G+VAAPTAGLHF+  LL+ + + GI+   VTLHVGAGTF+PVK +DT
Sbjct: 176 DTTDYQTVYAREPGAVAAPTAGLHFSDALLAGIDAAGIERVHVTLHVGAGTFLPVKADDT 235

Query: 236 DDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNI 295
           D H MH+EIG +DA TA  LN+V++RG R+V+VGTT+LRLLE+A   DG I P+SG T+I
Sbjct: 236 DAHRMHAEIGILDAATAARLNAVRARGNRVVAVGTTALRLLESAADPDGTIRPFSGATDI 295

Query: 296 FITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSL 355
           FITPGYRFRAVD L++NFHLP+STL MLVSAF G++  +  Y HAI   YRFYSYGD SL
Sbjct: 296 FITPGYRFRAVDALVTNFHLPRSTLFMLVSAFAGLDTMRAAYAHAIQSGYRFYSYGDASL 355

Query: 356 LFQK 359
           LF +
Sbjct: 356 LFPE 359


>gi|319783733|ref|YP_004143209.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317169621|gb|ADV13159.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 362

 Score =  394 bits (1013), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 202/362 (55%), Positives = 253/362 (69%), Gaps = 11/362 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  FDF+LP  RIALRP  PRDSA++++V P       + D  V DLP+ L++ D +V
Sbjct: 1   MRVDLFDFELPEERIALRPAQPRDSAKMLLVKPGEE----LEDRTVGDLPSLLSAGDVLV 56

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FN+TKVI AQL G+R         ++  TLHMR++P+ W  + RP K I  GD +HF   
Sbjct: 57  FNDTKVIPAQLKGIR--RRGEATAQVEATLHMRMAPDRWLAFMRPGKRIAAGDRIHF-GH 113

Query: 121 DGQS----RLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARD 176
           DG S    +L+ATVI+K   GE LL F +SG  L+  +  VG IPLPPYIA KR  D RD
Sbjct: 114 DGNSCFLGQLDATVIEKGEGGEALLGFDLSGPFLDEALHAVGHIPLPPYIASKRDDDERD 173

Query: 177 YVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTD 236
             DYQT YA  +G+VAAPTAGLHFT  L + L + G++  FVTLHVGAGTF+PVK +DT 
Sbjct: 174 RADYQTIYASEEGAVAAPTAGLHFTPELFAALDAKGVERRFVTLHVGAGTFLPVKADDTA 233

Query: 237 DHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIF 296
           DH MH+E G +   TA ALN+ ++RGGRIV+VGTTSLRLLE+A  EDG +  WSG T+IF
Sbjct: 234 DHKMHAETGSVSEATADALNAARARGGRIVAVGTTSLRLLESAAREDGTLAAWSGPTDIF 293

Query: 297 ITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           ITPGYRFR  D+LM+NFHLP+STL MLVSAF G++  +  Y HAI++ YRFYSYGD SLL
Sbjct: 294 ITPGYRFRTADMLMTNFHLPRSTLFMLVSAFSGLDTMRAAYAHAIANRYRFYSYGDASLL 353

Query: 357 FQ 358
           F+
Sbjct: 354 FR 355


>gi|304391768|ref|ZP_07373710.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Ahrensia
           sp. R2A130]
 gi|303295997|gb|EFL90355.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Ahrensia
           sp. R2A130]
          Length = 371

 Score =  394 bits (1012), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 194/360 (53%), Positives = 254/360 (70%), Gaps = 14/360 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M +  FDF+LP  RIALRPV PRDSA+L+ ++      L  +D +V++L   L+  DA+V
Sbjct: 1   MKIDAFDFELPEERIALRPVNPRDSAKLLTINAGRDGEL--ADRVVNELAELLSPGDALV 58

Query: 61  FNNTKVITAQLNGVRFCHINRREK---EISCTLHMRVSPNSWSVYARPSKVIKKGDILHF 117
           FN+TKVI AQL G+R     RRE     +  TLHM  +P++W  + R +K +K G+++ F
Sbjct: 59  FNDTKVIPAQLEGIR-----RREDVEARVGLTLHMEEAPDTWRAFVRGAKKLKLGELVEF 113

Query: 118 FSQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDY 177
               G +   A V++K + GEI+  F+ SG  L   ++  G IPLPPYIA KR  D RD 
Sbjct: 114 ----GGADFTAEVLEKGDAGEIVFRFNRSGQALRDALAKRGHIPLPPYIALKRGEDERDR 169

Query: 178 VDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDD 237
            DYQT YA+ +G+VAAPTAGLHFT  L+++L + GI+ +FVTLHVGAGTF+PVKV+DTDD
Sbjct: 170 SDYQTIYARDEGAVAAPTAGLHFTDELMAKLDARGIERHFVTLHVGAGTFLPVKVDDTDD 229

Query: 238 HIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFI 297
           H+MHSE G +   TA AL  V+SRGG++V+VGTTSLRLLE+A  E G +  W G T+IFI
Sbjct: 230 HVMHSERGIVTQETADALARVRSRGGKVVAVGTTSLRLLESAAQETGKVTAWQGATDIFI 289

Query: 298 TPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
            PGY F AVD LM+NFHLPKSTL MLVSAF G++  ++ Y+HAI + YRFYSYGD+SLLF
Sbjct: 290 QPGYNFLAVDALMTNFHLPKSTLFMLVSAFAGLDTMRRAYEHAIENQYRFYSYGDSSLLF 349


>gi|170743609|ref|YP_001772264.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Methylobacterium sp. 4-46]
 gi|238688051|sp|B0U9V5|QUEA_METS4 RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|168197883|gb|ACA19830.1| S-adenosylmethionine--tRNA-ribosyltransferase-isomerase
           [Methylobacterium sp. 4-46]
          Length = 362

 Score =  394 bits (1011), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 195/363 (53%), Positives = 251/363 (69%), Gaps = 10/363 (2%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  FDFDLP + IALRPV PRD+ARL+ V P       +++  V DLPA L   D +V
Sbjct: 1   MRVDLFDFDLPEALIALRPVEPRDAARLLRVAPGHP----LAEARVRDLPALLRPGDCLV 56

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFS- 119
           FN+T+VI A+L G+R    +     +   LH R  P+ W  +ARP K +++GD + F S 
Sbjct: 57  FNDTRVIPARLRGLR-ARPDGSSVRVEAMLHRREGPDCWRAFARPGKRLREGDRIRFGSG 115

Query: 120 QDGQS----RLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDAR 175
           +DG +     L+ATV  +   GEI L F ++G  L+  ++ +G +PLPPYIA +RP DAR
Sbjct: 116 RDGSACDLGHLDATVAARGEEGEITLAFDLAGAFLDEAVARLGELPLPPYIAGRRPADAR 175

Query: 176 DYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDT 235
           D  DYQT YA+  G+VAAPTAGLHFT +LL+RL + GI    +TLHVGAGTF+PVK +DT
Sbjct: 176 DAADYQTVYAREPGAVAAPTAGLHFTPDLLARLGAAGIGEARLTLHVGAGTFLPVKAQDT 235

Query: 236 DDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNI 295
           + H MH+E G I   TA  LN  ++ GGRIV+VGTTSLRLLE+A   DG I P++G T+I
Sbjct: 236 EAHRMHAETGEITPGTAARLNRARAEGGRIVAVGTTSLRLLESAAEPDGTIRPFAGATDI 295

Query: 296 FITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSL 355
           FITPGYRFRAVD+LM+NFHLP+STL MLVSAF G+E  +  Y HA++  YRFYSYGD SL
Sbjct: 296 FITPGYRFRAVDVLMTNFHLPRSTLFMLVSAFAGLETMRAAYAHAVAQGYRFYSYGDASL 355

Query: 356 LFQ 358
           LF+
Sbjct: 356 LFR 358


>gi|90419655|ref|ZP_01227565.1| S-adenosylmethionine, tRNA ribosyltransferase-isomerase
           [Aurantimonas manganoxydans SI85-9A1]
 gi|90336592|gb|EAS50333.1| S-adenosylmethionine, tRNA ribosyltransferase-isomerase
           [Aurantimonas manganoxydans SI85-9A1]
          Length = 363

 Score =  393 bits (1009), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 206/368 (55%), Positives = 248/368 (67%), Gaps = 22/368 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  FDF+LPP RIALRPV PR+SARL+ V P       ++D  V DLP+ L   D +V
Sbjct: 1   MRVDLFDFELPPERIALRPVSPRESARLLCVDPARG----LADQTVGDLPSLLTPGDVLV 56

Query: 61  FNNTKVITAQLNGVRFCHINRRE--------KEISCTLHMRVSPNSWSVYARPSKVIKKG 112
           FN+TKVI AQL G+R     RR          +IS TLHMR +P+ W  + RP K +K G
Sbjct: 57  FNDTKVIPAQLEGLR-----RRPGSVDGEGVAQISATLHMREAPDRWLAFVRPGKRVKVG 111

Query: 113 DILHFFSQDGQS----RLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIAR 168
           D + F    G +     LEATV  +   GE  L F +SG  L+  I+ VG IPLPPYIA 
Sbjct: 112 DRIAF-GHGGNACLAGTLEATVETRGEGGEASLRFDLSGPALDEAIAAVGHIPLPPYIAS 170

Query: 169 KRPIDARDYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFM 228
           KRP D++D  DYQT YA+  G+VAAPTAGLHFT +L +RL +  I   ++TLHVGAGTF+
Sbjct: 171 KRPDDSQDRSDYQTVYAREDGAVAAPTAGLHFTPDLFARLAARDIAAEYLTLHVGAGTFL 230

Query: 229 PVKVEDTDDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINP 288
           PVK EDT DH MHSEIG +   +A+ LN+ +  G RIVSVGTTSLRLLE+A   DG I P
Sbjct: 231 PVKAEDTADHRMHSEIGRVTEESAERLNAARREGRRIVSVGTTSLRLLESAADADGTIRP 290

Query: 289 WSGFTNIFITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFY 348
           +SG T+IFITPGYRFRAVD LM+NFHLP+STL MLVSAF GI+  K  Y HAI + YRFY
Sbjct: 291 FSGPTDIFITPGYRFRAVDRLMTNFHLPRSTLFMLVSAFSGIDTMKSAYAHAIGNEYRFY 350

Query: 349 SYGDTSLL 356
           SYGD  LL
Sbjct: 351 SYGDACLL 358


>gi|307947103|ref|ZP_07662438.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Roseibium
           sp. TrichSKD4]
 gi|307770767|gb|EFO29993.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Roseibium
           sp. TrichSKD4]
          Length = 357

 Score =  392 bits (1007), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 199/360 (55%), Positives = 252/360 (70%), Gaps = 6/360 (1%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V++FDF LP  RIALRP  PRDSAR++VV P  +  L  SD  V DLP  L   DA+V
Sbjct: 1   MRVEDFDFVLPNERIALRPARPRDSARMLVVQPGDTAEL--SDFGVRDLPLLLEPGDALV 58

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FN+TKVI AQL G R       E  IS TLH+R + + W  + RP K ++ GD+L F  +
Sbjct: 59  FNDTKVIPAQLEGKRVR--GDIEARISATLHLRAAADRWKAFVRPGKKVQLGDVLVF--E 114

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
           +G   L A   +K   G++LLVF  S  EL+  I+ VG IPLPPYIA+KR  D +D  DY
Sbjct: 115 EGGVTLTARAEEKSPAGDVLLVFDRSAAELDEAIASVGHIPLPPYIAQKRGEDEQDRSDY 174

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT +A+  G+VAAPTAGLHFT +LL+ L + GI+ + VTLHVGAGTF+PVKV+DTDDH M
Sbjct: 175 QTMFAEKDGAVAAPTAGLHFTPDLLAALDARGIEQHRVTLHVGAGTFLPVKVDDTDDHQM 234

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           H+E G +   TA AL +VK+RG ++VSVGTTSLR+LE+A    G +  ++G T+IFITPG
Sbjct: 235 HAEWGEVSEETAAALQAVKARGNKVVSVGTTSLRILESAAQGSGGLQAFAGETSIFITPG 294

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLFQKR 360
           Y FRA+D LM+NFHLP+STL MLVSA  G++  K+ Y HAI H YRFYSYGD SLLF ++
Sbjct: 295 YEFRAIDALMTNFHLPRSTLFMLVSALSGLDVMKRAYTHAIDHEYRFYSYGDASLLFPQK 354


>gi|220922620|ref|YP_002497922.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Methylobacterium nodulans ORS 2060]
 gi|219947227|gb|ACL57619.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Methylobacterium nodulans ORS 2060]
          Length = 364

 Score =  392 bits (1006), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 196/363 (53%), Positives = 252/363 (69%), Gaps = 10/363 (2%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  FDFDLP + IALRP  PRDSARLM V P        +D  V DLP  L   D +V
Sbjct: 4   MRVDLFDFDLPEALIALRPAVPRDSARLMRVRPGEPP----ADAQVRDLPDLLRPGDCLV 59

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFS- 119
           FN+TKVI A+L G+R    +     +   LH R + + W  +ARP+K +++GD + F + 
Sbjct: 60  FNDTKVIPARLRGLR-ARPDGTVVRVEAMLHHREAADCWRAFARPAKRLREGDRIRFGAG 118

Query: 120 QDGQS----RLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDAR 175
           Q+G +     L+ATV+ +   GEI L F ++G  L+  +  +G +PLPPYIA +RP DAR
Sbjct: 119 QEGAACDLGHLDATVVARGEGGEITLAFDLAGAVLDEAVVRLGELPLPPYIAGRRPADAR 178

Query: 176 DYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDT 235
           D  DYQT YA+  G+VAAPTAGLHFT +LL+RL + GI    VTLHVGAGTF+PVK EDT
Sbjct: 179 DAADYQTVYARAPGAVAAPTAGLHFTPDLLARLDAAGIGQARVTLHVGAGTFLPVKAEDT 238

Query: 236 DDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNI 295
            DH MH+E G I   TA ALN V++ GGRIV+VGTT+LRL+E+A   DG + P++G T+I
Sbjct: 239 ADHRMHAETGEITPETAAALNRVRAAGGRIVAVGTTALRLVESAAAPDGTLRPFAGETDI 298

Query: 296 FITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSL 355
           FITPGYRFRAVD+LM+NFHLP+STL MLVSAF G++  ++ Y  AI+  YRFYSYGD+SL
Sbjct: 299 FITPGYRFRAVDVLMTNFHLPRSTLFMLVSAFAGLDTMREAYAAAIARGYRFYSYGDSSL 358

Query: 356 LFQ 358
           LF+
Sbjct: 359 LFR 361


>gi|295689992|ref|YP_003593685.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase [Caulobacter
           segnis ATCC 21756]
 gi|295431895|gb|ADG11067.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase [Caulobacter
           segnis ATCC 21756]
          Length = 368

 Score =  392 bits (1006), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 200/366 (54%), Positives = 256/366 (69%), Gaps = 12/366 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FDFDLP  RIALRP  PRD+ARL+VV P       ++DH+V +LP FL   DA+V
Sbjct: 1   MHLSDFDFDLPEDRIALRPAEPRDAARLLVVRPGQP----LADHVVRELPDFLQPGDAMV 56

Query: 61  FNNTKVITAQLNGVRFCHINRREK----EISCTLHMRVSPNSWSVYARPSKVIKKGDILH 116
           FN+T+VI A+L+G+R              +  TLH R++P+ WS + RP K +K GD + 
Sbjct: 57  FNDTRVIPARLSGLREGRTTGGADGTPVAVEATLHRRLTPDRWSAFMRPGKRLKVGDRVA 116

Query: 117 FFSQDGQS----RLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPI 172
           F  +D ++    RL+ATV +K   GE++L F +SG +L+  I+  G +PLPPYIA KR  
Sbjct: 117 FGGRDDRACALDRLDATVAEKHEGGEVVLAFDLSGPDLDVGIARHGDMPLPPYIAAKRGE 176

Query: 173 DARDYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKV 232
           D RD  DYQT YA+  GSVAAPTAGLHFT +LL  L + G+  +FVTLHVGAGTF+PVK 
Sbjct: 177 DERDRADYQTVYAREDGSVAAPTAGLHFTPSLLEALKAKGVSTHFVTLHVGAGTFLPVKT 236

Query: 233 EDTDDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGF 292
           +D  +H MH+E G +    A ALN+ ++ GGRI+ VGTTSLRLLE+AT EDG++ P++  
Sbjct: 237 DDVSEHKMHAEYGQVTREVADALNAARAAGGRIICVGTTSLRLLESATGEDGVVKPFADE 296

Query: 293 TNIFITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           T IFITPGYRFRA DILM+NFHLPKSTL MLVSAF G E  +  Y+HAIS  YRFYSYGD
Sbjct: 297 TAIFITPGYRFRAADILMTNFHLPKSTLFMLVSAFAGRETMRAAYEHAISTGYRFYSYGD 356

Query: 353 TSLLFQ 358
            SLLF+
Sbjct: 357 GSLLFR 362


>gi|302383465|ref|YP_003819288.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Brevundimonas subvibrioides ATCC 15264]
 gi|302194093|gb|ADL01665.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Brevundimonas subvibrioides ATCC 15264]
          Length = 356

 Score =  391 bits (1005), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 203/367 (55%), Positives = 251/367 (68%), Gaps = 19/367 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +FDFDLP  RIALRP  PRDSARL+VV         ++DH++ DLPAFL   DA+V
Sbjct: 1   MKTADFDFDLPEDRIALRPAEPRDSARLLVVQDG-----ALADHVIRDLPAFLRPGDALV 55

Query: 61  FNNTKVITAQLNGVRFCH---INRREKE-----ISCTLHMRVSPNSWSVYARPSKVIKKG 112
           FN+T+VI A+L+GVR      +   E E     +  TLH R +P++WS + +P K I+  
Sbjct: 56  FNDTRVIPARLSGVRQRPNPVVGSPEGETLTVPVEATLHHRDTPDTWSAFMKPGKRIRPD 115

Query: 113 DILHFFSQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPI 172
           D + F S      L ATVI K + G + L F +SG  L+  I  VG +PLPPYIA KRP 
Sbjct: 116 DRIVFDS------LSATVIAKSDDGLVTLRFDVSGPALDDAIRAVGVMPLPPYIAAKRPE 169

Query: 173 DARDYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKV 232
           D RD +DYQT +A   GSVAAPTAGLHFT  LL  + + G+  + VTLHVGAGTF+PVK 
Sbjct: 170 DDRDRLDYQTVFATHDGSVAAPTAGLHFTPALLDAIRAKGVTTHAVTLHVGAGTFLPVKA 229

Query: 233 EDTDDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGF 292
           +DT DH MHSE G +   TA ALN+V + GGRIV VGTTSLRLLE+ATT DG+I P+ G 
Sbjct: 230 DDTADHRMHSEWGTVSGETAAALNAVHANGGRIVCVGTTSLRLLESATTPDGVIQPFHGD 289

Query: 293 TNIFITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           T IFITPGY FRA D+L++NFHLPKSTL MLVSAF G++  K  Y HA++  YRFYSYGD
Sbjct: 290 TAIFITPGYAFRAADVLVTNFHLPKSTLFMLVSAFAGLDTMKTAYAHAVADGYRFYSYGD 349

Query: 353 TSLLFQK 359
            SLLF++
Sbjct: 350 GSLLFRQ 356


>gi|254418229|ref|ZP_05031953.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Brevundimonas sp. BAL3]
 gi|196184406|gb|EDX79382.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Brevundimonas sp. BAL3]
          Length = 372

 Score =  389 bits (999), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 205/365 (56%), Positives = 245/365 (67%), Gaps = 12/365 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +FDFDLP  RIALRP  PRDSARL+VV         + D ++ DLP FL   DA+V
Sbjct: 7   MKTADFDFDLPEDRIALRPADPRDSARLLVVKDG-----ALDDRIIRDLPDFLRPGDALV 61

Query: 61  FNNTKVITAQLNGVRFCHINRREK---EISCTLHMRVSPNSWSVYARPSKVIKKGDILHF 117
           FN+T+VI A+L+GVR       E     +  TLH R +P+ WS + +P K IK GD + F
Sbjct: 62  FNDTRVIPARLSGVRTRPGPEGETLTVAVEATLHHRDAPDVWSAFMKPGKRIKPGDRIRF 121

Query: 118 FSQDGQS----RLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPID 173
             +   +    RL+ATV  K + G I L F +SG  L+  I  VG +PLPPYIA KRP D
Sbjct: 122 GQEADAACDLGRLDATVTAKGDDGLITLKFDLSGPALDDAIRDVGVMPLPPYIAAKRPED 181

Query: 174 ARDYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVE 233
            RD  DYQT +A+  GSVAAPTAGLHFT  LL  + + G+  + VTLHVGAGTF+PVK +
Sbjct: 182 DRDRSDYQTVFAEHDGSVAAPTAGLHFTPALLDAIRARGVSTHAVTLHVGAGTFLPVKAD 241

Query: 234 DTDDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFT 293
           D  DH MHSE G +   TA ALN+V + GGRIV VGTTSLRLLE+ATTE G I P+ G T
Sbjct: 242 DLADHRMHSEWGEVSPETADALNAVHAAGGRIVCVGTTSLRLLESATTEAGEIRPFHGDT 301

Query: 294 NIFITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDT 353
            IFITPGYRFRAVD+LM+NFHLPKSTL MLVSAF G    K  Y HAI+  YRFYSYGD 
Sbjct: 302 AIFITPGYRFRAVDVLMTNFHLPKSTLFMLVSAFAGRAAMKTAYAHAIADGYRFYSYGDG 361

Query: 354 SLLFQ 358
           SLLF+
Sbjct: 362 SLLFR 366


>gi|158423932|ref|YP_001525224.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Azorhizobium caulinodans ORS 571]
 gi|172047956|sp|A8I5Q2|QUEA_AZOC5 RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|158330821|dbj|BAF88306.1| S-adenosylmethionine [Azorhizobium caulinodans ORS 571]
          Length = 354

 Score =  387 bits (994), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 189/356 (53%), Positives = 249/356 (69%), Gaps = 4/356 (1%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  FDFDLPP RIALRP  PR+SARL+ V P  +  L   D  ++DLP  L   DA+V
Sbjct: 1   MRVDAFDFDLPPERIALRPAEPRESARLLRVRPGAAPEL--EDRTIADLPDLLQPGDALV 58

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+TKVI A+L+G R          I  TL  R+S ++W+ +A+P+K +  G+ + F   
Sbjct: 59  VNDTKVIPARLDGTR-TRAGGSTVAIEATLIRRLSGSAWAAFAKPAKRLAVGETVVFAGA 117

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G + LEA V+DK  +GE+   F++SG EL+  I  +G +PLPPYIA KRP D RD  DY
Sbjct: 118 SGGT-LEARVLDKLESGEVHFAFALSGPELDAAIDAIGHMPLPPYIAAKRPEDDRDRTDY 176

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           Q  +A+++GSVAAPTA LHFT +LL+++ + G+  Y VTLHVGAGTF+PVK EDT DH M
Sbjct: 177 QPVFARVEGSVAAPTASLHFTPDLLAKIAARGVSRYTVTLHVGAGTFLPVKAEDTTDHQM 236

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           H+E G +   TA  LN+VK+RGGRI++VG+T+ RL+ETA T +G I P+ G T+IFITPG
Sbjct: 237 HAEWGEVSPETAAELNAVKARGGRIITVGSTATRLIETAATPEGSIRPYLGETDIFITPG 296

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           Y FRA D++++NFHLP+STL+MLV+AF G E  K+ Y HAI+  YRFYSYGD  LL
Sbjct: 297 YAFRASDVMLTNFHLPRSTLVMLVAAFVGHETQKRAYAHAIASGYRFYSYGDACLL 352


>gi|254503766|ref|ZP_05115917.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Labrenzia
           alexandrii DFL-11]
 gi|222439837|gb|EEE46516.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Labrenzia
           alexandrii DFL-11]
          Length = 360

 Score =  386 bits (991), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 196/357 (54%), Positives = 252/357 (70%), Gaps = 6/357 (1%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V +FDF+L   RIALRP  PRD+AR++VV P    P  +SD  V DLPA L   DA+V
Sbjct: 1   MRVDQFDFELSNERIALRPARPRDAARMLVVRPG-EIP-ELSDMGVRDLPALLEPGDALV 58

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FN+TKVI AQL G R       E  IS TLH+R + + W  + RP+K ++  D++ F  +
Sbjct: 59  FNDTKVIPAQLEGKRVR--GDIEAGISVTLHLRSAADGWKAFVRPAKKLQVEDLVVF--E 114

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
              +RL ATV +K + GE+LL F  SG +L+  I+ VG IPLPPYIA+KR  D +D  DY
Sbjct: 115 GNGARLTATVKEKSDGGEVLLAFDCSGPDLDVAIAQVGHIPLPPYIAQKRGEDEQDRQDY 174

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT +A+  G+VAAPTAGLHFT  LL+ +   GI+++ VTLHVGAGTF+PVK +DTDDH M
Sbjct: 175 QTIFAEKDGAVAAPTAGLHFTPELLAAIKDRGIEMHRVTLHVGAGTFLPVKADDTDDHKM 234

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           H+E G +   TA AL +VK+RG ++VS+GTTSLR+LE+A  E G I P++  T+IFITPG
Sbjct: 235 HAEWGEVSEETAAALQAVKARGNKVVSIGTTSLRILESAAQETGTIVPFADETSIFITPG 294

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           Y+F+A+D LM+NFHLP+STL MLVSA  G+E  +  YQHAI   YRFYSYGD SLLF
Sbjct: 295 YKFKAIDALMTNFHLPRSTLFMLVSALSGLETMRAAYQHAIDTEYRFYSYGDASLLF 351


>gi|298291669|ref|YP_003693608.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase [Starkeya
           novella DSM 506]
 gi|296928180|gb|ADH88989.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase [Starkeya
           novella DSM 506]
          Length = 364

 Score =  385 bits (990), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 191/363 (52%), Positives = 251/363 (69%), Gaps = 6/363 (1%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  FDFDLPP RIALRPV PRD+AR++VV P  +  L  +D  V DL   L   DA+V
Sbjct: 1   MRVDLFDFDLPPERIALRPVSPRDAARMLVVRPGATPEL--ADAHVHDLANLLQPGDALV 58

Query: 61  FNNTKVITAQLNGVRFCHINRREK-EISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFS 119
            N+T+V+ A+L+G+R    ++ E   +   LH RV+P+ W   ARP+K +  GD + F  
Sbjct: 59  VNDTRVVPARLDGIRRRETSQGEGVRVEAMLHKRVAPDRWLALARPAKRLAPGDRIAFGG 118

Query: 120 QDGQ---SRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARD 176
           +        L+ATV  K   GEI L F ++G  L+  I+ VG IPLPPYIA KRP DA+D
Sbjct: 119 EGNACLLGTLDATVEGKGEAGEIELRFDLAGAALDEAIAAVGHIPLPPYIAAKRPDDAQD 178

Query: 177 YVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTD 236
             DYQT +A  +GSVAAPTAGLHFT  L++RL   G++ + VTLHVGAGTF+PVK +DT 
Sbjct: 179 RADYQTMFAAHEGSVAAPTAGLHFTPELIARLEERGVETHRVTLHVGAGTFLPVKADDTT 238

Query: 237 DHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIF 296
            H MH+E G + A TA ALN+VK+RGGR++++GTT+ RL+E+A +E G ++ W G T+IF
Sbjct: 239 GHRMHAEWGEVSAETAVALNAVKARGGRVITIGTTATRLIESAASEGGRLDAWRGETDIF 298

Query: 297 ITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           ITPGYRFR +D +++NFHLP+STL+MLV+AF G E  K+ Y HAI+  YRFYSYGD  LL
Sbjct: 299 ITPGYRFRFIDGMLTNFHLPRSTLVMLVAAFIGHEVQKRAYAHAIASGYRFYSYGDACLL 358

Query: 357 FQK 359
             K
Sbjct: 359 LPK 361


>gi|260459151|ref|ZP_05807406.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Mesorhizobium opportunistum WSM2075]
 gi|259034705|gb|EEW35961.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Mesorhizobium opportunistum WSM2075]
          Length = 362

 Score =  385 bits (988), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 204/362 (56%), Positives = 256/362 (70%), Gaps = 11/362 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  FDFDLP  RIALRP  PRDSA ++VV P  +    + D  V DLP+ L + D +V
Sbjct: 1   MRVDLFDFDLPEERIALRPAEPRDSAGMLVVRPGET----LDDRRVGDLPSLLRAGDVLV 56

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FN+TKVI AQL G+R       + ++  TLHMR++P+ W  + RP K +  GD +HF   
Sbjct: 57  FNDTKVIPAQLKGIR--RRGEAQAQVEATLHMRMAPDRWLAFMRPGKRVAAGDRIHF-GH 113

Query: 121 DGQS----RLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARD 176
           DG S    +L+ATVI+K   GE LL F +SG  L+  +  VG IPLPPYIA KR  D RD
Sbjct: 114 DGNSCFLGQLDATVIEKGEGGEALLGFDLSGPFLDEALHAVGHIPLPPYIASKRDDDERD 173

Query: 177 YVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTD 236
             DYQT YA+ +G+VAAPTAGLHFT  L + L + G++  FVTLHVGAGTF+PVK +DT 
Sbjct: 174 RADYQTIYAREEGAVAAPTAGLHFTPELFAALDAKGVERRFVTLHVGAGTFLPVKADDTA 233

Query: 237 DHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIF 296
           DH MH+EIG + A TA+ALN+ K+RGGRI++VGTTSLRLLE+A  +DG +  WSG T+IF
Sbjct: 234 DHKMHAEIGSVSAATAEALNAAKARGGRIIAVGTTSLRLLESAARDDGTLAAWSGPTDIF 293

Query: 297 ITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           ITPGYRFR  D+LM+NFHLP+STL MLVSAF G+E  +  Y HAI+  YRFYSYGD SLL
Sbjct: 294 ITPGYRFRTADMLMTNFHLPRSTLFMLVSAFSGLETMRAAYAHAIAERYRFYSYGDASLL 353

Query: 357 FQ 358
           ++
Sbjct: 354 YR 355


>gi|91977073|ref|YP_569732.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Rhodopseudomonas palustris BisB5]
 gi|123721830|sp|Q137A8|QUEA_RHOPS RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|91683529|gb|ABE39831.1| Queuosine biosynthesis protein [Rhodopseudomonas palustris BisB5]
          Length = 360

 Score =  384 bits (987), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 193/363 (53%), Positives = 248/363 (68%), Gaps = 11/363 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M  + FDFDLP S IALRPV PRD+AR++VV P  +    + D  V DLPA L   D +V
Sbjct: 1   MRTELFDFDLPASSIALRPVSPRDAARMLVVRPGAT----LEDRAVRDLPALLQPGDQLV 56

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+VI AQL G R       E  I  TL  R+  + W    +P+K + +GD++ F   
Sbjct: 57  VNDTRVIAAQLTGRRIGRAT--EPRIEATLIKRLDGSRWQALVKPAKKLAEGDVVRF-GH 113

Query: 121 DGQ----SRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARD 176
           DG+      L+ATV  K + GE+ L F+  G  L++ I+ +G  PLPPYIA KR  D +D
Sbjct: 114 DGRVCLLGHLDATVEAKGDAGEVTLAFTFHGPALDQAIAELGATPLPPYIASKRTPDDQD 173

Query: 177 YVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTD 236
             DYQT +A  +G+VAAPTAGLHFT  L + L + G+ ++ +TLHVGAGTF+PVKV+DT 
Sbjct: 174 AADYQTMFAANEGAVAAPTAGLHFTPELDAALKARGVTLHRLTLHVGAGTFLPVKVDDTA 233

Query: 237 DHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIF 296
           +H MH+E G I   TA ALN+ +++GGRIV+VGTTSLRLLE+A  EDG I P++  T IF
Sbjct: 234 EHKMHAEWGTISEATADALNAARAQGGRIVAVGTTSLRLLESAAREDGTIAPFADETAIF 293

Query: 297 ITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           ITPGYRFRAVD LM+NFHLP+STL MLVSAFCG+E  +  Y+HAI   YRFYSYGD SLL
Sbjct: 294 ITPGYRFRAVDALMTNFHLPRSTLFMLVSAFCGLETMQAAYRHAIDSGYRFYSYGDASLL 353

Query: 357 FQK 359
           F++
Sbjct: 354 FRE 356


>gi|209885349|ref|YP_002289206.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Oligotropha
           carboxidovorans OM5]
 gi|226713845|sp|B6JFC2|QUEA_OLICO RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|209873545|gb|ACI93341.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Oligotropha
           carboxidovorans OM5]
          Length = 361

 Score =  384 bits (986), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 191/362 (52%), Positives = 248/362 (68%), Gaps = 11/362 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M    FDFDLPP  IALRP  PRDSARL++V PN+     + DH V DLP  L   D IV
Sbjct: 1   MRTDLFDFDLPPECIALRPAEPRDSARLLLVRPNVG----VEDHSVRDLPGLLAPGDQIV 56

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+TKVI AQL+G R    +  E  I  TL  R+  + W    RP++ + +GD+L F   
Sbjct: 57  VNDTKVIAAQLSGRRIGGTS--EPHIDVTLIKRIDGSRWQALVRPARKLSEGDVLRF-GN 113

Query: 121 DGQ----SRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARD 176
           +G+      L+A+V  K   GE+ L F+  G  L++ I+ +G  PLPPYIA +R  D +D
Sbjct: 114 EGRVCLLGNLDASVEAKGEAGEVTLAFAFHGPVLDQAIADLGAPPLPPYIASRRAPDDKD 173

Query: 177 YVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTD 236
             DYQT +AK +G+VAAPTAGLHFT  L + L + GI +  +TLHVGAGTF+PVK +DTD
Sbjct: 174 VGDYQTMFAKNEGAVAAPTAGLHFTPALEAALAARGIGIQRLTLHVGAGTFLPVKADDTD 233

Query: 237 DHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIF 296
           DH MHSE G +   TA+ LN  +++GGR+V+VG+TS+RLLE+A TEDGII P++G T IF
Sbjct: 234 DHKMHSEWGTVSEETAKTLNEARAKGGRVVAVGSTSMRLLESAATEDGIIQPFTGETAIF 293

Query: 297 ITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           ITPGY+FRAVD++M+NFHLP+STL MLVSAF G++  +  Y HAI+  YRFYSYGD  LL
Sbjct: 294 ITPGYKFRAVDVMMTNFHLPRSTLFMLVSAFSGLDTMRAAYAHAIAKGYRFYSYGDACLL 353

Query: 357 FQ 358
           F+
Sbjct: 354 FR 355


>gi|118589194|ref|ZP_01546601.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Stappia
           aggregata IAM 12614]
 gi|118438523|gb|EAV45157.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Stappia
           aggregata IAM 12614]
          Length = 357

 Score =  384 bits (986), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 198/357 (55%), Positives = 247/357 (69%), Gaps = 6/357 (1%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V +FDFDLP  RIALRP  PRDSAR++VV P    PL +SD  V DLP  L   DA+V
Sbjct: 1   MRVDQFDFDLPNERIALRPARPRDSARMLVVRPG-EQPL-LSDAGVRDLPQLLEPGDALV 58

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FN+T+VI AQL G R          I  TLHMR  P+ W  + RP+K ++ GD + F  +
Sbjct: 59  FNDTRVIPAQLEGTRLR--GDISAGIGATLHMRTGPDRWKAFVRPAKKLQLGDTVLF--E 114

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
              +RL A V +K  +GE+LL F  SG +L+  I+ VG IPLPPYIA+KR  D +D  DY
Sbjct: 115 GFGTRLTAEVTEKGYSGEVLLTFDRSGPDLDVAIASVGHIPLPPYIAQKRGEDDQDRKDY 174

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT +A+  G+VAAPTAGLHFT  LL  L   GI+ + VTLHVGAGTF+PVK EDT DH M
Sbjct: 175 QTIFAEKDGAVAAPTAGLHFTPELLQALSYRGIEQHRVTLHVGAGTFLPVKAEDTADHKM 234

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           H+E G +   TA AL +VK RG ++VSVGTTSLR+LE++  + G+I  ++G T+IFITPG
Sbjct: 235 HAEWGEVSEETAAALLAVKVRGNKVVSVGTTSLRILESSAQKTGVITAFAGETSIFITPG 294

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           YRF+A+D LM+NFHLP+STL MLVSA  G++  +  Y HAIS  YRFYSYGD SLLF
Sbjct: 295 YRFKAIDALMTNFHLPRSTLFMLVSALSGLDTMRHAYAHAISQEYRFYSYGDASLLF 351


>gi|300023678|ref|YP_003756289.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Hyphomicrobium denitrificans ATCC 51888]
 gi|299525499|gb|ADJ23968.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Hyphomicrobium denitrificans ATCC 51888]
          Length = 370

 Score =  382 bits (980), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 202/365 (55%), Positives = 245/365 (67%), Gaps = 11/365 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHP-NLSCP---LVISDHLVSDLPAFLNSN 56
           M    FDF+LP S IALRP  PRDSARL+VVHP    C      +SD  V DLP  LN  
Sbjct: 1   MRTDLFDFELPDSAIALRPAEPRDSARLLVVHPVKGGCARDDAELSDKTVRDLPGLLNPG 60

Query: 57  DAIVFNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILH 116
           DA+VFN+T+VI A L+GVR       + ++   L  +V  +SW  +ARP+K ++ GD +H
Sbjct: 61  DALVFNDTRVIPAALSGVR--TRGDVQAKVDFNLTKQVGDSSWRAFARPAKRLEVGDRVH 118

Query: 117 FFSQDGQS----RLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPI 172
           F    G+S     L+ATV  K   GE+ L F  SG  L+  I  VG +PLPPYIA KR  
Sbjct: 119 F-GHSGESCFLGALDATVSAKGEAGEVELAFDYSGSILDDAIRAVGVMPLPPYIALKRGA 177

Query: 173 DARDYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKV 232
           D RD   YQT YAK  G+VAAPTAGLHFT  L + L + GI  +FVTLHVG GTF+PVK 
Sbjct: 178 DDRDRQSYQTVYAKNDGAVAAPTAGLHFTPELFAALDARGISRHFVTLHVGPGTFLPVKA 237

Query: 233 EDTDDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGF 292
           +DT +H MHSE G I A TA ALN  ++RGGRIV+VGTTSLR+LE+A  +DG I  WSG 
Sbjct: 238 DDTSEHKMHSEWGEISAETAAALNETRARGGRIVAVGTTSLRVLESAAGDDGSIPAWSGD 297

Query: 293 TNIFITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           T+IFITPGYRF+A+D LM+NFHLP+STL MLV+AF G+   +  Y HAI   YRFYSYGD
Sbjct: 298 TSIFITPGYRFKAIDALMTNFHLPRSTLFMLVAAFSGLGTMRAAYGHAIHSGYRFYSYGD 357

Query: 353 TSLLF 357
            SLLF
Sbjct: 358 ASLLF 362


>gi|85716503|ref|ZP_01047474.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Nitrobacter
           sp. Nb-311A]
 gi|85696692|gb|EAQ34579.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Nitrobacter
           sp. Nb-311A]
          Length = 371

 Score =  379 bits (974), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 198/365 (54%), Positives = 246/365 (67%), Gaps = 13/365 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M    FDF+LP   IALRP  PR+SAR++VVHP       + D  VSDLP +L   D +V
Sbjct: 12  MRTDLFDFELPAESIALRPASPRNSARMLVVHPGTR----LHDQRVSDLPEWLRPGDQLV 67

Query: 61  FNNTKVITAQLNGVRFCHINRR-EKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFS 119
            N+T+VI AQL+G R   I R  E  I  TL  R+  + WS   RP+K +  GD++ F  
Sbjct: 68  VNDTRVIAAQLHGRR---IGREAEPRIDATLIKRLDGSRWSALVRPAKKLVAGDVVRF-G 123

Query: 120 QDGQ----SRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDAR 175
            DG+      L+A V  K   GE+   FS  G  L+R I+ +G+ PLPPYIA KR  D +
Sbjct: 124 NDGRVCFLGHLDAQVESKGEEGEVTFAFSFHGPTLDRAIAELGSTPLPPYIASKRAPDDQ 183

Query: 176 DYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDT 235
           D  DYQT +A  +G+VAAPTAGLHFT  + + L   G+ ++ +TLHVGAGTF+PVK EDT
Sbjct: 184 DAADYQTMFAAHEGAVAAPTAGLHFTPVIETALRERGVGLHRITLHVGAGTFLPVKAEDT 243

Query: 236 DDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNI 295
             H MHSE G I A TA ALN+ +SRGGRIV+VGTTSLRLLE+A  EDG I P++G T I
Sbjct: 244 AGHRMHSEWGTISAETADALNTARSRGGRIVAVGTTSLRLLESAAAEDGRIAPFTGETAI 303

Query: 296 FITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSL 355
           FITPGYRFRA+DILM+NFHLP+STL MLVSAF G++  K+ Y HAI+  YRFYSYGD  L
Sbjct: 304 FITPGYRFRAIDILMTNFHLPRSTLFMLVSAFSGLKTMKQAYAHAIAAGYRFYSYGDACL 363

Query: 356 LFQKR 360
           LF +R
Sbjct: 364 LFPER 368


>gi|170746470|ref|YP_001752730.1| S-adenosylmethionine--tRNA-ribosyltransferase-isomerase
           [Methylobacterium radiotolerans JCM 2831]
 gi|238688890|sp|B1M584|QUEA_METRJ RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|170652992|gb|ACB22047.1| S-adenosylmethionine--tRNA-ribosyltransferase-isomerase
           [Methylobacterium radiotolerans JCM 2831]
          Length = 354

 Score =  378 bits (971), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 201/357 (56%), Positives = 249/357 (69%), Gaps = 11/357 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  FDF+LP + IALRP  PRD+ R++VV P    PLV  D  V DLP  L + DA+V
Sbjct: 1   MRVDLFDFELPETSIALRPAEPRDAGRMLVVRPG--APLV--DRTVRDLPDALRAGDALV 56

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FN+T+VI A+LNGVR        +     LH+R +P+ W  +ARP+K +  GD L F   
Sbjct: 57  FNDTRVIPARLNGVR-TRPGAPGQRTEVMLHLREAPDRWRAFARPAKRLTAGDALRF--- 112

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
                L ATV++K   GEI+L F  +G EL+  I+  G +PLPPYIA KR  DARD  DY
Sbjct: 113 ---GDLTATVLEKAEAGEIVLAFDRAGPELDAAIAAEGALPLPPYIAGKRATDARDATDY 169

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YA+  G+VAAPTAGLHF+  LL+ L + G++ + VTLHVGAGTF+PVK EDTD H M
Sbjct: 170 QTVYARNPGAVAAPTAGLHFSDALLADLDAAGLQRHHVTLHVGAGTFLPVKAEDTDGHRM 229

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           H+EIG +DA TA ALN+ ++ GGRIV+VGTT+LRLLE+A   DG + P+SG T IFITPG
Sbjct: 230 HAEIGILDAATADALNAARAAGGRIVAVGTTALRLLESAARPDGTLAPFSGPTEIFITPG 289

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           YRFRAVD L++NFHLP+STL MLVSAF G+E  +  Y HAI   YRFYSYGD SLLF
Sbjct: 290 YRFRAVDALVTNFHLPRSTLFMLVSAFSGLETMRAAYAHAIGAGYRFYSYGDASLLF 346


>gi|197104869|ref|YP_002130246.1| S-adenosylmethionine tRNA ribosyltransferase [Phenylobacterium
           zucineum HLK1]
 gi|238690135|sp|B4R9Q3|QUEA_PHEZH RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|196478289|gb|ACG77817.1| S-adenosylmethionine tRNA ribosyltransferase [Phenylobacterium
           zucineum HLK1]
          Length = 357

 Score =  378 bits (971), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 190/362 (52%), Positives = 240/362 (66%), Gaps = 10/362 (2%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FDFDLP   IALRP  PRD+ARL++V P         D  V DLP  L + D +V
Sbjct: 1   MKLADFDFDLPEEAIALRPANPRDAARLLLVEPGQD----FRDLAVRDLPGLLRAGDVLV 56

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+VI A+L GVR    +R    +  TLH R + + W+ + RP K +  GD + F   
Sbjct: 57  LNDTRVIPARLKGVRTREGSR--VAVEATLHQRKAGHVWTAFMRPGKRLAPGDRVSFGET 114

Query: 121 DGQS----RLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARD 176
           D ++     L+ATV +K   GE+ L F +SG +L+  I+  G +PLPPYIA KR  D +D
Sbjct: 115 DDRACFLGALDATVKEKGEGGEVTLAFDLSGPDLDAAIAERGAMPLPPYIAAKRAEDEQD 174

Query: 177 YVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTD 236
             DYQT YA+  GSVAAPTAGLHFT  LL+RL   G+    VTLHVGAGTF+PVK ED  
Sbjct: 175 RADYQTVYAEEDGSVAAPTAGLHFTPELLARLAQAGVTTERVTLHVGAGTFLPVKTEDIS 234

Query: 237 DHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIF 296
           +H MH+E G +DA TA  LN+ ++ GGRIV VGTTSLRLLE+A  EDG++ P+   T IF
Sbjct: 235 EHRMHAEWGEVDAATADRLNAARAAGGRIVCVGTTSLRLLESAAGEDGVVRPFRDETAIF 294

Query: 297 ITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           ITPGYRFRA D LM+NFHLPKSTL MLV AF G +  +  Y+HAI   YRFYSYGD+SLL
Sbjct: 295 ITPGYRFRAADGLMTNFHLPKSTLFMLVCAFAGTDTMRAAYRHAIETGYRFYSYGDSSLL 354

Query: 357 FQ 358
           ++
Sbjct: 355 WR 356


>gi|217979658|ref|YP_002363805.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Methylocella silvestris BL2]
 gi|254764284|sp|B8EIV1|QUEA_METSB RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|217505034|gb|ACK52443.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Methylocella silvestris BL2]
          Length = 361

 Score =  377 bits (967), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 184/359 (51%), Positives = 243/359 (67%), Gaps = 8/359 (2%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V +FDFDLP + IALRP  PRD+ARL+VV P    P  + D  + DLP  L + D +V
Sbjct: 1   MRVDQFDFDLPDASIALRPAHPRDAARLLVVRPGRLSPAALDDRFIRDLPELLAAGDVLV 60

Query: 61  FNNTKVITAQLNGVRFCHINRREK--EISCTLHMRVSPNSWSVYARPSKVIKKGDILHFF 118
            N+T+VI A+L+G R     R E    I  TLH R   + W  + RP+K ++ G+ + F 
Sbjct: 61  VNDTRVIPARLDGFR----ARGEALARIEATLHKREGGDLWRAFLRPAKKLRAGETILFS 116

Query: 119 SQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYV 178
           S  G ++L A V++K   GE+LL F +SG EL+  +  VG +PLPPYI+ KR  D  D  
Sbjct: 117 S--GDAKLAARVVEKGEDGEVLLGFELSGAELDLALERVGRMPLPPYISSKRGADESDAA 174

Query: 179 DYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDH 238
           DYQT +A   G+VAAPTA LHFT  LL+ L++ G+++  VTLHVGAGTF+PVK EDTDDH
Sbjct: 175 DYQTLFADRPGAVAAPTASLHFTPALLAALVAKGVQIERVTLHVGAGTFLPVKAEDTDDH 234

Query: 239 IMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFIT 298
            MH+E G + A TA ALN+ +  G R+V+ GTTSLR+LE+A   DG +  +SG T+IFIT
Sbjct: 235 RMHAEWGEVSAETAGALNAARRAGRRVVAAGTTSLRILESAAGPDGAVAAFSGDTSIFIT 294

Query: 299 PGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           PGY F+AVD+L++NFHLP+STL MLV AF G++  +  Y HAI+  YRFYSYGD  LL+
Sbjct: 295 PGYSFKAVDLLLTNFHLPRSTLFMLVCAFSGLQTMRDAYNHAIAAGYRFYSYGDACLLY 353


>gi|167646153|ref|YP_001683816.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Caulobacter
           sp. K31]
 gi|189038513|sp|B0T8H5|QUEA_CAUSK RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|167348583|gb|ABZ71318.1| S-adenosylmethionine--tRNA-ribosyltransferase-isomerase
           [Caulobacter sp. K31]
          Length = 373

 Score =  376 bits (966), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 201/366 (54%), Positives = 250/366 (68%), Gaps = 12/366 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FDF LP + IALRP  PRDSARL+VV P       + D +V DLP FL   DA+V
Sbjct: 1   MRLSDFDFHLPDAAIALRPAEPRDSARLLVVRPGEG----LEDRIVRDLPDFLRPGDALV 56

Query: 61  FNNTKVITAQLNGVRFCHI----NRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILH 116
           FN+T+VI A+L G R        +     +  TLH R++P+ W  + RP K +K+GD + 
Sbjct: 57  FNDTRVIPARLMGRRAGRETGGGDGSPVAVEATLHRRIAPDRWVAFMRPGKRLKEGDRIA 116

Query: 117 F-FSQDGQSR---LEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPI 172
           F   QD   +   L+ATVI K   GEI L F  +G++L+  ++  G +PLPPYIA KR  
Sbjct: 117 FGHDQDRACQAGMLDATVIAKHEGGEIELAFDFAGVDLDLAVAAHGEMPLPPYIAAKRAE 176

Query: 173 DARDYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKV 232
           D RD  DYQT YA+  GSVAAPTAGLHFTS+LL RL + G+ ++FVTLHVGAGTF+PVK 
Sbjct: 177 DDRDRADYQTVYAREDGSVAAPTAGLHFTSDLLERLKAGGVSLHFVTLHVGAGTFLPVKT 236

Query: 233 EDTDDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGF 292
           +   DH MH+E G + A  A ALN+ ++ GGRIV VGTTSLRLLE+AT ED II P++  
Sbjct: 237 DVVADHKMHAEFGEVPAAVADALNAARAAGGRIVCVGTTSLRLLESATGEDRIIKPFADE 296

Query: 293 TNIFITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           T IFITPGYRFRA D+LM+NFHLPKSTL MLVSAF G    K  Y+HAI+  YRFYSYGD
Sbjct: 297 TAIFITPGYRFRAADVLMTNFHLPKSTLFMLVSAFAGQATMKAAYEHAIAAGYRFYSYGD 356

Query: 353 TSLLFQ 358
            SLLF+
Sbjct: 357 GSLLFR 362


>gi|75675988|ref|YP_318409.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Nitrobacter
           winogradskyi Nb-255]
 gi|91207388|sp|Q3SRN4|QUEA_NITWN RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|74420858|gb|ABA05057.1| Queuosine biosynthesis protein [Nitrobacter winogradskyi Nb-255]
          Length = 360

 Score =  373 bits (958), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 196/365 (53%), Positives = 244/365 (66%), Gaps = 13/365 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M    FDF+LP   IALRP  PRDSAR++VV P       + D  VSDLP +L   D +V
Sbjct: 1   MRTDLFDFELPAGSIALRPASPRDSARMLVVQPGSG----VRDQQVSDLPEWLRPGDQLV 56

Query: 61  FNNTKVITAQLNGVRFCHINRR-EKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFS 119
            N+T+VI AQL+G R   I R  E  I  TL  R+  + WS   RP++ +  GDI+    
Sbjct: 57  VNDTRVIAAQLHGRR---IGREAEPRIDATLIKRLDGSRWSALVRPARKLMAGDIVRL-G 112

Query: 120 QDGQ----SRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDAR 175
            +G+      L+A V  K   GE+   FS  G  L++ I+ +G+ PLPPYIA KR  D R
Sbjct: 113 NEGRVCFLGHLDARVESKGEEGEVTFAFSFHGPMLDQAIAELGSTPLPPYIASKRAPDDR 172

Query: 176 DYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDT 235
           D  DYQT +A  +G+VAAPTAGLHFT  + + L   G+ ++ +TLHVGAGTF+PVKV+DT
Sbjct: 173 DASDYQTMFATHEGAVAAPTAGLHFTPEIETALRGRGVGLHRITLHVGAGTFLPVKVDDT 232

Query: 236 DDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNI 295
             H MHSE G I   TA ALN+ +SRGGRIV+VGTTSLRLLE+A  +DG I P++G T I
Sbjct: 233 AGHRMHSEWGAISTETADALNAARSRGGRIVAVGTTSLRLLESAADDDGRIKPFTGETAI 292

Query: 296 FITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSL 355
           FITPG+RFRAVDILM+NFHLP+STL MLVSAF G+E  K+ Y HAIS  YRFYSYGD  L
Sbjct: 293 FITPGHRFRAVDILMTNFHLPRSTLFMLVSAFSGLETMKQAYAHAISAGYRFYSYGDACL 352

Query: 356 LFQKR 360
           LF +R
Sbjct: 353 LFPER 357


>gi|299133970|ref|ZP_07027164.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase [Afipia sp.
           1NLS2]
 gi|298591806|gb|EFI52007.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase [Afipia sp.
           1NLS2]
          Length = 361

 Score =  372 bits (956), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 191/361 (52%), Positives = 242/361 (67%), Gaps = 11/361 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M    FDFDLPP  IALRPV PR+SARL+VV P       + D+ V DLP  L + D +V
Sbjct: 1   MRTDLFDFDLPPESIALRPVEPRESARLLVVRPGDG----LDDYTVRDLPDLLRAGDQLV 56

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+TKVI AQL G R       E  I  TL  RV  + W    RP++ + +GD++ F   
Sbjct: 57  VNDTKVIAAQLAGRRVGGAT--EPRIDVTLIKRVDGSRWQALVRPARKLAEGDVVRF-GN 113

Query: 121 DGQ----SRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARD 176
           +G+      L+ATV  K   GEI L F+  G  L++ I+ +G  PLPPYIA +R  D +D
Sbjct: 114 EGRVCLLGNLDATVEAKGEAGEITLSFAFHGPVLDQAIADLGAPPLPPYIASRRAPDEKD 173

Query: 177 YVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTD 236
             DYQT +AK +G+VAAPTAGLHFT  L + L + GI V  +TLHVGAGTF+PVK +DT 
Sbjct: 174 VGDYQTMFAKHEGAVAAPTAGLHFTPALEAALQARGIGVQRLTLHVGAGTFLPVKTDDTA 233

Query: 237 DHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIF 296
           DH MH+E G I A TA+ LN  +++GGRIV+VG+T++RLLE+A  E+G I P++G T IF
Sbjct: 234 DHKMHAEWGTISAETARTLNEARAKGGRIVAVGSTAMRLLESAADENGTIQPFTGETAIF 293

Query: 297 ITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           ITPGYRFRAVD++M+NFHLP+STL MLVSAF G+E  +  Y HAI   YRFYSYGD  LL
Sbjct: 294 ITPGYRFRAVDVMMTNFHLPRSTLFMLVSAFSGLETMQAAYAHAIEKGYRFYSYGDACLL 353

Query: 357 F 357
           F
Sbjct: 354 F 354


>gi|148255729|ref|YP_001240314.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Bradyrhizobium sp. BTAi1]
 gi|166216702|sp|A5EJR4|QUEA_BRASB RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|146407902|gb|ABQ36408.1| S-adenosylmethionine [Bradyrhizobium sp. BTAi1]
          Length = 364

 Score =  372 bits (954), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 191/363 (52%), Positives = 242/363 (66%), Gaps = 11/363 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M    FDF LPP  IALRP  PR++AR++VV  +     V+ D +V+DLP +L   D +V
Sbjct: 1   MRTDLFDFHLPPENIALRPASPREAARMLVVQGDG----VLRDRIVADLPDWLEPGDQLV 56

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+TKVI AQL+G R       E +I  TL  R+  + W    RP+K +  GD + F   
Sbjct: 57  VNDTKVIAAQLSGRRVS--RETEAKIEATLIKRLDGSRWQALVRPAKKLAPGDTIRF-GH 113

Query: 121 DGQ----SRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARD 176
           +G+      L+ATV  K   GE+ L F   G  L++ I+ +G  PLPPYIA KRP D +D
Sbjct: 114 EGKVCLLGHLDATVEAKGEEGEVTLSFVFHGPALDQAIADLGRPPLPPYIAGKRPADEQD 173

Query: 177 YVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTD 236
             DYQT +A  +G+VAAPTAGLHFT  L  RL + G+ +  VTLHVGAGTF+PVKVEDT+
Sbjct: 174 AADYQTMFAAKEGAVAAPTAGLHFTPALEQRLRARGVGLQRVTLHVGAGTFLPVKVEDTE 233

Query: 237 DHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIF 296
            H MH+E G + A TA ALN  +++GGRIV+VGTTS+RLLE+A   DG I P+   T+IF
Sbjct: 234 GHRMHAEWGSLSAETAAALNEARAKGGRIVAVGTTSMRLLESAALPDGTIAPFEAETSIF 293

Query: 297 ITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           ITPGYRFRAVDILM+NFHLP+STL MLVSAF G+E  +  Y HAI   YRFYSYGD  LL
Sbjct: 294 ITPGYRFRAVDILMTNFHLPRSTLFMLVSAFAGLETMQAAYAHAIRSGYRFYSYGDACLL 353

Query: 357 FQK 359
           F++
Sbjct: 354 FRQ 356


>gi|154248190|ref|YP_001419148.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Xanthobacter autotrophicus Py2]
 gi|238686741|sp|A7IN97|QUEA_XANP2 RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|154162275|gb|ABS69491.1| Queuosine biosynthesis protein [Xanthobacter autotrophicus Py2]
          Length = 362

 Score =  371 bits (953), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 184/362 (50%), Positives = 244/362 (67%), Gaps = 6/362 (1%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  FDFDLP   IALRP  PRD+AR++VV P  +  L  SD  V DLP F+ +NDA+V
Sbjct: 1   MRVDAFDFDLPEEHIALRPAEPRDAARMLVVRPGGAPEL--SDLKVRDLPDFITANDALV 58

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+VI A L GVR          I   L  R+  + W  +A+P K ++ GD + F  +
Sbjct: 59  VNDTRVIPAALEGVR-ERDGGSAVRIEANLIKRLDASRWQAFAKPGKRLRVGDRVRFGGE 117

Query: 121 DGQ---SRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDY 177
                   L+A +  K + G ++L F ++G  L+  ++ VG +P+PPYIA +R  D RD 
Sbjct: 118 GSACLLGALDAQIAAKEDDGSVILAFDLAGTALDEAVTAVGHMPIPPYIAARRAEDDRDR 177

Query: 178 VDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDD 237
            DYQT +A++ GSVAAPTA LHFT  L++R+ + G  ++ VTLHVGAGTF+PVK EDT  
Sbjct: 178 ADYQTLFARVSGSVAAPTASLHFTPELMARIAATGASMHTVTLHVGAGTFLPVKAEDTTG 237

Query: 238 HIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFI 297
           H MH+E G + A TA ALN+VK++GGRI +VG+TS RL+E+AT EDG I P+ G T+IFI
Sbjct: 238 HRMHAEWGEVSADTAAALNAVKAKGGRIFTVGSTSTRLIESATGEDGTIRPFVGETDIFI 297

Query: 298 TPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           TPGYRFRAVD +++NFHLP+STL+MLV+AF G E  K+ Y HAI+  YRFYSYGD  LL 
Sbjct: 298 TPGYRFRAVDGMLTNFHLPRSTLVMLVAAFVGHEAQKRAYAHAIAAGYRFYSYGDACLLL 357

Query: 358 QK 359
            +
Sbjct: 358 PE 359


>gi|91207399|sp|Q6N6L0|QUEA_RHOPA RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
          Length = 360

 Score =  371 bits (952), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 198/364 (54%), Positives = 252/364 (69%), Gaps = 13/364 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M  + FDFDLP   IALRPV PRD+AR++VV P    PL   D +V DLPA L   D +V
Sbjct: 1   MRTELFDFDLPAENIALRPVSPRDAARMLVVRPG--APL--EDRIVRDLPALLAPGDQLV 56

Query: 61  FNNTKVITAQLNGVRFCHINRR-EKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFS 119
            N+T+VI AQL G R   I R  E +I  TL  R+    W    +P+K +  GD++ F  
Sbjct: 57  VNDTRVIAAQLTGRR---IGRGLEPKIEATLIKRLDGARWQALVKPAKKLLPGDVVRF-G 112

Query: 120 QDGQ----SRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDAR 175
            DG+      L+ATV  K + GE+ LVFS  G  L++ I+ VG  PLPPYIA KR  DA+
Sbjct: 113 HDGRVCLLGHLDATVEAKGDAGEVTLVFSFHGPVLDQAIAEVGATPLPPYIASKRAPDAQ 172

Query: 176 DYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDT 235
           D  DYQT +A  +G+VAAPTAGLHFT+ L + L + G+ ++ +TLHVGAGTF+PVK EDT
Sbjct: 173 DIADYQTMFASNEGAVAAPTAGLHFTAELETALAACGVGLHRITLHVGAGTFLPVKAEDT 232

Query: 236 DDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNI 295
            +H MH+E G I + TA+ALN+ ++ GGRIV+VGTTSLRLLE+A  +DG I P++  T+I
Sbjct: 233 SEHRMHAEWGTISSGTAEALNAARAAGGRIVAVGTTSLRLLESAARDDGRIAPFADETSI 292

Query: 296 FITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSL 355
           FITPGYRFRAVD+LM+NFHLP+STL MLVSAFCG++  +  Y HAI   YRFYSYGD SL
Sbjct: 293 FITPGYRFRAVDVLMTNFHLPRSTLFMLVSAFCGLDTMQAAYAHAIRTGYRFYSYGDASL 352

Query: 356 LFQK 359
           LF+ 
Sbjct: 353 LFRN 356


>gi|39935671|ref|NP_947947.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Rhodopseudomonas palustris CGA009]
 gi|39649524|emb|CAE28046.1| S-adenosylmethionine tRNA ribosyltransferase [Rhodopseudomonas
           palustris CGA009]
          Length = 364

 Score =  370 bits (950), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 198/364 (54%), Positives = 252/364 (69%), Gaps = 13/364 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M  + FDFDLP   IALRPV PRD+AR++VV P    PL   D +V DLPA L   D +V
Sbjct: 5   MRTELFDFDLPAENIALRPVSPRDAARMLVVRPG--APL--EDRIVRDLPALLAPGDQLV 60

Query: 61  FNNTKVITAQLNGVRFCHINRR-EKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFS 119
            N+T+VI AQL G R   I R  E +I  TL  R+    W    +P+K +  GD++ F  
Sbjct: 61  VNDTRVIAAQLTGRR---IGRGLEPKIEATLIKRLDGARWQALVKPAKKLLPGDVVRF-G 116

Query: 120 QDGQ----SRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDAR 175
            DG+      L+ATV  K + GE+ LVFS  G  L++ I+ VG  PLPPYIA KR  DA+
Sbjct: 117 HDGRVCLLGHLDATVEAKGDAGEVTLVFSFHGPVLDQAIAEVGATPLPPYIASKRAPDAQ 176

Query: 176 DYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDT 235
           D  DYQT +A  +G+VAAPTAGLHFT+ L + L + G+ ++ +TLHVGAGTF+PVK EDT
Sbjct: 177 DIADYQTMFASNEGAVAAPTAGLHFTAELETALAACGVGLHRITLHVGAGTFLPVKAEDT 236

Query: 236 DDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNI 295
            +H MH+E G I + TA+ALN+ ++ GGRIV+VGTTSLRLLE+A  +DG I P++  T+I
Sbjct: 237 SEHRMHAEWGTISSGTAEALNAARAAGGRIVAVGTTSLRLLESAARDDGRIAPFADETSI 296

Query: 296 FITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSL 355
           FITPGYRFRAVD+LM+NFHLP+STL MLVSAFCG++  +  Y HAI   YRFYSYGD SL
Sbjct: 297 FITPGYRFRAVDVLMTNFHLPRSTLFMLVSAFCGLDTMQAAYAHAIRTGYRFYSYGDASL 356

Query: 356 LFQK 359
           LF+ 
Sbjct: 357 LFRN 360


>gi|90424090|ref|YP_532460.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Rhodopseudomonas palustris BisB18]
 gi|90106104|gb|ABD88141.1| Queuosine biosynthesis protein [Rhodopseudomonas palustris BisB18]
          Length = 379

 Score =  369 bits (948), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 189/359 (52%), Positives = 248/359 (69%), Gaps = 11/359 (3%)

Query: 6   FDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIVFNNTK 65
           FDF+LP + IALRP  PRD+ARL+VV P  +    + D +V DLP +L   DA+V N+T+
Sbjct: 27  FDFELPATAIALRPAQPRDAARLLVVRPGAA----LHDGVVRDLPDWLAPGDALVVNDTR 82

Query: 66  VITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQDGQ-- 123
           VI AQL+G R    +  E +I  TL  R+  + W    + +K + +GD++ F   DG+  
Sbjct: 83  VIAAQLSGRRIGRDS--EAKIEATLIKRLDGSRWQALVKGAKKLNEGDVVRF-GHDGRVC 139

Query: 124 --SRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDYQ 181
              +L+ATV  K   GEI L FS  G  L++ I+ +G  PLPPYIA KR  D RD  DYQ
Sbjct: 140 LLGQLDATVEHKGEAGEITLSFSFHGPTLDQAIAELGAPPLPPYIASKRAPDDRDAADYQ 199

Query: 182 TTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIMH 241
           T +A  +G+VAAPTAGLHFT  L + L + G+ ++ VTLHVGAGTF+PVKV+DT+DH MH
Sbjct: 200 TMFAAHEGAVAAPTAGLHFTPELEAALAARGVSIHRVTLHVGAGTFLPVKVDDTEDHKMH 259

Query: 242 SEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPGY 301
           +E G I   TA ALN+V ++G RIV+VG+TSLRLLE+A  +DG I P++  T IFITPGY
Sbjct: 260 AEWGTISRATADALNAVHAKGCRIVAVGSTSLRLLESAAADDGSIQPFADDTAIFITPGY 319

Query: 302 RFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLFQKR 360
           RF+AVD++M+NFHLP+STL MLVSAF G E  ++ Y HAI+  YRFYSYGD  LLF +R
Sbjct: 320 RFKAVDLMMTNFHLPRSTLFMLVSAFAGRETMQRAYAHAIATGYRFYSYGDACLLFPER 378


>gi|328543843|ref|YP_004303952.1| S-adenosylmethionine:tRNA-ribosyltransferase-isomerase (queuine
           synthetase) [Polymorphum gilvum SL003B-26A1]
 gi|326413587|gb|ADZ70650.1| S-adenosylmethionine:tRNA-ribosyltransferase-isomerase (queuine
           synthetase) [Polymorphum gilvum SL003B-26A1]
          Length = 365

 Score =  369 bits (947), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 198/365 (54%), Positives = 250/365 (68%), Gaps = 17/365 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  FDFDLPP RIALRP  PRD+ARL+VV P  S  L  +D  V DL   L   DA+V
Sbjct: 1   MRVDVFDFDLPPERIALRPARPRDAARLLVVRPGQSPEL--ADCGVRDLARELEPGDALV 58

Query: 61  FNNTKVITAQLNGVRFCHINRREK--EISCTLHMRVSPNSWSVYARPSKVIKKGDILHFF 118
           FN+T+VI AQL G R     R E    I  TLH+R   + W  + RP+K +  GD + F 
Sbjct: 59  FNDTRVIPAQLEGTR----TRGEAVAGIGATLHLRAGADRWWAFVRPAKKLAVGDRVRF- 113

Query: 119 SQDGQSR------LEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPI 172
              G+ R      L+ATV DK ++GE+LL F ++G +L++ I+ VG IPLPPYIA +R  
Sbjct: 114 --GGEGRACLLGTLDATVADKRDSGEVLLAFDLAGPDLDQAIAAVGHIPLPPYIAARRGE 171

Query: 173 DARDYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKV 232
           D +D  DYQT +A   G+VAAPTAGLHFT  L+  L + GI+ + VTLHVGAGTF+PVK 
Sbjct: 172 DEQDRSDYQTMFADKDGAVAAPTAGLHFTPALIEALDARGIERHTVTLHVGAGTFLPVKA 231

Query: 233 EDTDDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGF 292
           EDT DH MH+E G + A TA AL +V++RG R+V+VGTTSLR+LE+A      +  +SG 
Sbjct: 232 EDTADHRMHAEWGKVSAATAAALKAVRARGNRVVAVGTTSLRILESAAQGADGLTAFSGE 291

Query: 293 TNIFITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           T+IFITPGYRFRAVD+LM+NFHLP+STL MLVSAF G++  ++ Y HAI+  YRFYSYGD
Sbjct: 292 TSIFITPGYRFRAVDVLMTNFHLPRSTLFMLVSAFSGLQTMRRAYAHAIASGYRFYSYGD 351

Query: 353 TSLLF 357
             LLF
Sbjct: 352 ACLLF 356


>gi|323136311|ref|ZP_08071393.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Methylocystis sp. ATCC 49242]
 gi|322398385|gb|EFY00905.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Methylocystis sp. ATCC 49242]
          Length = 359

 Score =  369 bits (947), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 186/362 (51%), Positives = 238/362 (65%), Gaps = 10/362 (2%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  FDF+LP  RIALRP  PRDSAR++VV P         D  V DLPA L   DA+V
Sbjct: 1   MRVDLFDFELPQDRIALRPANPRDSARMLVV-PGKGA---FEDKSVRDLPACLRGGDALV 56

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+VI A+L+G R          +  TL  R+  + W    RP+K +  GD++ F  +
Sbjct: 57  VNDTRVIHARLSGRRL--RGELSAGVEATLIERLDASRWRALMRPAKKLAIGDLIRFGRE 114

Query: 121 DG----QSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARD 176
            G    Q  L+A V  + + GE+ L F +SG  L+  I + G +PLPPYIA KR  DA D
Sbjct: 115 GGEACLQGALDARVEGRGDAGEVTLAFDLSGASLDEAIEVAGEMPLPPYIAGKRAADASD 174

Query: 177 YVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTD 236
             DYQT +A+  G+VAAPTAGLHFT NLL+ + + G++++ VTLHVGAGTF+PVK +DT 
Sbjct: 175 ETDYQTVFAREAGAVAAPTAGLHFTPNLLAAVEARGVQLHRVTLHVGAGTFLPVKADDTG 234

Query: 237 DHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIF 296
            H MH E   ID+ TA ALN  ++RGGRIV+VGTT+LR+LE+A   DG + P++  T IF
Sbjct: 235 SHRMHEEFARIDSGTAAALNEARARGGRIVAVGTTALRVLESAAAPDGRLAPYAQRTGIF 294

Query: 297 ITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           ITPGYRFRA D+L++NFHLP+STL MLVSAF G+E  K  Y HAI   YRFYSYGD  LL
Sbjct: 295 ITPGYRFRATDMLLTNFHLPRSTLFMLVSAFSGLERMKAAYAHAIEDGYRFYSYGDACLL 354

Query: 357 FQ 358
            +
Sbjct: 355 HR 356


>gi|192291253|ref|YP_001991858.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Rhodopseudomonas palustris TIE-1]
 gi|238692597|sp|B3QIN0|QUEA_RHOPT RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|192285002|gb|ACF01383.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Rhodopseudomonas palustris TIE-1]
          Length = 360

 Score =  368 bits (944), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 198/364 (54%), Positives = 252/364 (69%), Gaps = 13/364 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M  + FDFDLP   IALRPV PRD+AR++VV P  S PL   D +V DLPA L   D +V
Sbjct: 1   MRTELFDFDLPTQNIALRPVSPRDAARMLVVRP--SVPL--EDRIVRDLPALLAPGDQLV 56

Query: 61  FNNTKVITAQLNGVRFCHINRR-EKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFS 119
            N+T+VI AQL G R   I R  E +I  TL  R+    W    +P+K +  GD++ F  
Sbjct: 57  VNDTRVIAAQLTGRR---IGRGLEPKIEATLIKRLDGARWQALVKPAKKLLPGDVVRF-G 112

Query: 120 QDGQ----SRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDAR 175
            DG+      L+ATV  K + GE+ L FS  G  L++ I+ VG  PLPPYIA KR  DA+
Sbjct: 113 HDGRVCLLGHLDATVEAKGDAGEVTLAFSFHGPVLDQAIAEVGATPLPPYIASKRAPDAQ 172

Query: 176 DYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDT 235
           D  DYQT +A  +G+VAAPTAGLHFT+ L + L + G+ ++ +TLHVGAGTF+PVK EDT
Sbjct: 173 DIADYQTMFASNEGAVAAPTAGLHFTAELETALAARGVGLHRITLHVGAGTFLPVKAEDT 232

Query: 236 DDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNI 295
            +H MH+E G I + TA+ALN+ ++ GGRIV+VGTTSLRLLE+A  +DG I P++  T+I
Sbjct: 233 SEHRMHAEWGTISSGTAEALNAARAAGGRIVAVGTTSLRLLESAARDDGRIAPFADETSI 292

Query: 296 FITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSL 355
           FITPGYRFRAVD+LM+NFHLP+STL MLVSAFCG++  +  Y HAI   YRFYSYGD SL
Sbjct: 293 FITPGYRFRAVDMLMTNFHLPRSTLFMLVSAFCGLDTMQAAYAHAIRTGYRFYSYGDASL 352

Query: 356 LFQK 359
           LF+ 
Sbjct: 353 LFRN 356


>gi|146340922|ref|YP_001205970.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Bradyrhizobium sp. ORS278]
 gi|166216703|sp|A4YV19|QUEA_BRASO RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|146193728|emb|CAL77745.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Bradyrhizobium sp. ORS278]
          Length = 364

 Score =  366 bits (940), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 190/363 (52%), Positives = 238/363 (65%), Gaps = 11/363 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M    FDF LPP  IALRP  PR++AR++VV  +     V+ D  + DLP +L   D +V
Sbjct: 1   MRTDLFDFHLPPENIALRPASPREAARMLVVQGDG----VLRDRTIGDLPDWLEPGDQLV 56

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+TKVI AQL+G R       E +I  TL  R+  + W    RP+K +  GD + F   
Sbjct: 57  VNDTKVIAAQLSGRRIS--RETEAKIEATLIKRLDGSRWQALVRPAKKLLAGDTIRF-GN 113

Query: 121 DGQ----SRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARD 176
           +G+      L+ATV  K   GE+ L F   G  L++ I+ +G  PLPPYIA KRP D +D
Sbjct: 114 EGKVCLLGHLDATVEAKGEEGEVTLSFVFHGPALDQAIADLGRPPLPPYIAGKRPADEQD 173

Query: 177 YVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTD 236
             DYQT +A  +G+VAAPTAGLHFT  L  RL + G+ +  VTLHVGAGTF+PVKVEDT+
Sbjct: 174 AQDYQTMFAAKEGAVAAPTAGLHFTPALEQRLRARGVGLQRVTLHVGAGTFLPVKVEDTE 233

Query: 237 DHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIF 296
            H MH+E G +   TA ALN  K+ GGRIV+VGTTS+RLLE+A   DG I P+   T+IF
Sbjct: 234 GHRMHAEWGSLTPETAAALNQAKAEGGRIVAVGTTSMRLLESAALPDGTIAPFEAETSIF 293

Query: 297 ITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           ITPGYRFRAVDILM+NFHLP+STL MLVSAF G+E  +  Y HAI   YRFYSYGD  LL
Sbjct: 294 ITPGYRFRAVDILMTNFHLPRSTLFMLVSAFAGLETMQAAYAHAIESGYRFYSYGDACLL 353

Query: 357 FQK 359
           F++
Sbjct: 354 FRQ 356


>gi|92117315|ref|YP_577044.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Nitrobacter
           hamburgensis X14]
 gi|91800209|gb|ABE62584.1| Queuosine biosynthesis protein [Nitrobacter hamburgensis X14]
          Length = 365

 Score =  366 bits (939), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 194/362 (53%), Positives = 242/362 (66%), Gaps = 13/362 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M    FDF+LP   IALRP  PRDSAR++VV P       + D  VSDLP +L   D +V
Sbjct: 6   MRTDLFDFELPSESIALRPASPRDSARMLVVQPGAG----LHDQRVSDLPKWLRPGDQLV 61

Query: 61  FNNTKVITAQLNGVRFCHINR-REKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFS 119
            N+T+VI AQL G R   I R  E  I  TL  R+  + W+   +P++ +  GDI+ F  
Sbjct: 62  VNDTRVIAAQLRGRR---IGRDAEPRIEATLIKRLDGSRWNALVKPARKLIAGDIVRF-G 117

Query: 120 QDGQ----SRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDAR 175
            +G+      L+A V  K   GE+   FS  G  L++ I+ +G+ PLPPYIA KR  D R
Sbjct: 118 NEGRVCFLGHLDAQVESKGEEGEVTFAFSFHGPTLDQAIADLGSPPLPPYIASKREPDDR 177

Query: 176 DYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDT 235
           D  DYQT +A  +G+VAAPTAGLHFT  + + L   G+ ++ +TLHVGAGTF+PVK EDT
Sbjct: 178 DVADYQTMFAVHEGAVAAPTAGLHFTPAVEAVLRERGVGLHRLTLHVGAGTFLPVKTEDT 237

Query: 236 DDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNI 295
             H MHSE G I A TA ALN+ ++ GGRIV+VGTTSLRLLE+AT +DG I P++G T I
Sbjct: 238 VGHRMHSEWGTISAETADALNAARASGGRIVAVGTTSLRLLESATADDGRIAPFTGETAI 297

Query: 296 FITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSL 355
           FITPGYRFRAVDILM+NFHLP+STL MLVSAF G+E  K+ Y HAI+  YRFYSYGD  L
Sbjct: 298 FITPGYRFRAVDILMTNFHLPRSTLFMLVSAFSGLETMKQAYAHAIAAGYRFYSYGDACL 357

Query: 356 LF 357
           LF
Sbjct: 358 LF 359


>gi|329889500|ref|ZP_08267843.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Brevundimonas diminuta ATCC 11568]
 gi|328844801|gb|EGF94365.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Brevundimonas diminuta ATCC 11568]
          Length = 364

 Score =  366 bits (939), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 197/368 (53%), Positives = 249/368 (67%), Gaps = 16/368 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +FDFDLP + IALRP  PRDSARL+VV         +   ++ DLP FL   DA+V
Sbjct: 1   MRTSDFDFDLPEACIALRPADPRDSARLLVVKGG-----DLQHRIIRDLPDFLQPGDALV 55

Query: 61  FNNTKVITAQLNGVRFCHINRREKE-----ISCTLHMRVSPNSWSVYARPSKVIKKGDIL 115
           FN+T+VI A+L+GVR  H    E E     +  TLH R +P+ WS + +P K +K GD +
Sbjct: 56  FNDTRVIPARLSGVR--HRTAPEGELLSVPVEATLHHRDAPDVWSAFMKPGKRLKVGDRV 113

Query: 116 HFFSQDGQS----RLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRP 171
            F  ++  +    +++A +  K   G + L F ++G  L+  I  VG +PLPPYIA KR 
Sbjct: 114 RFGREEDNACLLGQVDAEITAKGEDGLVTLRFDLAGPVLDDAIREVGVMPLPPYIAAKRA 173

Query: 172 IDARDYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVK 231
            D +D  DYQT +A+  GSVAAPTAGLHFT  LL  + + G+  + VTLHVGAGTF+PVK
Sbjct: 174 EDDQDLKDYQTVFAEHDGSVAAPTAGLHFTPALLDAIRARGVTTHAVTLHVGAGTFLPVK 233

Query: 232 VEDTDDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSG 291
            +DT DH MHSE G + A TA ALN+V++ GGRIV VGTTSLRLLE+AT EDG+I P+ G
Sbjct: 234 ADDTADHKMHSEWGEVSAETAAALNAVRAAGGRIVCVGTTSLRLLESATGEDGVIQPFHG 293

Query: 292 FTNIFITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYG 351
            T IFITPGYRFRA D+LM+NFHLPKSTL MLVSAF G+E  +  Y HAI   YRFYSYG
Sbjct: 294 DTAIFITPGYRFRACDVLMTNFHLPKSTLFMLVSAFAGLETMRAAYAHAIDSGYRFYSYG 353

Query: 352 DTSLLFQK 359
           D SLLF++
Sbjct: 354 DGSLLFRE 361


>gi|86749987|ref|YP_486483.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Rhodopseudomonas palustris HaA2]
 gi|86573015|gb|ABD07572.1| Queuosine biosynthesis protein [Rhodopseudomonas palustris HaA2]
          Length = 384

 Score =  366 bits (939), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 192/363 (52%), Positives = 247/363 (68%), Gaps = 11/363 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M    FDFDLP   IALRP+ PRD+AR++VV P  + P    D +V DLPA L   D +V
Sbjct: 27  MRTDLFDFDLPAENIALRPMSPRDAARMLVVRPG-AAP---EDRVVRDLPALLQPGDQLV 82

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+VI AQL+G R       E +I  TL  R+  + W    +P+K + +GD++ F   
Sbjct: 83  VNDTRVIAAQLSGRRIGRAT--EPKIEATLIKRLDGSRWQALVKPAKKLAEGDVVRF-GH 139

Query: 121 DGQ----SRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARD 176
           DG+      L+ATV  K   GE+ L F   G  L++ I+ +G  PLPPYIA KR  D RD
Sbjct: 140 DGRVCLLGHLDATVEVKGEAGEVTLAFCFHGPALDQAIAELGATPLPPYIASKRAPDDRD 199

Query: 177 YVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTD 236
             DYQT +A  +G+VAAPTAGLHFT  L + L + G+ V+ VTLHVGAGTF+PVK +DT 
Sbjct: 200 AADYQTMFAANEGAVAAPTAGLHFTPELDAALAARGVTVHRVTLHVGAGTFLPVKTDDTA 259

Query: 237 DHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIF 296
           +H MH+E G I   TA ALN+ +++GGRIV+VGTTSLRLLE+A  +DG I P++  T IF
Sbjct: 260 EHRMHAEWGTIGRDTAAALNAARAQGGRIVAVGTTSLRLLESAARDDGTIAPFADETAIF 319

Query: 297 ITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           ITPGY+FRAVD+LM+NFHLP+STL MLVSAFCG+E  +  Y+HAI   YRFYSYGD SLL
Sbjct: 320 ITPGYKFRAVDVLMTNFHLPRSTLFMLVSAFCGLETMQAAYRHAIETGYRFYSYGDASLL 379

Query: 357 FQK 359
           F++
Sbjct: 380 FRE 382


>gi|296445819|ref|ZP_06887771.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Methylosinus trichosporium OB3b]
 gi|296256647|gb|EFH03722.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Methylosinus trichosporium OB3b]
          Length = 371

 Score =  365 bits (938), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 194/356 (54%), Positives = 239/356 (67%), Gaps = 11/356 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V+ FDF+LP   IALRP  PRDSARL+VV P+       SD  VSDLP  L   DA+V
Sbjct: 24  MRVELFDFELPQEAIALRPASPRDSARLLVVPPDGH----FSDRSVSDLPQLLAPGDALV 79

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+VI A+L+G R    +R    I  TL  RV  + W    RP+K +  G+ + F   
Sbjct: 80  VNDTQVIHARLSGFRARGESR--AHIDATLIERVGADRWRALVRPAKKLGVGESVRF--- 134

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
                LEA V++K   GEIL  FS++G  L+  +   G +PLPPYIA KR  DARD  DY
Sbjct: 135 --AEGLEARVVEKGENGEILFAFSLAGSALDAAVEASGVMPLPPYIAGKRAADARDEADY 192

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT +A   G+VAAPTAGLHFT  L+  L + G+ ++ VTLHVGAGTF+PVK EDT +H M
Sbjct: 193 QTLFAARAGAVAAPTAGLHFTPRLVDALTARGVSLHSVTLHVGAGTFLPVKAEDTAEHRM 252

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           H+E G IDA TA ALN  ++RGGRIV+VGTT+LR+LE+A   DG I+P++  T IFITPG
Sbjct: 253 HAEWGAIDAATADALNETRARGGRIVAVGTTALRVLESAAGADGRISPFADRTAIFITPG 312

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           YRFRAVD L++NFHLP+STL MLVSAF G+E  K  Y HAI   YRFYSYGD  LL
Sbjct: 313 YRFRAVDALLTNFHLPRSTLFMLVSAFSGLERMKAAYAHAIGSGYRFYSYGDACLL 368


>gi|27379800|ref|NP_771329.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Bradyrhizobium japonicum USDA 110]
 gi|46577026|sp|Q89L59|QUEA_BRAJA RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|27352953|dbj|BAC49954.1| S-adenosylmethionine tRNA ribosyltransferase [Bradyrhizobium
           japonicum USDA 110]
          Length = 366

 Score =  365 bits (936), Expect = 7e-99,   Method: Compositional matrix adjust.
 Identities = 191/363 (52%), Positives = 242/363 (66%), Gaps = 14/363 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M    FDFDLP  RIALRP  PRDSA+++VV         + D  +S+LP +L   D +V
Sbjct: 1   MRTDLFDFDLPAERIALRPASPRDSAKMLVVEGG-----ALRDRTISELPQWLKRGDQLV 55

Query: 61  FNNTKVITAQLNGVRFCHINRR-EKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFS 119
            N+TKVI AQL G R   I R  E +I  TL  R+  + W    +P+K +  GD + F  
Sbjct: 56  VNDTKVIAAQLKGRR---IGRETEPKIEATLIKRLDGSRWQALVKPAKKLIAGDRIRF-G 111

Query: 120 QDGQ----SRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDAR 175
            +G+      L+A V  K + GE+ L FS  G  L++ I+ +G+ PLPPYIA KR  D +
Sbjct: 112 NEGKVCLLGHLDAEVEAKGSEGEVTLSFSFHGPALDQAIADLGSPPLPPYIASKRTPDDQ 171

Query: 176 DYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDT 235
           D+ DYQT +A  +G+VAAPTAGLHFT  L   L   G+ +  VTLHVGAGTF+PVKVEDT
Sbjct: 172 DFADYQTMFAANEGAVAAPTAGLHFTPALEQALRERGVGLNRVTLHVGAGTFLPVKVEDT 231

Query: 236 DDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNI 295
             H MH+E G I A TA+ LN  +  GGRI++VGTTSLRLLE+A +EDG I P++  T+I
Sbjct: 232 AGHKMHAEWGTISAETAERLNIARHNGGRIIAVGTTSLRLLESAASEDGTIQPFAAETSI 291

Query: 296 FITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSL 355
           FITPGYRFRAVDIL++NFHLPKSTL MLVSAF G+E  ++ Y HAI+  YRFYSYGD  L
Sbjct: 292 FITPGYRFRAVDILLTNFHLPKSTLFMLVSAFSGLETMRRAYAHAIAQGYRFYSYGDACL 351

Query: 356 LFQ 358
           LF+
Sbjct: 352 LFR 354


>gi|316934200|ref|YP_004109182.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Rhodopseudomonas palustris DX-1]
 gi|315601914|gb|ADU44449.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Rhodopseudomonas palustris DX-1]
          Length = 360

 Score =  364 bits (934), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 196/364 (53%), Positives = 248/364 (68%), Gaps = 13/364 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M    FDFDLP   IALRPV PRD+AR++VV P    PL   D +V DLPA L   D +V
Sbjct: 1   MRTDLFDFDLPAGNIALRPVSPRDAARMLVVRPG--APL--EDRIVRDLPALLAPGDQLV 56

Query: 61  FNNTKVITAQLNGVRFCHINRR-EKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFS 119
            N+T+VI AQL G R   I R  E +I  TL  R+    W    +P+K +  GD++ F  
Sbjct: 57  VNDTRVIAAQLAGHR---IGRGPEPKIDATLIKRLDGARWQALVKPAKKLVPGDVVRF-G 112

Query: 120 QDGQ----SRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDAR 175
            DG+      L+ATV  K   GEI L FS  G  L++ I+ +G  PLPPYIA KRP D +
Sbjct: 113 HDGRVCLLGHLDATVEAKGEAGEITLAFSFHGPVLDQAIAEIGATPLPPYIASKRPPDVQ 172

Query: 176 DYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDT 235
           D  DYQT +A  +G+VAAPTAGLHFT++L + L + G+ ++ +TLHVGAGTF+PVK EDT
Sbjct: 173 DVADYQTMFAANEGAVAAPTAGLHFTADLEAALAARGVGLHRITLHVGAGTFLPVKAEDT 232

Query: 236 DDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNI 295
            +H MH+E G I   TA+ALN+ ++ GGRIV+VGTTSLRLLE+A  +DG I  ++  T+I
Sbjct: 233 AEHKMHAEWGTISRATAEALNAARAAGGRIVAVGTTSLRLLESAARDDGRIAAFADETSI 292

Query: 296 FITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSL 355
           FITPGYRFRAVD+LM+NFHLP+STL MLVSAFCG++  +  Y HAI   YRFYSYGD SL
Sbjct: 293 FITPGYRFRAVDVLMTNFHLPRSTLFMLVSAFCGLDTMQAAYAHAIRTGYRFYSYGDASL 352

Query: 356 LFQK 359
           LF+ 
Sbjct: 353 LFRN 356


>gi|182679292|ref|YP_001833438.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Beijerinckia indica subsp. indica ATCC 9039]
 gi|238691230|sp|B2IHG4|QUEA_BEII9 RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|182635175|gb|ACB95949.1| S-adenosylmethionine--tRNA-ribosyltransferase-isomerase
           [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 367

 Score =  360 bits (923), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 185/361 (51%), Positives = 252/361 (69%), Gaps = 8/361 (2%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  FDFDLPP RIALRPV PRD++RL+VV P+      ++DH + +LP FL + D +V
Sbjct: 1   MRVDLFDFDLPPERIALRPVEPRDASRLLVVRPDSGD---MTDHGMRELPDFLRAGDVLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+VI A+L+G R    +R   +I  TLH R     W  + +P+K ++ G+ + F  Q
Sbjct: 58  VNDTRVIPARLHGFRSRGESR--AKIEATLHKREGEALWRAFVKPAKKLRVGETICFARQ 115

Query: 121 DGQSR---LEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDY 177
           +  +    LEA V++K   GE++L F+ +G  L+  + L+G +PLPPYIA KR  D++D 
Sbjct: 116 EPGTEVESLEAEVLEKGAEGEVVLGFNRAGAALDAALDLLGEMPLPPYIAGKRAPDSQDS 175

Query: 178 VDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDD 237
           +DYQT +A   G+VAAPTA LHFT  L++ + + G+ +  VTLHVGAGTF+PVK EDTD 
Sbjct: 176 LDYQTLFANRSGAVAAPTASLHFTPRLIAAIEARGVTICKVTLHVGAGTFLPVKAEDTDA 235

Query: 238 HIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFI 297
           H MH+E G + A  A  LN V + GGRI++ GTTSLRLLE+A  EDG+I P+ G T+IF+
Sbjct: 236 HRMHAEWGEVSAEVAAFLNKVHAAGGRIIAAGTTSLRLLESAVDEDGLIQPFQGETSIFM 295

Query: 298 TPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           TPG+RFRAVDIL++NFHLP+STL MLV AF G+E  ++ Y HAI+ +YRFYSYGD  LLF
Sbjct: 296 TPGFRFRAVDILLTNFHLPRSTLFMLVCAFAGLETMRRAYAHAIAASYRFYSYGDACLLF 355

Query: 358 Q 358
           +
Sbjct: 356 R 356


>gi|307293389|ref|ZP_07573235.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase [Sphingobium
           chlorophenolicum L-1]
 gi|306881455|gb|EFN12671.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase [Sphingobium
           chlorophenolicum L-1]
          Length = 342

 Score =  359 bits (922), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 189/358 (52%), Positives = 232/358 (64%), Gaps = 18/358 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  FDFDLPP  IALRP  PRDSARL++V    S   +  D +V DLP  L   D +V
Sbjct: 1   MRVDLFDFDLPPESIALRPASPRDSARLLLV----SGDALFEDRIVRDLPGLLRPGDVLV 56

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FN+TKVI AQL G+R       E  I  TLH R+S   W  + R +K ++ GD + F + 
Sbjct: 57  FNDTKVIPAQLEGMRG------EARIGATLHKRLSLRQWQAFLRNAKRVRDGDRIDFGAG 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIE-LERQISLVGTIPLPPYIARKRPIDARDYVD 179
                + A    +   G + L F   G E +E  +   G +PLPPYIA KRP D RD  D
Sbjct: 111 -----VTAIAGPRDEDGGVTLSFE--GEEPVEVLLERAGRMPLPPYIASKRPTDERDRSD 163

Query: 180 YQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHI 239
           YQT +A+  G+VAAPTA LHFT +L + L   G+    +TLHVGAGTF+PVK EDTDDH 
Sbjct: 164 YQTMFAREDGAVAAPTAALHFTPDLTAALAKAGVGTETLTLHVGAGTFLPVKAEDTDDHR 223

Query: 240 MHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITP 299
           MH+E G ID  TA  LN+ +  GGR+++VGTTSLRLLE+AT E G+I+P++  T IFITP
Sbjct: 224 MHAEWGRIDQATADRLNAARQAGGRLIAVGTTSLRLLESATDEHGVIHPFADETRIFITP 283

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           GYRFRAVD LM+NFHLPKSTL MLVSA  G E  +  Y HAI+  YRFYSYGD+SLL 
Sbjct: 284 GYRFRAVDGLMTNFHLPKSTLFMLVSALMGRERMQAAYAHAIAQGYRFYSYGDSSLLL 341


>gi|312116034|ref|YP_004013630.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Rhodomicrobium vannielii ATCC 17100]
 gi|311221163|gb|ADP72531.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Rhodomicrobium vannielii ATCC 17100]
          Length = 391

 Score =  358 bits (918), Expect = 8e-97,   Method: Compositional matrix adjust.
 Identities = 181/355 (50%), Positives = 241/355 (67%), Gaps = 6/355 (1%)

Query: 3   VKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIVFN 62
           + +FDF+LP S IALRP  PRD+ARL+ V P  + P  +S+  + DLPAF    D +VFN
Sbjct: 30  LTDFDFELPKSAIALRPASPRDAARLLRVDP--AAPQPLSEATIRDLPAFFRPGDIMVFN 87

Query: 63  NTKVITAQLNGVRFCH-INRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQD 121
           +T+V++A+L+G R     +    ++S  L  R +  SW  +ARP++ ++ GD +HF +  
Sbjct: 88  DTRVLSAELSGTRPPRDADAPAVDVSLNLIEREASGSWKAFARPARRLRPGDAIHFETGG 147

Query: 122 GQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDYQ 181
             SRL   V+ K + GEI L  +  G  +E  +   G +PLPPYIAR+RP D RD  DYQ
Sbjct: 148 HASRL--IVVAKSDEGEITLA-APDGDSVEAIMQRHGAMPLPPYIARQRPADERDRSDYQ 204

Query: 182 TTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIMH 241
           T +A+ +G+VAAPTAGLHFT  LL+RL   GI+  FVTLHVGAGTF+PVK E  +DH +H
Sbjct: 205 TVFARNEGAVAAPTAGLHFTPELLARLAERGIETAFVTLHVGAGTFLPVKSETVEDHEIH 264

Query: 242 SEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPGY 301
           +E   I   TA+A+N+ + RGGRI++ GTTSLR+LETAT EDG I P  GFT IFI PG+
Sbjct: 265 AEWFEIGDATARAINAARERGGRIIAAGTTSLRVLETATREDGFIEPAKGFTRIFIKPGH 324

Query: 302 RFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
            FR+ D+L++NFHLPKSTL MLV AF G +  K+ Y HA+   +RFYSYGD  LL
Sbjct: 325 CFRSADLLVTNFHLPKSTLFMLVCAFSGTDLMKRAYAHAVEAGFRFYSYGDACLL 379


>gi|148552954|ref|YP_001260536.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Sphingomonas wittichii RW1]
 gi|166218743|sp|A5V282|QUEA_SPHWW RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|148498144|gb|ABQ66398.1| Queuosine biosynthesis protein [Sphingomonas wittichii RW1]
          Length = 344

 Score =  358 bits (918), Expect = 9e-97,   Method: Compositional matrix adjust.
 Identities = 190/358 (53%), Positives = 237/358 (66%), Gaps = 17/358 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  FDFDLPP  IALRP  PRDSAR+++V  +      ++D  VSDLP  L   D +V
Sbjct: 1   MRVDLFDFDLPPENIALRPASPRDSARMLLVEGSEGA---LADRHVSDLPGLLRVGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FN+T+VI AQL G       R E  I  TLH R     W  + R +K ++ GD + F + 
Sbjct: 58  FNDTRVIPAQLEG------RRGEARIGATLHKREGLRQWRAFVRNAKRVRTGDRIDFGAG 111

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIE-LERQISLVGTIPLPPYIARKRPIDARDYVD 179
                + A   ++   G ILL F   G E +E  +   GT+PLPPYIA KRP D RD  D
Sbjct: 112 -----VSAIAAERGEDGSILLDFE--GDEPVELLLERAGTMPLPPYIAGKRPTDDRDRDD 164

Query: 180 YQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHI 239
           YQT +A+ +G+VAAPTA LHFT  L+  L + GI    +TLHVGAGTF+PVK +DTDDH 
Sbjct: 165 YQTMFAREKGAVAAPTAALHFTPRLMEALAAAGIASETLTLHVGAGTFLPVKADDTDDHR 224

Query: 240 MHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITP 299
           MH+E G IDA TA  LN++++ GGR+++VGTTSLRLLE+AT EDG+I P+ G T IFITP
Sbjct: 225 MHAEWGRIDAATADHLNAIRAAGGRVIAVGTTSLRLLESATGEDGVIRPFDGDTAIFITP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           GYRFRA+D LM+NFHLPKSTL MLVSA  G +  +  Y HAI+  YRFYSYGD+SLL 
Sbjct: 285 GYRFRAIDGLMTNFHLPKSTLFMLVSALMGRDRMQAAYAHAIAEGYRFYSYGDSSLLL 342


>gi|85373945|ref|YP_458007.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Erythrobacter litoralis HTCC2594]
 gi|122544578|sp|Q2NAT1|QUEA_ERYLH RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|84787028|gb|ABC63210.1| S-adenosylmethionine:tRNA-ribosyltransferase [Erythrobacter
           litoralis HTCC2594]
          Length = 347

 Score =  358 bits (918), Expect = 9e-97,   Method: Compositional matrix adjust.
 Identities = 190/357 (53%), Positives = 234/357 (65%), Gaps = 18/357 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  FDF+LP   IALRP  PRDSARL+V     +    I D +V DLP  L   D +V
Sbjct: 1   MRVDLFDFELPQELIALRPAVPRDSARLLVA----AGAGAIDDRIVRDLPQLLMPGDVLV 56

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FN+T+VI AQL G       R E  +  TLH R+    W  + R +K +  GD + F + 
Sbjct: 57  FNDTRVIPAQLTG------KRGEATVGVTLHKRLDLRRWQAFVRNAKRLAPGDTVDFGND 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIE-LERQISLVGTIPLPPYIARKRPIDARDYVD 179
                + A V D+ + G     F+  G E +E  +   GT+PLPPYIA KR  D RD  D
Sbjct: 111 -----VSADVEDRADDGS--FTFAFRGDEPVEVLLDRAGTMPLPPYIAGKRATDERDRDD 163

Query: 180 YQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHI 239
           YQT +A+  G+VAAPTA LHFTS L++ L   G+    +TLHVGAGTF+PVK +DTDDH 
Sbjct: 164 YQTMFAREDGAVAAPTAALHFTSELIAALDERGVARQTLTLHVGAGTFLPVKADDTDDHR 223

Query: 240 MHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITP 299
           MHSE G I+  TA  LN+ KSRGGRI++VGTTSLRLLE+AT EDG+I  ++G T+IFITP
Sbjct: 224 MHSEWGRIEHDTADRLNAAKSRGGRIIAVGTTSLRLLESATGEDGVIRTFAGDTDIFITP 283

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           GYRFRAVD LM+NFHLPKSTL+MLVSA  G E    +Y HAI+  YRFYSYGD+SLL
Sbjct: 284 GYRFRAVDGLMTNFHLPKSTLMMLVSALMGRERMMDIYAHAIAQRYRFYSYGDSSLL 340


>gi|332187845|ref|ZP_08389579.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Sphingomonas sp. S17]
 gi|332012195|gb|EGI54266.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Sphingomonas sp. S17]
          Length = 345

 Score =  356 bits (913), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 184/358 (51%), Positives = 237/358 (66%), Gaps = 19/358 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  FDF LPP RIAL P  PRDSAR++V+  + +      D  VSDLP  L + D +V
Sbjct: 1   MNVDLFDFALPPERIALYPASPRDSARMLVLDGDAT-----RDERVSDLPQALRAGDLLV 55

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FN+T+VI AQL G       R + +I  TLH R     W  + R +K +++GD++ F   
Sbjct: 56  FNDTRVIPAQLQG------TRGDAKIGATLHKREGVRRWRAFIRNAKRLREGDVIDF--- 106

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIE-LERQISLVGTIPLPPYIARKRPIDARDYVD 179
              + + AT  D+   G   L F+  G E +E  +   GT+PLPPYIA+KR +  +D  D
Sbjct: 107 --GAGVSATANDRAEDGSFALDFA--GDEPVELLLERAGTMPLPPYIAQKRGVTEKDAED 162

Query: 180 YQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHI 239
           YQT +A+  G+VAAPTA LHFT  LL  L + GI+   +TLHVGAGTF+PVK +DT DH 
Sbjct: 163 YQTMFAQEPGAVAAPTAALHFTPGLLESLAAAGIEHATLTLHVGAGTFLPVKADDTVDHK 222

Query: 240 MHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITP 299
           MH+E G IDA TA  LN+VK+RGGR+++VGTTSLRL+E+A  EDG+I P+ G T IFITP
Sbjct: 223 MHAEWGRIDAATAHRLNAVKARGGRVIAVGTTSLRLIESAAGEDGVIRPFEGDTAIFITP 282

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           GYRFR +D LM+NFHLP+STL MLVSA  G++  +  Y HAI+  YRFYSYGD SLL 
Sbjct: 283 GYRFRGIDGLMTNFHLPRSTLFMLVSALMGLDRMQAAYAHAIAQGYRFYSYGDASLLL 340


>gi|294013326|ref|YP_003546786.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Sphingobium
           japonicum UT26S]
 gi|292676656|dbj|BAI98174.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Sphingobium
           japonicum UT26S]
          Length = 344

 Score =  355 bits (910), Expect = 8e-96,   Method: Compositional matrix adjust.
 Identities = 187/358 (52%), Positives = 233/358 (65%), Gaps = 18/358 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  FDFDLPP  IALRP  PR SARL++   +   P    D +V DLP  L   D +V
Sbjct: 1   MRVDLFDFDLPPESIALRPASPRHSARLLLAAGD--APF--QDRIVRDLPGLLRPGDVLV 56

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FN+TKVI AQL G+R       + +I  TLH R+    W  + R +K ++ GD + F + 
Sbjct: 57  FNDTKVIPAQLEGMRG------QAKIGATLHKRLGLRQWQAFLRNAKRVRDGDRIDFGNG 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIE-LERQISLVGTIPLPPYIARKRPIDARDYVD 179
                + A    +   G ++L F   G E +E  +   G +PLPPYIA KRP D RD  D
Sbjct: 111 -----VTAVAGPRDEEGGVMLRFE--GEEPVELLLERAGRMPLPPYIASKRPTDERDRSD 163

Query: 180 YQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHI 239
           YQT +A+  G+VAAPTA LHFT  L++ +   GI    +TLHVGAGTF+PVK EDTDDH 
Sbjct: 164 YQTMFAREDGAVAAPTAALHFTPELMTAIEKAGIGTETLTLHVGAGTFLPVKAEDTDDHH 223

Query: 240 MHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITP 299
           MH+E G ID  TA  LN+ ++ GGR+++VGTTSLRLLE+AT EDGII P+   T IFITP
Sbjct: 224 MHAEWGRIDQATAGRLNAARAAGGRLIAVGTTSLRLLESATGEDGIIRPFEDETRIFITP 283

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           GYRFRAVD LM+NFHLPKSTL MLVSA  G E+ + +Y+HAI   YRFYSYGD+SLL 
Sbjct: 284 GYRFRAVDGLMTNFHLPKSTLFMLVSALMGTEKMQSVYRHAIDGGYRFYSYGDSSLLL 341


>gi|85708532|ref|ZP_01039598.1| S-adenosylmethionine:tRNA-ribosyltransferase [Erythrobacter sp.
           NAP1]
 gi|85690066|gb|EAQ30069.1| S-adenosylmethionine:tRNA-ribosyltransferase [Erythrobacter sp.
           NAP1]
          Length = 345

 Score =  354 bits (908), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 188/358 (52%), Positives = 239/358 (66%), Gaps = 15/358 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  FDF+LP  RIALRPV PRD+AR++VV  +   PL  +DH VSDLP  L   D +V
Sbjct: 1   MRVDLFDFELPQERIALRPVRPRDAARMLVVEGS-QGPL--ADHGVSDLPCLLRPGDVLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FN+T+VI AQL G R    +  E +I  TLH R+    W  + R +K +K+GD L F   
Sbjct: 58  FNDTRVIPAQLEGRR----SGGEAKIGATLHKRIDLRRWQAFIRNAKRVKEGDHLVFGGG 113

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIE-LERQISLVGTIPLPPYIARKRPIDARDYVD 179
                + A    +   G + L+F   G E +E  +   GT+PLPPYIA++R +D +D  D
Sbjct: 114 -----VTAIAEKRHRDGSMTLLFE--GTEPVEVLLDRAGTMPLPPYIAQRRGVDDQDQSD 166

Query: 180 YQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHI 239
           YQT +A   G+VAAPTA LHFT+ L+S L   GIK   +TLHVGAGTF+PVK EDT DH 
Sbjct: 167 YQTMFAAEDGAVAAPTASLHFTTRLVSALDHAGIKREMLTLHVGAGTFLPVKAEDTKDHQ 226

Query: 240 MHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITP 299
           MHSE G I+A TA  +N  ++ GGR+++VGTTSLRLLE+A  EDG +  ++G T+IFITP
Sbjct: 227 MHSEFGRINAGTASRINEARAAGGRVIAVGTTSLRLLESAAGEDGKLREFAGDTDIFITP 286

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           GY FR VD LM+NFHLPKSTL+MLVSA  G E   + Y+HAI+  YRFYSYGD+SLL 
Sbjct: 287 GYPFRVVDGLMTNFHLPKSTLMMLVSALMGRERMMEAYEHAIAQNYRFYSYGDSSLLL 344


>gi|115524776|ref|YP_781687.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Rhodopseudomonas palustris BisA53]
 gi|122296024|sp|Q07MX7|QUEA_RHOP5 RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|115518723|gb|ABJ06707.1| Queuosine biosynthesis protein [Rhodopseudomonas palustris BisA53]
          Length = 358

 Score =  351 bits (900), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 187/362 (51%), Positives = 244/362 (67%), Gaps = 11/362 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M    FDFDLP   IALRP  PRD+AR++VV  + +    + D +VS+LP +L   DA+V
Sbjct: 1   MRTDLFDFDLPQGAIALRPASPRDAARMLVVEASGA----LHDRVVSELPEWLRPGDALV 56

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+TKVI AQL G R       E +I  TL  R+  + W    +P+K +  GDI+ F   
Sbjct: 57  VNDTKVIAAQLTGRRIGRDT--EPKIDATLIKRLDGSRWQALVKPAKKLLPGDIVRF-GH 113

Query: 121 DGQ----SRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARD 176
           DG+     +L+ATV  K   GEI+L F++ G  L++ I+ +G  PLPPYIA KR  D RD
Sbjct: 114 DGRVCLLGQLDATVEAKGEAGEIILAFTLHGPVLDQAIAELGAPPLPPYIASKRAPDDRD 173

Query: 177 YVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTD 236
             DYQT +A  +G+VAAPTAGLHFT  L   L + G+ ++ VTLHVGAGTF+PVK EDT 
Sbjct: 174 AADYQTMFAANEGAVAAPTAGLHFTKALEQALAARGVTLHRVTLHVGAGTFLPVKTEDTA 233

Query: 237 DHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIF 296
           +H MH+E G +   TA ALN+ ++  GRIV+VGTTSLRLLE+A  +DG + P++  T IF
Sbjct: 234 EHKMHAEWGCLSRETADALNAARAADGRIVAVGTTSLRLLESAAGDDGRLAPFADDTAIF 293

Query: 297 ITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           ITPGYRF+AVD+LM+NFHLP+STL MLVSAF G++  ++ Y HAI   YRFYSYGD  LL
Sbjct: 294 ITPGYRFKAVDVLMTNFHLPRSTLFMLVSAFAGLDTMQRAYAHAIKSGYRFYSYGDACLL 353

Query: 357 FQ 358
           F+
Sbjct: 354 FR 355


>gi|103487672|ref|YP_617233.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Sphingopyxis alaskensis RB2256]
 gi|122984871|sp|Q1GR22|QUEA_SPHAL RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|98977749|gb|ABF53900.1| Queuosine biosynthesis protein [Sphingopyxis alaskensis RB2256]
          Length = 351

 Score =  348 bits (894), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 184/361 (50%), Positives = 239/361 (66%), Gaps = 19/361 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  FDFDLP  RIALRP  PRD+AR++VV         I D  V DLP +L   D +V
Sbjct: 1   MRVDAFDFDLPSERIALRPARPRDAARMLVVDAG-----NIVDAGVRDLPQWLRPGDCLV 55

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FN+T+VI AQL G+R       E +I  TLH R+    W  + R +K ++ G+ + F S 
Sbjct: 56  FNDTRVIPAQLEGLRG------EAKIGATLHKRIDLRRWQAFVRNAKRLRVGETVDFGSG 109

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIE-LERQISLVGTIPLPPYIARKRPIDARDYVD 179
                + A   ++   G  +L F+  G E +E  +   GT+PLPPYIA KR  D  D  D
Sbjct: 110 -----VAALAEERLADGSFVLAFA--GDEPVELLLERAGTMPLPPYIAGKRGADEADRDD 162

Query: 180 YQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHI 239
           YQT +A+  G+VAAPTA LHFT  LL+ L + GI    +TLHVGAGTF+PVK +DTDDH+
Sbjct: 163 YQTMFAREDGAVAAPTAALHFTPELLAALAAAGIATETLTLHVGAGTFLPVKADDTDDHV 222

Query: 240 MHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITP 299
           MH+E G I+A TA  LN+V++ GGR+++VGTTSLRLLE+A  +DG I P++G T+IFITP
Sbjct: 223 MHAEWGRIEADTAARLNAVRASGGRVIAVGTTSLRLLESAARDDGTITPFAGDTSIFITP 282

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLFQK 359
           GYRF+A+D LM+NFHLP+STL MLVSA  G+E  +  Y HAI+  YRFYSYGD SLL  +
Sbjct: 283 GYRFKAIDGLMTNFHLPRSTLFMLVSALMGLETMQAAYAHAIAREYRFYSYGDASLLLPR 342

Query: 360 R 360
           +
Sbjct: 343 Q 343


>gi|83591621|ref|YP_425373.1| queuosine biosynthesis protein [Rhodospirillum rubrum ATCC 11170]
 gi|91207400|sp|Q2RXQ9|QUEA_RHORT RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|83574535|gb|ABC21086.1| Queuosine biosynthesis protein [Rhodospirillum rubrum ATCC 11170]
          Length = 345

 Score =  348 bits (893), Expect = 7e-94,   Method: Compositional matrix adjust.
 Identities = 188/356 (52%), Positives = 235/356 (66%), Gaps = 18/356 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  FDFDLP   IA+RP  PRDSARL++V           D  V DLP  L+  D +V
Sbjct: 1   MRVDLFDFDLPRDLIAVRPAVPRDSARLLLVEGESR-----RDLGVGDLPGLLDPGDILV 55

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FN+T+VI A+L G     I   +  +  TLH RV P++W  +ARP++ +K G ++ F   
Sbjct: 56  FNDTRVIPARLKG----RIG--DGGVEVTLHKRVGPDAWDCFARPARKLKPGVVILF--- 106

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
                  ATV  +   GE  L F  +G  L   +   G IPLPPYI  KRP DARD  DY
Sbjct: 107 --AEGFTATVAARGEDGEATLRFDRAGAALMAALEAYGHIPLPPYI--KRPDDARDRADY 162

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YA+  G+VAAPTAGLHFT  LL+ L + G+    VTLHVGAGTF+PVKVEDTDDH M
Sbjct: 163 QTIYAREDGAVAAPTAGLHFTPALLAALEARGVSRAMVTLHVGAGTFLPVKVEDTDDHRM 222

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           H+E G + A TA+A+N+ ++ GG++V+VGTT++RLLE+AT  D +I P+ G T+IFITPG
Sbjct: 223 HAETGTLTAQTAEAINAARAAGGKVVAVGTTAMRLLESATGADKVIRPFHGDTSIFITPG 282

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           YRF AVD LM+NFHLP+STL MLVSAF G    +  Y HAIS  YRFYSYGD+SLL
Sbjct: 283 YRFNAVDRLMTNFHLPRSTLFMLVSAFAGASRMRNAYAHAISQGYRFYSYGDSSLL 338


>gi|144900483|emb|CAM77347.1| Queuosine biosynthesis protein [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 345

 Score =  348 bits (892), Expect = 9e-94,   Method: Compositional matrix adjust.
 Identities = 180/356 (50%), Positives = 234/356 (65%), Gaps = 17/356 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  FDFDLP + IA RPV PRD+ARL+ V         ++D +V DLP +L   D ++
Sbjct: 1   MDVNLFDFDLPRTLIAERPVSPRDAARLLHVQAG-----GLTDGVVGDLPRWLRPGDLLI 55

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+VI A+L G       + E  I  TLH R S + W  +ARP+K ++ GD + F   
Sbjct: 56  SNDTRVIPARLFG------RKGEGGIELTLHERTSLDEWKAFARPAKKLRPGDEVRFADD 109

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
                  ATV  K   GE+L+ F   G +L   +   G +PLPPYI RK   D RD  DY
Sbjct: 110 -----FSATVAAKGEAGEVLMRFDRGGDDLMLALDAYGRLPLPPYI-RKGEADERDRADY 163

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT +A+ +G+VAAPTAGLHFT  LL+ L S G+    +TLHVGAGTF+PVKV+DT DH M
Sbjct: 164 QTVFAREKGAVAAPTAGLHFTDALLTALESAGVTRTTITLHVGAGTFLPVKVDDTKDHRM 223

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           H+E G + A  A  +N  K+ GGR+V+VGTTSLRLLE+A  +DG+++P+ G T+IFITPG
Sbjct: 224 HAERGVVTAEVADLVNRTKAAGGRVVAVGTTSLRLLESAADDDGVLHPFDGPTDIFITPG 283

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           YRFR VD+LM+NFHLPKSTL MLVSAF G++   + Y +A++  YRFYSYGD  LL
Sbjct: 284 YRFRLVDVLMTNFHLPKSTLFMLVSAFAGLDRMHQAYAYAMNRGYRFYSYGDACLL 339


>gi|56551748|ref|YP_162587.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Zymomonas
           mobilis subsp. mobilis ZM4]
 gi|81598273|sp|Q5NP84|QUEA_ZYMMO RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|56543322|gb|AAV89476.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase [Zymomonas
           mobilis subsp. mobilis ZM4]
          Length = 342

 Score =  346 bits (888), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 180/359 (50%), Positives = 232/359 (64%), Gaps = 17/359 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  FDF+LP   IALRP  PR+SARL+ V         + D+ V+DLP  L   D ++
Sbjct: 1   MRVDLFDFELPTESIALRPAVPRESARLLQV-----TSQEMDDYHVADLPNLLQEGDLLI 55

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FN+T+VI A L G       + +  IS  +  R     W  + R +K +K  DI+ F   
Sbjct: 56  FNDTRVIPAYLEG------KKNQARISANMIKREGLRQWQAFVRNAKRLKSDDIVDF--- 106

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            GQ  + A V+ + + G +L  F +    +E  +   G +PLPPYIA KRP D +D  DY
Sbjct: 107 -GQD-VSARVVHRNDDGSVLFEF-LGNEPVEILLERAGNMPLPPYIAHKRPADQQDRQDY 163

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT +A+ +G+VAAPTA LHFT  LL RL   G+K   VTLHVGAGTF+P+KVED+DDH+M
Sbjct: 164 QTIFAEKEGAVAAPTASLHFTEELLQRLEEKGVKHTKVTLHVGAGTFLPMKVEDSDDHVM 223

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE G I A TA A+N  K +GGR+++ GTTSLRL+E+A  E G+++P+S  T+IFITPG
Sbjct: 224 HSEWGQISAETANAINETKKQGGRVIATGTTSLRLIESAADETGLVHPFSDETDIFITPG 283

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLFQK 359
           YRFR +D LM+NFHLPKSTL MLVSA  G E+    YQHAI   YRFYSYGD+SLL  K
Sbjct: 284 YRFRVIDGLMTNFHLPKSTLFMLVSALMGREKMLAAYQHAIDTGYRFYSYGDSSLLLPK 342


>gi|5834352|gb|AAD53918.1|AF179611_2 S-adenosylmethionine tRNA ribosyltransferase [Zymomonas mobilis
           subsp. mobilis ZM4]
          Length = 342

 Score =  345 bits (884), Expect = 7e-93,   Method: Compositional matrix adjust.
 Identities = 179/359 (49%), Positives = 232/359 (64%), Gaps = 17/359 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  FDF+LP   IALRP  PR+SARL+ V         + D+ V+DLP  L   D ++
Sbjct: 1   MRVDLFDFELPTESIALRPAVPRESARLLQV-----TSQEMDDYHVADLPNLLQEGDLLI 55

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FN+T+VI A L G       + +  IS  +  R     W  + R +K +K  DI+ F   
Sbjct: 56  FNDTRVIPAYLEG------KKNQARISANMIKREGLRQWQAFVRNAKRLKSDDIVDF--- 106

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            GQ  + A V+ + + G +L  F +    +E  +   G +PLPPYIA KRP D +D  DY
Sbjct: 107 -GQD-VSARVVHRNDDGSVLFEF-LGNEPVEILLERAGNMPLPPYIAHKRPADQQDRQDY 163

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT +A+ +G+VAAPTA LHFT  LL RL   G+K   VTLHVGAGTF+P+KVED+DDH+M
Sbjct: 164 QTIFAEKEGAVAAPTASLHFTEELLQRLEEKGVKHTKVTLHVGAGTFLPMKVEDSDDHVM 223

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE G I A TA A+N  K +GGR+++ GTTSLRL+++A  E G+++P+S  T+IFITPG
Sbjct: 224 HSEWGQISAETANAINETKKQGGRVIATGTTSLRLIDSAADETGLVHPFSDETDIFITPG 283

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLFQK 359
           YRFR +D LM+NFHLPKSTL MLVSA  G E+    YQHAI   YRFYSYGD+SLL  K
Sbjct: 284 YRFRVIDGLMTNFHLPKSTLFMLVSALMGREKMLAAYQHAIDTGYRFYSYGDSSLLLPK 342


>gi|94497297|ref|ZP_01303868.1| Queuosine biosynthesis protein [Sphingomonas sp. SKA58]
 gi|94423160|gb|EAT08190.1| Queuosine biosynthesis protein [Sphingomonas sp. SKA58]
          Length = 344

 Score =  345 bits (884), Expect = 7e-93,   Method: Compositional matrix adjust.
 Identities = 185/361 (51%), Positives = 235/361 (65%), Gaps = 18/361 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  FDFDLPP  IALRP  PRDSARL+      + P  I D  V DLP+ L + D +V
Sbjct: 1   MRVDLFDFDLPPDNIALRPASPRDSARLLAA----AGPSGIEDRTVRDLPSLLRAGDMLV 56

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FN+T+VI AQL G       R E  I  TLH R+    W  + R +K +++GD + F + 
Sbjct: 57  FNDTRVIPAQLEG------RRGEARIGATLHKRIGLRQWQAFLRNAKRVREGDRIEFGAG 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIE-LERQISLVGTIPLPPYIARKRPIDARDYVD 179
                + A    +   G + L F   G E +E  +   GT+PLPPYIA KRP D +D  D
Sbjct: 111 -----VTAIAGARDEDGGVTLEFE--GDEPVEILLERAGTMPLPPYIASKRPTDEQDRSD 163

Query: 180 YQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHI 239
           YQT +A+  G+VAAPTA LHFT  L+  + + G+    +TLHVGAGTF+PVK +DTDDH 
Sbjct: 164 YQTMFAREDGAVAAPTAALHFTPELMDAIAAAGVLTQTLTLHVGAGTFLPVKAQDTDDHR 223

Query: 240 MHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITP 299
           MH+E G IDA  A  LN+ ++ GGR+++VGTTSLRLLE+A  EDG+I P++  T IFITP
Sbjct: 224 MHAEWGRIDAAAADRLNAARAAGGRLIAVGTTSLRLLESAAGEDGVIRPFADETRIFITP 283

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLFQK 359
           GYRFRAVD LM+NFHLPKSTL MLVSA  G E  + +Y HAI+  YRFYSYGD+SLL  +
Sbjct: 284 GYRFRAVDGLMTNFHLPKSTLFMLVSALMGRERMQAIYAHAIAQGYRFYSYGDSSLLLPE 343

Query: 360 R 360
           +
Sbjct: 344 K 344


>gi|83858653|ref|ZP_00952175.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Oceanicaulis alexandrii HTCC2633]
 gi|83853476|gb|EAP91328.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Oceanicaulis alexandrii HTCC2633]
          Length = 357

 Score =  345 bits (884), Expect = 9e-93,   Method: Compositional matrix adjust.
 Identities = 184/363 (50%), Positives = 226/363 (62%), Gaps = 14/363 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FDF LP  RIALRP  PRDSARL+ V         +SD  V DLP  L   D +V
Sbjct: 4   MRLSDFDFHLPEDRIALRPARPRDSARLLQVKDG-----GLSDLGVLDLPNLLEPGDLLV 58

Query: 61  FNNTKVITAQLNGVR--FCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFF 118
           FN+T+VI A L GVR    H      EI   LH R     W  + RP+K +K+GD LHF 
Sbjct: 59  FNDTRVIPAALTGVRPARAHGGGGGVEIEINLHKRDDEAVWRAFVRPAKRLKEGDTLHF- 117

Query: 119 SQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYV 178
               +  L A V +K   GE++L F  +G+EL++ I   G  PLPPYIA KR  DA D  
Sbjct: 118 ----KGGLTAEVREKREGGEVVLTFDRAGVELDKAIVEAGAPPLPPYIASKRAADAADLE 173

Query: 179 DYQTTYA--KIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTD 236
           DYQT YA     GSVAAPTAGLHFT  L + L + GIK   VTLHVGAGTF+PVK ED  
Sbjct: 174 DYQTVYAAPDKAGSVAAPTAGLHFTDRLFAALDARGIKRTHVTLHVGAGTFLPVKTEDLS 233

Query: 237 DHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIF 296
           +H MH+E   +    A+ +N  +  GGRI++VGTTS+R LE+A  EDG +   +  T IF
Sbjct: 234 EHQMHAEWYSVSEEAARTINETRKAGGRIIAVGTTSIRTLESAAEEDGTVRAEARDTAIF 293

Query: 297 ITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           ITPG RF+ +D LM+NFHLPKSTL MLVSA  G E+    Y HAI   YRF+SYGD+SLL
Sbjct: 294 ITPGCRFKVIDALMTNFHLPKSTLFMLVSALAGFEDMHAAYAHAIREHYRFFSYGDSSLL 353

Query: 357 FQK 359
           ++K
Sbjct: 354 WRK 356


>gi|149184807|ref|ZP_01863125.1| Queuosine biosynthesis protein [Erythrobacter sp. SD-21]
 gi|148832127|gb|EDL50560.1| Queuosine biosynthesis protein [Erythrobacter sp. SD-21]
          Length = 342

 Score =  344 bits (883), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 184/358 (51%), Positives = 233/358 (65%), Gaps = 18/358 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  FDF+LP  RIALRP  PRD+AR++VV    + P   +D  V DLPA L+  D +V
Sbjct: 1   MKVDLFDFELPNERIALRPARPRDAARMLVVRG--AEPF--ADRTVLDLPAMLDPGDVLV 56

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FN+T+VI AQL G       R E +I  TLH RV    W  + R +K ++ G+I  F   
Sbjct: 57  FNDTRVIPAQLEG------RRGEAKIGATLHKRVDLRRWQAFIRNAKRLRVGEIATF--- 107

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIE-LERQISLVGTIPLPPYIARKRPIDARDYVD 179
                + A   ++   G  +L F   G E +E  +   GT+PLPPYIA KR  DA+D  D
Sbjct: 108 --GGGVTALAEERLADGSFILFFE--GEEPVEVLLERAGTMPLPPYIAGKRATDAQDRED 163

Query: 180 YQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHI 239
           YQT +AK  G+VAAPTA LHFT  L+  L   GI    +TLHVGAGTF+PVK +DT+DH 
Sbjct: 164 YQTMFAKEDGAVAAPTAALHFTDRLMGALAERGIGTETLTLHVGAGTFLPVKADDTEDHQ 223

Query: 240 MHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITP 299
           MH+E G I+  TA  LN+V++ G R+++VGTTSLRLLE+AT ED +I P++G T+IFITP
Sbjct: 224 MHAEWGRIEQDTADRLNAVRAGGNRVIAVGTTSLRLLESATGEDKVIRPFAGDTDIFITP 283

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           GY FRA+D LM+NFHLPKSTL MLV A  G E  +  Y HAI+  YRFYSYGD+SLL 
Sbjct: 284 GYSFRAIDGLMTNFHLPKSTLFMLVGALMGRERMQAAYAHAIATEYRFYSYGDSSLLL 341


>gi|241762411|ref|ZP_04760490.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase [Zymomonas
           mobilis subsp. mobilis ATCC 10988]
 gi|241373098|gb|EER62747.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase [Zymomonas
           mobilis subsp. mobilis ATCC 10988]
          Length = 342

 Score =  343 bits (881), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 179/359 (49%), Positives = 232/359 (64%), Gaps = 17/359 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  FDF+LP   IALRP  PR+SARL+ V         + D+ V+DLP  L   D ++
Sbjct: 1   MRVDLFDFELPTESIALRPAVPRESARLLQV-----TSQGMDDYHVADLPNLLQEGDLLI 55

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FN+T+VI A L G       + +  IS  +  R     W  + R +K +K  DI+ F   
Sbjct: 56  FNDTRVIPAYLEG------KKNQARISANMIKREGLRQWQAFVRNAKRLKSDDIVDF--- 106

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            GQ  + A V+ + + G +L  F +    +E  +   G +PLPPYIA KRP D +D  DY
Sbjct: 107 -GQD-VSARVVHRNDDGSVLFEF-LGNEPVEILLERAGNMPLPPYIAHKRPADQQDRQDY 163

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT +A+ +G+VAAPTA LHFT  LL RL   G+K   VTLHVGAGTF+P+KVED+DDH+M
Sbjct: 164 QTIFAEKEGAVAAPTASLHFTEELLQRLEEKGVKHTKVTLHVGAGTFLPMKVEDSDDHVM 223

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE G I A TA A+N  K +GGR+++ GTTSLRL+E+A  E G+++P+S  T+IFITPG
Sbjct: 224 HSEWGQISAETANAINETKKQGGRVIATGTTSLRLIESAADEMGLVHPFSDETDIFITPG 283

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLFQK 359
           YRF+ +D LM+NFHLPKSTL MLVSA  G E+    YQHAI   YRFYSYGD+SLL  K
Sbjct: 284 YRFQVIDGLMTNFHLPKSTLFMLVSALMGREKMLAAYQHAIDTGYRFYSYGDSSLLLPK 342


>gi|260752680|ref|YP_003225573.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Zymomonas
           mobilis subsp. mobilis NCIMB 11163]
 gi|258552043|gb|ACV74989.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase [Zymomonas
           mobilis subsp. mobilis NCIMB 11163]
          Length = 342

 Score =  342 bits (878), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 178/359 (49%), Positives = 231/359 (64%), Gaps = 17/359 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  FDF+LP   IALRP  PR+SARL+ V         + D+ V+DLP  L   D ++
Sbjct: 1   MRVDLFDFELPTESIALRPAVPRESARLLQV-----TSQGMDDYHVADLPNLLQEGDLLI 55

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FN+T+VI A L G       + +  IS  +  R     W  + R +K +K  DI+ F   
Sbjct: 56  FNDTRVIPAYLEG------KKNQARISANMIKREGLRQWQAFVRNAKRLKSDDIVDF--- 106

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            GQ  + A V+ + + G +L  F +    +E  +   G +PLPPYIA KRP D +D  DY
Sbjct: 107 -GQD-VSARVVHRNDDGSVLFEF-LGNEPVEILLERAGNMPLPPYIAHKRPADQQDRQDY 163

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT +A+ +G+VAAPTA LHFT  LL RL   G+K   VTLHVGAGTF+P+KV+D+DDH+M
Sbjct: 164 QTIFAEKEGAVAAPTASLHFTEELLQRLEEKGVKHTKVTLHVGAGTFLPMKVDDSDDHVM 223

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE G I A TA  +N  K +GGR+++ GTTSLRL+E+A  E G+++P+S  T+IFITPG
Sbjct: 224 HSEWGQISAETANVINETKKQGGRVIATGTTSLRLIESAADETGLVHPFSDETDIFITPG 283

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLFQK 359
           YRFR +D LM+NFHLPKSTL MLVSA  G E+    YQHAI   YRFYSYGD+SLL  K
Sbjct: 284 YRFRVIDGLMTNFHLPKSTLFMLVSALMGREKMLAAYQHAIDTGYRFYSYGDSSLLLPK 342


>gi|288958938|ref|YP_003449279.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Azospirillum sp. B510]
 gi|288911246|dbj|BAI72735.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Azospirillum sp. B510]
          Length = 342

 Score =  342 bits (877), Expect = 6e-92,   Method: Compositional matrix adjust.
 Identities = 182/358 (50%), Positives = 233/358 (65%), Gaps = 20/358 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +FDFDLPP RIA  PV PRD+ARL+ V  +L       D +V DLPA L   D +V
Sbjct: 1   MKTADFDFDLPPDRIAEHPVRPRDAARLLEVGSSLR------DLIVRDLPALLQPGDLMV 54

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+VI A+L+G       R E  +  TLH R+    W+ +++P K +K GD +   ++
Sbjct: 55  VNDTRVIPARLDG------RRGEVAVEITLHKRLGERDWATFSKPGKRLKPGDTI-VIAE 107

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
           D  + + A      +  E+ L FS  G +L   +   G +PLPPYI RK   DA D  DY
Sbjct: 108 DFSAEVTAK-----DGMEVRLRFSAGGADLMEALHRHGRMPLPPYIRRK--ADAGDNADY 160

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT +A  +G+VAAPTAGLHFT++LL+ L + G++   VTLHVGAGTF+PVKV+D  DH M
Sbjct: 161 QTVFAAREGAVAAPTAGLHFTADLLAALDARGVRRVPVTLHVGAGTFLPVKVDDIADHKM 220

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE G I   TA A+N  +  GGRIVSVGTT+LR+LETA   DG + P+SG T+IFITPG
Sbjct: 221 HSEWGEISPETAAAVNETRKAGGRIVSVGTTALRILETAGRPDGTLVPFSGDTDIFITPG 280

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLFQ 358
           YRFR VD+L +NFHLPKSTL MLV AF G +  +  Y HAI H YRF+SYGD SLL +
Sbjct: 281 YRFRIVDLLWTNFHLPKSTLFMLVCAFAGYDRMRAAYAHAIDHDYRFFSYGDASLLHR 338


>gi|87200264|ref|YP_497521.1| queuosine biosynthesis protein [Novosphingobium aromaticivorans DSM
           12444]
 gi|123488975|sp|Q2G636|QUEA_NOVAD RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|87135945|gb|ABD26687.1| Queuosine biosynthesis protein [Novosphingobium aromaticivorans DSM
           12444]
          Length = 342

 Score =  341 bits (875), Expect = 8e-92,   Method: Compositional matrix adjust.
 Identities = 181/358 (50%), Positives = 230/358 (64%), Gaps = 18/358 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  FDF+LP   IALRP  PRDSARL+ V      P    D +V DLP  LN  D +V
Sbjct: 1   MRVDLFDFELPSENIALRPARPRDSARLLGV--GRDGPF--RDLIVRDLPDLLNPGDVLV 56

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FN+T+VI AQL G       R E  +  TLH R+    W  + R +K +++GD++ F + 
Sbjct: 57  FNDTRVIPAQLEG------QRGEARVGATLHKRIDLRRWQAFVRNAKRLREGDVIQFGAG 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIE-LERQISLVGTIPLPPYIARKRPIDARDYVD 179
                + AT   +   G   L F   G E +E  +   G +PLPPYIA KRP D +D  D
Sbjct: 111 -----VTATAEMRLPDGSWTLFFP--GEEPVEVLLERAGRMPLPPYIAGKRPTDEQDRED 163

Query: 180 YQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHI 239
           YQT +A   G+VAAPTA LHFT +L+  L + G+    +TLHVGAGTF+PVK +DT DH 
Sbjct: 164 YQTMFAAKDGAVAAPTAALHFTPSLMEALAARGVATETLTLHVGAGTFLPVKADDTQDHQ 223

Query: 240 MHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITP 299
           MH+E G IDA TA  LN+ ++ G R+++VGTTSLRLLE+AT ED +I P+ G T+IFITP
Sbjct: 224 MHAEWGTIDAATADRLNAARAAGKRVIAVGTTSLRLLESATGEDRVIRPFEGDTSIFITP 283

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           GY FRA+D LM+NFHLPKSTL MLVSA  G++  +  Y HAI+  YRFYSYGD+SLL 
Sbjct: 284 GYTFRAIDGLMTNFHLPKSTLFMLVSALMGLDRMQAAYAHAIAGGYRFYSYGDSSLLL 341


>gi|326387409|ref|ZP_08209018.1| queuosine biosynthesis protein [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326208065|gb|EGD58873.1| queuosine biosynthesis protein [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 342

 Score =  340 bits (873), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 185/358 (51%), Positives = 224/358 (62%), Gaps = 18/358 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  FDFDLPP RIALRP  PRDSARL+ V P       + D  V DLP  L   D +V
Sbjct: 1   MRVDLFDFDLPPERIALRPARPRDSARLLHV-PGKGA---LGDLHVRDLPGLLRKGDVLV 56

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FN+T+VI AQL G+R       +  I  TLH R     W  + R  K +  GD + F   
Sbjct: 57  FNDTRVIPAQLEGMRG------QARIGATLHKREDLRRWQAFVRNGKRLSPGDTIDF--- 107

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIE-LERQISLVGTIPLPPYIARKRPIDARDYVD 179
            G+  +    + +   G   L F   G E +E  +   G +PLPPYIA KRP DA D  D
Sbjct: 108 -GEGVMALAEV-RHPDGSWTLAFQ--GDEPVEILLERAGRMPLPPYIASKRPTDAADRQD 163

Query: 180 YQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHI 239
           YQT +A   G+VAAPTA LHFT  LL  L   GI    +TLHVGAGTF+PVK EDT DH 
Sbjct: 164 YQTMFAARDGAVAAPTAALHFTPGLLEALADAGIGHETLTLHVGAGTFLPVKAEDTSDHA 223

Query: 240 MHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITP 299
           MH E G I+  TA  LN+V++ GGR+++VGTTSLRLLE+A  ED +I P++G T+IFITP
Sbjct: 224 MHPEWGRIEQETADRLNAVRAGGGRVIAVGTTSLRLLESAAGEDRVIRPFAGDTSIFITP 283

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           GY FRA+D LM+NFHLPKSTL MLVSA  G++  ++ Y HAI   YRFYSYGD SLL 
Sbjct: 284 GYTFRAIDGLMTNFHLPKSTLFMLVSALMGLDRMQEAYAHAIREGYRFYSYGDASLLL 341


>gi|154253493|ref|YP_001414317.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Parvibaculum lavamentivorans DS-1]
 gi|171769669|sp|A7HXM7|QUEA_PARL1 RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|154157443|gb|ABS64660.1| Queuosine biosynthesis protein [Parvibaculum lavamentivorans DS-1]
          Length = 350

 Score =  335 bits (858), Expect = 8e-90,   Method: Compositional matrix adjust.
 Identities = 183/357 (51%), Positives = 233/357 (65%), Gaps = 10/357 (2%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V +FDFDLP   IALRP  PRDSAR++V+ P  +    ++D  VSDLP+ L   D +V
Sbjct: 1   MRVSDFDFDLPEELIALRPARPRDSARMLVIGPAENA---LADKSVSDLPSHLREGDILV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FN+TKVI A+L G R          I   LH R S + W  + RP+K +   + + F   
Sbjct: 58  FNDTKVIPARLFGTR--RRGEASARIEVMLHKRESADEWRAFLRPAKKLNLSETIDF--- 112

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
                L A V +K   GE  L FS+SG  L+  I+  G +PLPPYIARKR  D  D  DY
Sbjct: 113 --PGGLSAAVEEKGEGGEAGLRFSLSGPALDAAIAAAGEMPLPPYIARKRAADDEDVADY 170

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT +A   G+VAAPTAGLHFT  L++ + + G+    +TLHVGAGTF+PV  EDTD H M
Sbjct: 171 QTLHADEPGAVAAPTAGLHFTPALMAAIEARGVSTVRLTLHVGAGTFLPVTAEDTDTHKM 230

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           H+E G I    A A+N  +++GGRIV+VGTTSLRLLE+A  E G ++P+ G T+IFITPG
Sbjct: 231 HAERGEITEAEAAAINEARAKGGRIVAVGTTSLRLLESAVDEAGTVHPFRGETDIFITPG 290

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           YRFRAVD+LM+NFHLP+STL MLVSA    EE K+ Y HA++  YRFYSYGD  L++
Sbjct: 291 YRFRAVDVLMTNFHLPRSTLFMLVSALRSTEEMKRAYAHAVAEKYRFYSYGDACLIY 347


>gi|315499637|ref|YP_004088440.1| s-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Asticcacaulis excentricus CB 48]
 gi|315417649|gb|ADU14289.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Asticcacaulis excentricus CB 48]
          Length = 348

 Score =  334 bits (856), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 177/362 (48%), Positives = 227/362 (62%), Gaps = 19/362 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V +FDFDLP  RIALRPV PR++ARL+ V       +V  D  V DLP+ L + D +V
Sbjct: 1   MKVSDFDFDLPEDRIALRPVTPREAARLLRVDG-----VVREDWRVGDLPSLLKAGDLLV 55

Query: 61  FNNTKVITAQLNGVRFCHINRREKE---ISCTLHMRVSPNSWSVYARPSKVIKKGDILHF 117
            NNT+V+  QL G R      RE +      TL   +    W  + +P + I++GD L F
Sbjct: 56  INNTRVLPTQLKGTRV-----REGQTVAFEATLIKSLDGQRWQAFLKPGRRIREGDTLRF 110

Query: 118 FSQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDY 177
                   L A V+ K   G  +L F  +  E+   +  +G +PLPPYI  KRP D +D 
Sbjct: 111 ------DDLSARVLSKDEDGVYVLRFEQAASEVLNGLHRLGGMPLPPYIRSKRPEDEQDK 164

Query: 178 VDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDD 237
            DYQT +A+ +GSVAAPTAGLHFT  LL  L   G+    VTLHVGAGTF+PVKVEDT D
Sbjct: 165 SDYQTVFARDEGSVAAPTAGLHFTPELLQALRDKGVLFEEVTLHVGAGTFLPVKVEDTKD 224

Query: 238 HIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFI 297
           H MH+E G + A +A  +N+ +  GGRI+++GTT+LRL+E+A   DG I+P+SG T+IFI
Sbjct: 225 HRMHAEFGVVSADSAARINAARVAGGRIIAIGTTALRLIESACDADGRIHPFSGDTDIFI 284

Query: 298 TPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           TPG   R+ D+L +NFHLPKSTL MLV AF G E  K  Y HAI+  YRF+SYGD SLL 
Sbjct: 285 TPGVPVRSADMLWTNFHLPKSTLFMLVCAFAGTEAMKAAYAHAINSGYRFFSYGDASLLT 344

Query: 358 QK 359
            K
Sbjct: 345 NK 346


>gi|23016644|ref|ZP_00056398.1| COG0809: S-adenosylmethionine:tRNA-ribosyltransferase-isomerase
           (queuine synthetase) [Magnetospirillum magnetotacticum
           MS-1]
          Length = 345

 Score =  331 bits (849), Expect = 9e-89,   Method: Compositional matrix adjust.
 Identities = 183/358 (51%), Positives = 234/358 (65%), Gaps = 20/358 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLV--ISDHLVSDLPAFLNSNDA 58
           M V +FDF+LP   IA RPV PRDSARL+ V      P++  +SD  V DLP  L   D 
Sbjct: 1   MRVDDFDFELPRELIAERPVCPRDSARLLHV------PIIGGLSDRGVRDLPDLLMPGDI 54

Query: 59  IVFNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFF 118
           +VFN+TKVI A+L G       R    +  TLH R     W  +ARP+K ++ GD + F 
Sbjct: 55  LVFNDTKVIPARLFG------RRGTAGVEVTLHQRTGLAQWKAFARPAKKLRPGDRVDF- 107

Query: 119 SQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYV 178
                    ATV +K   GE+ L F  SG +L   +   G++PLPPYI RK   D RD  
Sbjct: 108 ----AEGFFATVAEKGEMGEVTLDFDRSGEDLMVALEAFGSLPLPPYI-RKGEADERDRG 162

Query: 179 DYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDH 238
           DYQT +A+ +G+VAAPTAGLHFT +LL+ L + G+K   VTLHVGAGTF+PVK +DT+DH
Sbjct: 163 DYQTVFARQKGAVAAPTAGLHFTPDLLAALDARGVKRATVTLHVGAGTFLPVKADDTNDH 222

Query: 239 IMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFIT 298
            MH EIG I   TA A+N+ K+ GGR+V+VGTTS RLLE+A    GI++P+ G T+IFIT
Sbjct: 223 RMHQEIGVITPETAAAINAAKAAGGRVVAVGTTSARLLESAADPLGILHPFDGATDIFIT 282

Query: 299 PGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           PG+ FR  D+L++NFHLP+STL MLVSAF G+   K+ Y+HA +  YRFYSYGD  LL
Sbjct: 283 PGHSFRLADVLLTNFHLPRSTLFMLVSAFSGLSRMKEAYEHAKAAGYRFYSYGDCCLL 340


>gi|91207425|sp|Q5FR06|QUEA_GLUOX RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
          Length = 347

 Score =  326 bits (835), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 173/351 (49%), Positives = 224/351 (63%), Gaps = 15/351 (4%)

Query: 6   FDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIVFNNTK 65
           FDF+LP   IA  P  PRDSA L+ V P L        H++ DLP FL   D ++ NNT 
Sbjct: 8   FDFELPRDHIATEPARPRDSATLLHVRPGLPP----DPHVIRDLPDFLREGDLLIANNTA 63

Query: 66  VITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQDGQSR 125
           VI AQL   R       E +I  TL   ++  SW   AR S+ +K  DILHF    G   
Sbjct: 64  VIRAQLAATR------GEAKIGLTLDRILANGSWHALARNSRKLKPQDILHF----GDDP 113

Query: 126 LEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDYQTTYA 185
           + ATVI+    G + + FS+ G E +  +  VG + LPPYI R      +D  DY+T ++
Sbjct: 114 VTATVIENEGDGAVSIRFSVEGDEFDAFLERVGALALPPYIERPFGPTKQDDADYRTIFS 173

Query: 186 KIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIMHSEIG 245
           + +G+VAAPTAGLHFT  +L+ L + GI+   +TLHVGAGTF+PV+     +H MH+E G
Sbjct: 174 QYRGAVAAPTAGLHFTPEVLAALDAKGIQRRTLTLHVGAGTFLPVR-STIAEHKMHAEWG 232

Query: 246 FIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPGYRFRA 305
            IDA TA A+N  ++RGGRIV+VGTTSLRLLE+A  EDG + PW G T+IFI PGYRF+A
Sbjct: 233 EIDAETAAAINETRARGGRIVAVGTTSLRLLESAAREDGTVAPWRGETSIFIKPGYRFKA 292

Query: 306 VDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           VD+LM+NFHLP+STL MLV AF G E  ++ Y +AI++  RFYSYGD  LL
Sbjct: 293 VDVLMTNFHLPRSTLFMLVCAFSGTETMREAYAYAIANGLRFYSYGDACLL 343


>gi|58039882|ref|YP_191846.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Gluconobacter oxydans 621H]
 gi|58002296|gb|AAW61190.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Gluconobacter oxydans 621H]
          Length = 357

 Score =  325 bits (834), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 173/351 (49%), Positives = 224/351 (63%), Gaps = 15/351 (4%)

Query: 6   FDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIVFNNTK 65
           FDF+LP   IA  P  PRDSA L+ V P L        H++ DLP FL   D ++ NNT 
Sbjct: 18  FDFELPRDHIATEPARPRDSATLLHVRPGLPP----DPHVIRDLPDFLREGDLLIANNTA 73

Query: 66  VITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQDGQSR 125
           VI AQL   R       E +I  TL   ++  SW   AR S+ +K  DILHF    G   
Sbjct: 74  VIRAQLAATR------GEAKIGLTLDRILANGSWHALARNSRKLKPQDILHF----GDDP 123

Query: 126 LEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDYQTTYA 185
           + ATVI+    G + + FS+ G E +  +  VG + LPPYI R      +D  DY+T ++
Sbjct: 124 VTATVIENEGDGAVSIRFSVEGDEFDAFLERVGALALPPYIERPFGPTKQDDADYRTIFS 183

Query: 186 KIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIMHSEIG 245
           + +G+VAAPTAGLHFT  +L+ L + GI+   +TLHVGAGTF+PV+     +H MH+E G
Sbjct: 184 QYRGAVAAPTAGLHFTPEVLAALDAKGIQRRTLTLHVGAGTFLPVR-STIAEHKMHAEWG 242

Query: 246 FIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPGYRFRA 305
            IDA TA A+N  ++RGGRIV+VGTTSLRLLE+A  EDG + PW G T+IFI PGYRF+A
Sbjct: 243 EIDAETAAAINETRARGGRIVAVGTTSLRLLESAAREDGTVAPWRGETSIFIKPGYRFKA 302

Query: 306 VDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           VD+LM+NFHLP+STL MLV AF G E  ++ Y +AI++  RFYSYGD  LL
Sbjct: 303 VDVLMTNFHLPRSTLFMLVCAFSGTETMREAYAYAIANGLRFYSYGDACLL 353


>gi|83952643|ref|ZP_00961373.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Roseovarius
           nubinhibens ISM]
 gi|83835778|gb|EAP75077.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Roseovarius
           nubinhibens ISM]
          Length = 348

 Score =  323 bits (828), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 168/356 (47%), Positives = 229/356 (64%), Gaps = 11/356 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FDFDLP   IA RPV PR +ARL+V          I D  V DL  +L   D +V
Sbjct: 1   MKLSDFDFDLPEELIATRPVRPRPAARLLVAEGA-----AIRDAHVRDLGQWLRPGDRLV 55

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+TKVI A+L+G+R    +     I  TL        W    +P K +++G+++ F   
Sbjct: 56  LNDTKVIPARLSGLRHREGSEAGARIEVTLLEPDGQGQWGALIKPLKKLREGEVVAF--- 112

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
              + L AT++ K + G+ LL F++ G + +  ++  G +PLPPYIA KRP DA+D+ DY
Sbjct: 113 --AAGLSATLVAK-SEGQGLLRFNLEGDDFDAALAEAGAMPLPPYIAAKRPADAQDHEDY 169

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT +A+ +G+VAAPTA LHF   LL+ L   G+++  VTLHVGAGTF+PVKVED   H M
Sbjct: 170 QTVFARNKGAVAAPTASLHFDEALLAALRGQGVEMTHVTLHVGAGTFLPVKVEDVTTHKM 229

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           H+E G +    A  + + ++ GGRI+ VGTT+LRL+ETA+ E G I PW G T+IFI PG
Sbjct: 230 HAEWGEVSEKAAAEIAATRAAGGRIIPVGTTALRLIETASRETGEIAPWQGETDIFIYPG 289

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           + FRA D LM+NFHLPKSTL+MLVSA  G +   ++Y+HAI+  YRF+SYGD SLL
Sbjct: 290 FTFRATDALMTNFHLPKSTLMMLVSALMGKDRMARVYEHAIAEKYRFFSYGDASLL 345


>gi|126726330|ref|ZP_01742171.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Rhodobacterales bacterium HTCC2150]
 gi|126704193|gb|EBA03285.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Rhodobacterales bacterium HTCC2150]
          Length = 359

 Score =  323 bits (828), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 165/358 (46%), Positives = 228/358 (63%), Gaps = 13/358 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +++FDLP + IA RP  PR +AR++ V  + S  L      V+DL   LN+ D +V
Sbjct: 1   MKLSDYNFDLPETLIATRPAVPRTAARMLHVAGDDSVDLS-----VTDLTDLLNAGDLLV 55

Query: 61  FNNTKVITAQLNGVRFCH--INRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFF 118
            NNTKVI A+L G RF          +I  TL    +   W    +P K +K+G+ + F 
Sbjct: 56  LNNTKVIPARLFGQRFRQGDAGATSAKIEMTLLSPTTDGHWQALVKPLKKVKEGEEVVF- 114

Query: 119 SQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYV 178
                 +L A +I K + G  ++ F+  G + +  ++ VG +PLPPYIA KR  D +D++
Sbjct: 115 ----SEKLSAKLISKAD-GMSVVAFNQQGRDFDEALAEVGKMPLPPYIAAKRAADQQDHI 169

Query: 179 DYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDH 238
           DYQT +A+  G+VAAPTA LHF   LL ++ + G+ + +VTLHVGAGTF+PVKV+D   H
Sbjct: 170 DYQTVFAQTTGAVAAPTASLHFDQELLDKIRAKGVNITYVTLHVGAGTFLPVKVDDISQH 229

Query: 239 IMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFIT 298
            MHSE G +    A+A+     +GGR++ VGTT+LRL+ETA  E+G I+PW G T+IFI 
Sbjct: 230 KMHSEWGEVTDGAAKAIMQTHEQGGRVIPVGTTALRLIETAADENGKISPWVGDTDIFIH 289

Query: 299 PGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           PGY F+  D LM+NFHLPKSTL+MLVSA  G    K++Y HAI H YRF+SYGD+SLL
Sbjct: 290 PGYEFKVTDALMTNFHLPKSTLMMLVSALMGQSRIKEVYSHAIEHKYRFFSYGDSSLL 347


>gi|148260342|ref|YP_001234469.1| queuosine biosynthesis protein [Acidiphilium cryptum JF-5]
 gi|326403533|ref|YP_004283615.1| S-adenosylmethionine--tRNA ribosyltransferase-isomerase
           [Acidiphilium multivorum AIU301]
 gi|166216693|sp|A5FY68|QUEA_ACICJ RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|146402023|gb|ABQ30550.1| Queuosine biosynthesis protein [Acidiphilium cryptum JF-5]
 gi|325050395|dbj|BAJ80733.1| S-adenosylmethionine--tRNA ribosyltransferase-isomerase
           [Acidiphilium multivorum AIU301]
          Length = 345

 Score =  319 bits (818), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 164/356 (46%), Positives = 219/356 (61%), Gaps = 14/356 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FD+ LPP RIA  P  PR +ARL+ V  +      + D  + DLPA L   D +V
Sbjct: 1   MNLADFDYHLPPERIAAEPARPRHAARLLHVRGD-----GLDDRTILDLPALLAPGDLLV 55

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+VI AQL G       R +  I  TL   ++  +W V  R ++  + G+ +     
Sbjct: 56  VNDTRVIPAQLTG------RRGDARIGITLDRPLADGTWRVLLRNARRARPGETIAI--- 106

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
           DG   + A VID+   G   L F          +    ++ LPPYI R   I  +D  DY
Sbjct: 107 DGAGGIAAEVIDRAPDGSATLRFDCDAETFRAMLDRAASLALPPYIPRPAGISEQDRQDY 166

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT +A  +G+VAAPTAGLHFT  +L+ L + G+ +  VTLHVGAGTF+PV+ +  + H +
Sbjct: 167 QTMFAAEEGAVAAPTAGLHFTETVLAALAARGVGLATVTLHVGAGTFLPVREDQLERHKL 226

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           H+E G I   TA  +N+ ++RGGRIV+VGTTSLR+LETA  +DG + PW G T +FITPG
Sbjct: 227 HAERGLIGPETAALVNATRARGGRIVAVGTTSLRVLETAAGDDGTLAPWHGETELFITPG 286

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           YRF+ VD LM+NFHLPKSTLLMLV+AF G+E  +  Y HAI+  YRFYSYGD SLL
Sbjct: 287 YRFKLVDRLMTNFHLPKSTLLMLVAAFAGVERMRAAYAHAIARGYRFYSYGDASLL 342


>gi|163792636|ref|ZP_02186613.1| Queuosine biosynthesis protein [alpha proteobacterium BAL199]
 gi|159182341|gb|EDP66850.1| Queuosine biosynthesis protein [alpha proteobacterium BAL199]
          Length = 349

 Score =  319 bits (818), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 171/363 (47%), Positives = 229/363 (63%), Gaps = 20/363 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  FD+ LP  RIA  P  PRD+ARL+ +  +      ++D  ++DLP  L   D ++
Sbjct: 1   MRVDLFDYHLPEERIARFPANPRDTARLLDLTGDR-----LADRTIADLPDLLQPGDLLI 55

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+VI A+L+G       R E ++  TLH R     W  +ARP+K ++ GD + F +Q
Sbjct: 56  ANDTRVIPARLDG------KRGEAKVEVTLHKRDGDAVWRAFARPAKKLRPGDRITF-AQ 108

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
           D    L A V  K   GE+ L F  +G  L   ++  G +PLPPYI R+      D  DY
Sbjct: 109 D----LTAEVTAKGEAGEVTLSFDTAGPALMEALAAYGRMPLPPYIKRQADEIQDDARDY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT +A   G+VAAPTAGLHFT  LL+R+ + G++   VTLHVGAGTF+PVKV+DT DH+M
Sbjct: 165 QTVFAARDGAVAAPTAGLHFTPELLARIEARGVRRALVTLHVGAGTFLPVKVDDTADHVM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE----DGIINPWSGFTNIF 296
           HSE G + + TA A+   ++ GGR+V+ GTT+LR+LE A       D  +  WSG T++F
Sbjct: 225 HSEWGSVPSETAAAVAETRAAGGRVVATGTTTLRILEAAAQTTAPGDDAVPAWSGETDLF 284

Query: 297 ITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           ITPGYRFRAVD+L++NFHLP+STLLMLVSAF G E     Y HAI   YRF+SYGD  LL
Sbjct: 285 ITPGYRFRAVDLLLTNFHLPRSTLLMLVSAFSGRERILAAYDHAIRTGYRFFSYGDACLL 344

Query: 357 FQK 359
            ++
Sbjct: 345 ARE 347


>gi|163731371|ref|ZP_02138818.1| S-adenosylmethionine [Roseobacter litoralis Och 149]
 gi|161394825|gb|EDQ19147.1| S-adenosylmethionine [Roseobacter litoralis Och 149]
          Length = 351

 Score =  318 bits (816), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 171/361 (47%), Positives = 222/361 (61%), Gaps = 14/361 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FDFDLP   IA RP  PR SARL+V          ISD +VSDLP +L+  D +V
Sbjct: 1   MKLSDFDFDLPEDLIATRPAVPRTSARLLVAKGQQ-----ISDSIVSDLPNWLSPGDRLV 55

Query: 61  FNNTKVITAQLNGVRFCHINR--REKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFF 118
            N+T+VI A+L G R     +   +  I  TL    +   WS   +P K +K G+ + F 
Sbjct: 56  LNDTRVIPARLTGARHRDTAQGPMQARIEVTLLEPDARGDWSALIKPLKKVKIGEEIIF- 114

Query: 119 SQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYV 178
                  L AT +     G+  L F++ G + +  ++  G +PLPPYIA +RP D RD  
Sbjct: 115 ----SDVLRAT-LQSVTDGQGFLKFNLEGDDFDAALNAAGAMPLPPYIATRRPADERDKS 169

Query: 179 DYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDH 238
           DYQT +A+  G+VAAPTA LHF   LLS L + G+   +VTLHVGAGTF+PVKVED   H
Sbjct: 170 DYQTVFAQNNGAVAAPTASLHFDEALLSELAARGVLFSYVTLHVGAGTFLPVKVEDVTTH 229

Query: 239 IMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFIT 298
            MH+E G + A  A  +N+ K  G R++ VGTT+LRL+ETA  E G I  W G T+IFI 
Sbjct: 230 KMHAEWGQVSAVAAAEINATKQAGKRVIPVGTTALRLIETAGRE-GQITAWEGDTDIFIY 288

Query: 299 PGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLFQ 358
           PG+RF   D LM+NFHLPKSTL+MLVSA  G +E + +Y HAI+  YRF+SYGD SLL  
Sbjct: 289 PGFRFNVADALMTNFHLPKSTLMMLVSALMGYDEVRTIYNHAIAEKYRFFSYGDASLLIP 348

Query: 359 K 359
           K
Sbjct: 349 K 349


>gi|126735609|ref|ZP_01751354.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Roseobacter
           sp. CCS2]
 gi|126714796|gb|EBA11662.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Roseobacter
           sp. CCS2]
          Length = 350

 Score =  318 bits (814), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 167/359 (46%), Positives = 231/359 (64%), Gaps = 14/359 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + EFDFDLP S IA RP  PR SARL+     L+    I D +V+ LP  L   D ++
Sbjct: 1   MKLSEFDFDLPDSLIATRPARPRSSARLL-----LAQGATIEDRIVNQLPDILQPGDRLI 55

Query: 61  FNNTKVITAQLNGVRF--CHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFF 118
            N+TKVI A+L G+R           ++  TL    +  SWS   +P K ++ G+++  F
Sbjct: 56  LNDTKVIPARLFGLRHRSGEAGETAAKMDVTLLEPRADGSWSALIKPLKKVRDGEVI-VF 114

Query: 119 SQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYV 178
           S D    LEA V  + + G+  L F++ G + +  ++ VG +PLPPYIA KR  D  D  
Sbjct: 115 SDD----LEAEVTGRGD-GQGYLAFNLKGDDFDAALNAVGAMPLPPYIAGKRSADDADKT 169

Query: 179 DYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDH 238
           DYQT +A+  G+VAAPTA LHF   LL+ L + G++   VTLHVGAGTF+PVKV+D  DH
Sbjct: 170 DYQTYWARNSGAVAAPTASLHFDGPLLAALAARGVQFTHVTLHVGAGTFLPVKVDDVRDH 229

Query: 239 IMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFIT 298
            MH+E G + A  A  +N+ K+ G R++ VGTT+LRL+E+A  + G++ PW+G T+IFIT
Sbjct: 230 KMHAEWGEVTADAAAEINATKAAGHRVIPVGTTALRLIESA-AQRGVMQPWTGPTDIFIT 288

Query: 299 PGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           PG++F+  D LM+NFHLPKSTL+MLVSA  G +  + +Y HAI+  YRF+SYGD+SLL 
Sbjct: 289 PGFQFQMADGLMTNFHLPKSTLMMLVSALMGTDTIRAIYAHAIAQNYRFFSYGDSSLLL 347


>gi|110680196|ref|YP_683203.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Roseobacter
           denitrificans OCh 114]
 gi|123172304|sp|Q164S6|QUEA_ROSDO RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|109456312|gb|ABG32517.1| S-adenosylmethionine [Roseobacter denitrificans OCh 114]
          Length = 351

 Score =  317 bits (811), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 170/362 (46%), Positives = 225/362 (62%), Gaps = 14/362 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FDFDLP   IA RP  PR SARL+V          ISD +VSDLP +L+  D +V
Sbjct: 1   MKLSDFDFDLPEDLIATRPAVPRTSARLLVAKGRQ-----ISDSIVSDLPNWLSPGDRLV 55

Query: 61  FNNTKVITAQLNGVRFCHINR--REKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFF 118
            N+T+VI A+L G R     +   +  I  TL    +  +WS   +P K +K  + + F 
Sbjct: 56  LNDTRVIPARLTGARHRDTAQGPMQARIEVTLLEPDAQGNWSALIKPLKKVKIAEEIIF- 114

Query: 119 SQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYV 178
                 RL AT +     G+ +L F++ G + +  ++  G +PLPPYIA +RP D RD  
Sbjct: 115 ----SDRLRAT-LRAVKDGQGVLQFNLEGDDFDAALNAAGAMPLPPYIATRRPADERDKS 169

Query: 179 DYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDH 238
           DYQT +A+  G+VAAPTA LHF   LLS L + G+   +VTLHVGAGTF+PVKVED   H
Sbjct: 170 DYQTVFAQNSGAVAAPTASLHFDKALLSELAARGVLFSYVTLHVGAGTFLPVKVEDVTTH 229

Query: 239 IMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFIT 298
            MH+E G + A  A  +N+ K  G R++ VGTT+LRL+ETA  E G I  W G T+IFI 
Sbjct: 230 KMHAEWGQVSAAAAAEINATKQAGKRVIPVGTTALRLIETAGRE-GQIKAWEGDTDIFIY 288

Query: 299 PGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLFQ 358
           PG+RF   D LM+NFHLPKSTL+MLVSA  G +E + +Y HA++  YRF+SYGD SLL  
Sbjct: 289 PGFRFNVADALMTNFHLPKSTLMMLVSALMGYDEVRAIYDHAVAEKYRFFSYGDASLLIP 348

Query: 359 KR 360
           +R
Sbjct: 349 QR 350


>gi|294677090|ref|YP_003577705.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Rhodobacter
           capsulatus SB 1003]
 gi|294475910|gb|ADE85298.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Rhodobacter
           capsulatus SB 1003]
          Length = 350

 Score =  315 bits (807), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 163/359 (45%), Positives = 226/359 (62%), Gaps = 13/359 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FDF+LP  RIA+RP  PR +A+L+V  P+      I D  V+DLP  L   D +V
Sbjct: 1   MNLSDFDFELPEGRIAIRPARPRTAAKLLVATPD-----AIRDLTVADLPDLLGPGDRLV 55

Query: 61  FNNTKVITAQLNGVRFCHINRRE--KEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFF 118
            N TKVI A+L+G R     + E    +  TL        W   A+P + +K+G+ +  F
Sbjct: 56  LNTTKVIPARLSGRRTRQSAQGEVVARVEVTLLEPAPGGDWMALAKPLRKLKEGEEI-VF 114

Query: 119 SQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYV 178
           S    +R+ A        G++ + F+++G + +  ++  G +PLPPYIA  R  D +D  
Sbjct: 115 SDALSARIAAIA-----EGQMRIRFNLTGPDFDAALAEAGAMPLPPYIAALRAPDEQDKT 169

Query: 179 DYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDH 238
           DYQT +A+  G+VAAPTA LHFT +LL +L   G++   VTLHVGAGTF+PVKVED   H
Sbjct: 170 DYQTVFAQKPGAVAAPTASLHFTPDLLEKLRDKGVQFTEVTLHVGAGTFLPVKVEDVTTH 229

Query: 239 IMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFIT 298
            MH+E G +    A  +N+ K+ GGR++ VGTT+LRL+E+A T  G+I P++  T+IFI 
Sbjct: 230 RMHAEWGEVTPQAAAEINATKAAGGRVIPVGTTALRLIESAATGPGVIAPFAATTDIFIY 289

Query: 299 PGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           PGYRFR  D LM+NFHLPKSTLLMLVSA  G +  + +Y HA++  YRF+SYGD SLL 
Sbjct: 290 PGYRFRIADALMTNFHLPKSTLLMLVSALMGQDRIRAIYDHALTKNYRFFSYGDASLLL 348


>gi|254466678|ref|ZP_05080089.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Rhodobacterales bacterium Y4I]
 gi|206687586|gb|EDZ48068.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Rhodobacterales bacterium Y4I]
          Length = 354

 Score =  315 bits (807), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 168/367 (45%), Positives = 232/367 (63%), Gaps = 24/367 (6%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FDFDLP + IA RP  PR SARL+V     +    + D  V+DL  +L   D +V
Sbjct: 1   MKLSDFDFDLPDTLIATRPANPRSSARLLV-----AAGGSLHDGRVTDLVDWLQPGDRLV 55

Query: 61  FNNTKVITAQLNGVRFCHINRREK-------EISCTLHMRVSPNSWSVYARPSKVIKKGD 113
            N+TKVI A+L+G+R     RR+        +I  TL    +  SW+   +P K I++G+
Sbjct: 56  LNDTKVIPARLSGLR-----RRDSAQGPVAAKIEATLLEPRADGSWAALLKPLKKIREGE 110

Query: 114 ILHFFSQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPID 173
            +  FS D  + LEA        G+  L F++SG + +  ++  G +PLPPYIA KR  D
Sbjct: 111 EI-VFSDDLSAALEAI-----EDGQGHLRFNLSGTDFDAALAEAGAMPLPPYIAAKRAAD 164

Query: 174 ARDYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVE 233
            +D  DYQT +A+  G+VAAPTA LHF + LL  L + G+++ +VTLHVGAGTF+PVKVE
Sbjct: 165 EQDKTDYQTVWARNSGAVAAPTASLHFDAPLLEALKARGVEISYVTLHVGAGTFLPVKVE 224

Query: 234 DTDDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFT 293
           D   H MH+E G +    A  + + K+ GGR++ VGTT+LRL+E+A   DG I+ W G T
Sbjct: 225 DVTTHRMHAEWGKVSEEAASEIAATKAAGGRVIPVGTTALRLIESA-ARDGQIHAWEGDT 283

Query: 294 NIFITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDT 353
           +IFI PG++F+  D LM+NFHLPKSTLLMLVSA  G EE +++Y HA+   YRF+SYGD 
Sbjct: 284 DIFIYPGFKFQVADALMTNFHLPKSTLLMLVSALMGQEEIRRIYDHAVRSGYRFFSYGDA 343

Query: 354 SLLFQKR 360
           SLL   +
Sbjct: 344 SLLIPAK 350


>gi|297172494|gb|ADI23466.1| S-adenosylmethionine:tRNA-ribosyltransferase-isomerase (queuine
           synthetase) [uncultured nuHF1 cluster bacterium
           HF0770_35I22]
          Length = 349

 Score =  315 bits (807), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 165/356 (46%), Positives = 226/356 (63%), Gaps = 13/356 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M    FDF LPP  IA +P  PR+SA+L+ V  + +      D  + DLPA L + D +V
Sbjct: 1   MKTSNFDFSLPPELIAQKPARPRESAKLLQVFSDGN----FRDVYIKDLPALLKAGDLLV 56

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NNT+VI AQL+G  F      EK++   LH + S   W  +A+P+K +   D + FFS 
Sbjct: 57  VNNTRVIPAQLSGKIFS----TEKKVRVNLHKQKSNGVWLAFAKPAKKLLLNDKI-FFS- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
              S   A + DK   G+I L F++ G    + +   G++PLPPYI R   +   D  DY
Sbjct: 111 ---STFFALITDKQPFGQITLKFNLVGATFLKALKKFGSMPLPPYIKRSGKVHPSDKTDY 167

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QTT+A   G+VA+PTAGLHF+ NL++ L   GI+V  +TLHVGAGTF+P+K +  + H M
Sbjct: 168 QTTFASRDGAVASPTAGLHFSMNLINDLKRCGIRVAPITLHVGAGTFLPIKTDTINHHRM 227

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   I+A TA  +N  +  GG+I++VGTT LR LETA   +G I+P+ G T+IFI PG
Sbjct: 228 HSEWVEINARTANLINKTRKAGGKIIAVGTTVLRTLETAVDTEGNIHPFKGKTDIFIAPG 287

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           ++F+ VD+L++NFHLPKSTL +LVSAFCG+   K  Y++AI   YRF+SYGD SLL
Sbjct: 288 HQFKTVDLLITNFHLPKSTLFVLVSAFCGLNRMKNAYKYAIKKKYRFFSYGDASLL 343


>gi|296283991|ref|ZP_06861989.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Citromicrobium bathyomarinum JL354]
          Length = 349

 Score =  313 bits (802), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 180/360 (50%), Positives = 233/360 (64%), Gaps = 11/360 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  FDFDLPP RIALRPV PRD+A+++VV  + + P   +D  V DLP  L + D +V
Sbjct: 1   MKVDLFDFDLPPERIALRPVSPRDAAKMLVV--DGAAPF--ADRQVRDLPDLLRAGDVLV 56

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FN+T+VI AQL G R          I  TLH R+    W  + R +K +++GD + F   
Sbjct: 57  FNDTRVIPAQLEGERIRE-GASGAAIGATLHKRIDARRWQAFVRNAKRLREGDTIRF--P 113

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
           DG   +  T   +   G   L F+  G  +E  ++  G +PLPPYIA++R  D RD  DY
Sbjct: 114 DG---ISVTAEARAEDGSWTLAFA-GGEPVEELLARAGAMPLPPYIAQRRAADERDAQDY 169

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT +A   G+VAAPTA LHFT  L+ RL + GI    +TLHVGAGTF+PVK +DT  H M
Sbjct: 170 QTLFADKAGAVAAPTAALHFTPALVERLDAAGIVRETLTLHVGAGTFLPVKADDTAQHKM 229

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           H+E G I A  A  LN+ ++ G R+++VGTTSLRLLE+A  ++  I P++G T+IFITPG
Sbjct: 230 HAEWGEITAEAAARLNAARAEGRRVIAVGTTSLRLLESAADQNHTIQPFAGDTDIFITPG 289

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLFQKR 360
           Y FRAVD LM+NFHLPKSTL+MLVSA  G E   + Y +AI+H YRFYSYGD+SLL   R
Sbjct: 290 YEFRAVDGLMTNFHLPKSTLMMLVSALMGRERMMEAYAYAIAHEYRFYSYGDSSLLLPPR 349


>gi|114771126|ref|ZP_01448566.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [alpha
           proteobacterium HTCC2255]
 gi|114548408|gb|EAU51294.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [alpha
           proteobacterium HTCC2255]
          Length = 348

 Score =  313 bits (802), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 171/359 (47%), Positives = 233/359 (64%), Gaps = 14/359 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FDF+LP   IALRPV PR S++L+V   +     +I D  + +L  +L   D +V
Sbjct: 1   MKLSDFDFELPNELIALRPVHPRSSSKLLVSKDDK----IIDDQFL-NLLKYLKKGDRLV 55

Query: 61  FNNTKVITAQLNGVRFCHIN--RREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFF 118
            N+TKVI A+L+G R  H +  R    I   L    +   W   A+P+K +  G+I++F 
Sbjct: 56  LNDTKVIPAKLHGKRIRHSDNGRTTANIGINLLSTNNDGHWLALAKPAKRVNVGEIINF- 114

Query: 119 SQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYV 178
                + L A V+DK + G ++L F++S    ++++  +GT+PLPPYIA +R  D  D  
Sbjct: 115 ----DNELTAKVLDKSSNG-LVLQFNLSEEIFDQKLKEIGTMPLPPYIASQRLPDKFDDN 169

Query: 179 DYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDH 238
           DYQT +A+  GSVAAPTA LHF   LL +L   GIK   VTLHVGAGTF+PVKV++  DH
Sbjct: 170 DYQTVFAEKSGSVAAPTASLHFDDVLLKQLNDFGIKTSKVTLHVGAGTFLPVKVDNIADH 229

Query: 239 IMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFIT 298
            MHSE G ++   A  +   KS GGRI+ VGTT+LRL+ETA  + G IN W+G T+IFIT
Sbjct: 230 KMHSEWGEVNNIAASEIAKTKSEGGRIIPVGTTALRLIETA-AKSGKINSWTGDTDIFIT 288

Query: 299 PGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           PG++F+  D L++NFHLPKSTLLMLVSA  G E+ K +Y HAI++ YRF+SYGD SLL 
Sbjct: 289 PGFKFKIADGLITNFHLPKSTLLMLVSALIGTEKLKNVYLHAINNRYRFFSYGDASLLL 347


>gi|209543312|ref|YP_002275541.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Gluconacetobacter diazotrophicus PAl 5]
 gi|209530989|gb|ACI50926.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Gluconacetobacter diazotrophicus PAl 5]
          Length = 355

 Score =  313 bits (801), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 165/357 (46%), Positives = 218/357 (61%), Gaps = 14/357 (3%)

Query: 2   MVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIVF 61
           +  +FDFDLPP+ IA  P  PRDSARL+    ++       D +V DLP+ L   D +V 
Sbjct: 4   LASDFDFDLPPALIAEHPARPRDSARLL----DIPAAGPFHDRIVRDLPSLLRPGDLLVA 59

Query: 62  NNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQD 121
           N+T VI AQL+        R E  I  TL   +   +W   AR ++ ++ GD+L F    
Sbjct: 60  NDTAVIPAQLDA------RRGEARIGITLDRILPDGTWHALARNARRLRAGDVLTFPGTP 113

Query: 122 GQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDYQ 181
                 A VI + + G ++L F   G   +  +   G + LPPYIAR      +D VDY 
Sbjct: 114 NT----AAVISRDDEGGVVLRFDTEGAAFDAFLQAAGVLALPPYIARPFGPTEQDRVDYA 169

Query: 182 TTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIMH 241
           T ++  +G+VAAPTAGLHFT +LL+ L + G+    +TLHVGAGTF+PV+ +    H MH
Sbjct: 170 TIFSAHRGAVAAPTAGLHFTPDLLAALDAAGVGRCTLTLHVGAGTFLPVRGDSIAAHRMH 229

Query: 242 SEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPGY 301
           +E G I A TA A+N+ +  GGRIV+VGTTSLRLLE+A   DG I P+ G T IFI PGY
Sbjct: 230 AERGVITAETADAINAARRAGGRIVAVGTTSLRLLESAADPDGTIRPFDGDTAIFIRPGY 289

Query: 302 RFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLFQ 358
           RFRAVD+LM+NFHLP+STL MLV AF G +  +  Y HA++  YRFYSYGD  LL +
Sbjct: 290 RFRAVDVLMTNFHLPRSTLFMLVCAFAGYDRMRDAYAHAVADGYRFYSYGDACLLHR 346


>gi|163746642|ref|ZP_02153999.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Oceanibulbus indolifex HEL-45]
 gi|161379756|gb|EDQ04168.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Oceanibulbus indolifex HEL-45]
          Length = 348

 Score =  312 bits (800), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 164/359 (45%), Positives = 226/359 (62%), Gaps = 14/359 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FDFDLP   IA RP  PR SARL+V          + D  V+DL  +L   D +V
Sbjct: 1   MKLSDFDFDLPEELIATRPANPRSSARLLVAEGA-----QLHDRRVTDLTDWLRPGDRLV 55

Query: 61  FNNTKVITAQLNGVRF--CHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFF 118
            N+T+VI A+L+G+R         + +I  TL       +WS   +P + +K G+ +  F
Sbjct: 56  LNDTRVIPARLSGLRHRASAQGAVQAKIEVTLLEPRGDGTWSALIKPLRKLKIGEEV-IF 114

Query: 119 SQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYV 178
           S D ++ LEA        G+  L F+ +G + +  ++  G +PLPPYIA KR  DA+D  
Sbjct: 115 SDDLRATLEAV-----EDGQGHLRFNCAGDDFDAALNAAGAMPLPPYIAAKRAADAQDMT 169

Query: 179 DYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDH 238
           DYQT +A+  G+VAAPTA LHF   LL+ L + G+    VTLHVGAGTF+PVKV+D  +H
Sbjct: 170 DYQTVFARHAGAVAAPTASLHFDETLLAALAAKGVTFSHVTLHVGAGTFLPVKVDDISEH 229

Query: 239 IMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFIT 298
            MH+E G + A  A+ + + ++ GGR++ VGTT+LRL+ETA   DG I  W G T+IFIT
Sbjct: 230 KMHAEWGRVSAEAAEEITATRAAGGRVIPVGTTALRLIETA-ARDGQITAWEGDTDIFIT 288

Query: 299 PGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           PG+ F   D LM+NFHLPKSTL+MLVSA  G+++ K +Y HAI+  YRF+SYGD+SLL 
Sbjct: 289 PGFTFNVTDGLMTNFHLPKSTLMMLVSALMGVQQVKDIYAHAIAEKYRFFSYGDSSLLL 347


>gi|162146698|ref|YP_001601157.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Gluconacetobacter diazotrophicus PAl 5]
 gi|189038525|sp|A9HBI8|QUEA_GLUDA RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|161785273|emb|CAP54819.1| putative s-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Gluconacetobacter diazotrophicus PAl 5]
          Length = 355

 Score =  312 bits (800), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 165/357 (46%), Positives = 218/357 (61%), Gaps = 14/357 (3%)

Query: 2   MVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIVF 61
           +  +FDFDLPP+ IA  P  PRDSARL+    ++       D +V DLP+ L   D +V 
Sbjct: 4   LASDFDFDLPPALIAEHPARPRDSARLL----DIPAAGPFHDRIVRDLPSLLRPGDLLVA 59

Query: 62  NNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQD 121
           N+T VI AQL+        R E  I  TL   +   +W   AR ++ ++ GD+L F    
Sbjct: 60  NDTAVIPAQLDA------RRGEARIGITLDRILPDGTWHALARNARRLRAGDVLTFPGTP 113

Query: 122 GQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDYQ 181
                 A VI + + G ++L F   G   +  +   G + LPPYIAR      +D VDY 
Sbjct: 114 NT----AAVISRDDEGGVVLRFDTEGAAFDAFLQAAGVLALPPYIARPFGPTEQDRVDYA 169

Query: 182 TTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIMH 241
           T ++  +G+VAAPTAGLHFT +LL+ L + G+    +TLHVGAGTF+PV+ +    H MH
Sbjct: 170 TIFSAHRGAVAAPTAGLHFTPDLLAALDAAGVGRCTLTLHVGAGTFLPVRGDSIAAHRMH 229

Query: 242 SEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPGY 301
           +E G I A TA A+N+ +  GGRIV+VGTTSLRLLE+A   DG I P+ G T IFI PGY
Sbjct: 230 AERGVITAETADAINAARRAGGRIVAVGTTSLRLLESAADPDGTIRPFDGDTAIFIRPGY 289

Query: 302 RFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLFQ 358
           RFRAVD+LM+NFHLP+STL MLV AF G +  +  Y HA++  YRFYSYGD  LL +
Sbjct: 290 RFRAVDVLMTNFHLPRSTLFMLVCAFAGYDRMRDAYAHAVADGYRFYSYGDACLLHR 346


>gi|114570417|ref|YP_757097.1| queuosine biosynthesis protein [Maricaulis maris MCS10]
 gi|122315730|sp|Q0ANH8|QUEA_MARMM RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|114340879|gb|ABI66159.1| Queuosine biosynthesis protein [Maricaulis maris MCS10]
          Length = 353

 Score =  312 bits (799), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 173/361 (47%), Positives = 236/361 (65%), Gaps = 11/361 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V +FDF LP +RIALRP  PRD+AR++ V  N     V +D  V DLP  L   D +V
Sbjct: 1   MRVSDFDFHLPEARIALRPARPRDAARMLHVASNG----VFADRGVRDLPDLLQPGDLMV 56

Query: 61  FNNTKVITAQLNGVRFCHI--NRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFF 118
           FN+T+VI A L G+R           E+   LH R+  ++W  + RP+K ++ GD + F 
Sbjct: 57  FNDTRVIPAALKGIRPARAVGGGGPVEVEVNLHKRIDASAWRAFVRPAKRLRMGDEIAF- 115

Query: 119 SQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYV 178
              G++ L+A V  K   G++ LVF+ +G  L+  I++ G +PLPPYIARKR +D +D  
Sbjct: 116 ---GET-LKAEVTGKSEGGDVRLVFNAAGAALDAAIAVAGEMPLPPYIARKRGVDEKDEA 171

Query: 179 DYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDH 238
           DYQT +A  +GSVAAPTAGLHFT  L++ L + G++   VTLHVGAGTF+PVK +DTDDH
Sbjct: 172 DYQTLFATHEGSVAAPTAGLHFTPELMAALEARGVEQTRVTLHVGAGTFLPVKSDDTDDH 231

Query: 239 IMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFIT 298
            MHSE   + A  A A+N+ K+ G R++ VGTT+LR +E+  +  GI+   S  T+IF+T
Sbjct: 232 QMHSEWCTVSAEAADAINAAKAEGRRVIPVGTTALRTIESLASGPGIVRAGSRDTDIFLT 291

Query: 299 PGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLFQ 358
           PG  F   D+LM+NFHLPKSTL MLVSA  G++  ++ Y HAI+  YRFYSYGD  LL +
Sbjct: 292 PGSDFAITDMLMTNFHLPKSTLFMLVSALSGLDVMQRAYAHAIAAEYRFYSYGDACLLER 351

Query: 359 K 359
           +
Sbjct: 352 R 352


>gi|254460455|ref|ZP_05073871.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Rhodobacterales bacterium HTCC2083]
 gi|206677044|gb|EDZ41531.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Rhodobacteraceae bacterium HTCC2083]
          Length = 352

 Score =  312 bits (799), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 165/363 (45%), Positives = 224/363 (61%), Gaps = 14/363 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FDF LP   IA RP  PR SARL++          I D  VSDL       D +V
Sbjct: 1   MKLSDFDFYLPEDLIATRPAKPRSSARLLLAKDG-----AIKDAYVSDLVKIFQPGDLLV 55

Query: 61  FNNTKVITAQLNGVRFCHI--NRREKEISCTLHMRVS-PNSWSVYARPSKVIKKGDILHF 117
            NNTKVI A+L GVR         E +I  TL   ++ P +W    +P + +K+G+++ F
Sbjct: 56  LNNTKVIPARLFGVRKRESVHGSGEAKIEVTLLEPIATPGTWQALIKPLRKVKEGEVMVF 115

Query: 118 FSQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDY 177
                   L AT+ DK + G+  L F++ G + +  ++  G +PLPPYIA +RP DA+D 
Sbjct: 116 -----SETLSATLTDK-DDGQGTLQFNLLGDDFDTALAEAGAMPLPPYIAARRPADAQDK 169

Query: 178 VDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDD 237
            DYQT +A+  G+VAAPTA LHF + LL  L    ++   VTLHVGAGTF+PVKVED   
Sbjct: 170 DDYQTVFAQHSGAVAAPTASLHFDAALLGELKERCVEFAEVTLHVGAGTFLPVKVEDVTT 229

Query: 238 HIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFI 297
           H MH+E G +D   A  + + K  G R++ VGTT+LRL+E+A  + G I PW G T+IFI
Sbjct: 230 HKMHAEWGQVDETAADQITAAKREGRRVIPVGTTALRLIESAAAQTGEIAPWEGETDIFI 289

Query: 298 TPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
            PG++F   D LM+NFHLPKSTL+MLVSA  G E   ++Y HAI++ YRF+SYGD+SLL 
Sbjct: 290 YPGFKFNVADALMTNFHLPKSTLMMLVSALMGKERVDQIYTHAIANEYRFFSYGDSSLLV 349

Query: 358 QKR 360
            ++
Sbjct: 350 PEK 352


>gi|258541319|ref|YP_003186752.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256632397|dbj|BAH98372.1| tRNA ribosyltransferase/isomerase [Acetobacter pasteurianus IFO
           3283-01]
 gi|256635454|dbj|BAI01423.1| tRNA ribosyltransferase/isomerase [Acetobacter pasteurianus IFO
           3283-03]
 gi|256638509|dbj|BAI04471.1| tRNA ribosyltransferase/isomerase [Acetobacter pasteurianus IFO
           3283-07]
 gi|256641563|dbj|BAI07518.1| tRNA ribosyltransferase/isomerase [Acetobacter pasteurianus IFO
           3283-22]
 gi|256644618|dbj|BAI10566.1| tRNA ribosyltransferase/isomerase [Acetobacter pasteurianus IFO
           3283-26]
 gi|256647673|dbj|BAI13614.1| tRNA ribosyltransferase/isomerase [Acetobacter pasteurianus IFO
           3283-32]
 gi|256650726|dbj|BAI16660.1| tRNA ribosyltransferase/isomerase [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256653717|dbj|BAI19644.1| tRNA ribosyltransferase/isomerase [Acetobacter pasteurianus IFO
           3283-12]
          Length = 360

 Score =  311 bits (798), Expect = 8e-83,   Method: Compositional matrix adjust.
 Identities = 162/354 (45%), Positives = 224/354 (63%), Gaps = 14/354 (3%)

Query: 3   VKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIVFN 62
            ++FDF LP S IA  P  PR++ARL+    + + P + +D  + DLP+ L   D +V N
Sbjct: 6   TEDFDFHLPESLIAQEPARPREAARLL----DATQPDMFADRHIRDLPSLLKRGDLLVAN 61

Query: 63  NTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQDG 122
           NT VI AQL+G+R       E +I  TL       SW V  R ++ +K GD + F     
Sbjct: 62  NTAVIRAQLHGLR------GEAKIGITLDQIQPDGSWHVLVRNARRLKVGDTIAFPGVQD 115

Query: 123 QSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDYQT 182
            +R++A        G  +L FS  G   +  +   G + LPPYI R     A+D  DY T
Sbjct: 116 TARVQAL----EPGGGAVLQFSAEGDAFDAFLQKAGALALPPYIHRPEGPTAQDTSDYAT 171

Query: 183 TYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIMHS 242
            + + +G+VAAPTAGLHFT  LL  + + G +   +TLHVGAGTF+PV+  +  +H MHS
Sbjct: 172 IFERNKGAVAAPTAGLHFTPALLKAIDATGAQRCTLTLHVGAGTFLPVREAEISEHKMHS 231

Query: 243 EIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPGYR 302
           E G I   TA+ +N+ +  GGRI+++GTTSLRLLETAT E+GI++P+ G T+IFI PGY+
Sbjct: 232 ERGIITPETAERINATRKAGGRIIAIGTTSLRLLETATDENGIVHPFDGTTSIFIRPGYQ 291

Query: 303 FRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           FRAVD+L++NFHLP+STL MLVSAF G+E  +++Y HA++  YRFYSYGD  LL
Sbjct: 292 FRAVDMLLTNFHLPRSTLFMLVSAFAGVERARQIYAHAVASGYRFYSYGDACLL 345


>gi|163742741|ref|ZP_02150126.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Phaeobacter
           gallaeciensis 2.10]
 gi|161383996|gb|EDQ08380.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Phaeobacter
           gallaeciensis 2.10]
          Length = 356

 Score =  311 bits (797), Expect = 9e-83,   Method: Compositional matrix adjust.
 Identities = 165/358 (46%), Positives = 228/358 (63%), Gaps = 14/358 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FDFDLP  RIA RP  PR SARL+V   +      I D  V++L  +L S D +V
Sbjct: 1   MKLSDFDFDLPDDRIATRPAVPRSSARLLVAEGDR-----IRDARVANLGQWLRSGDRLV 55

Query: 61  FNNTKVITAQLNGVRFCHINR--REKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFF 118
            N+TKVI A+L+G+R     +     ++  TL    +  SW+   +P K +K G+ + F 
Sbjct: 56  LNDTKVIPARLSGLRHRDTAQGPMAAKVEVTLLDPGADGSWAALLKPLKKVKPGEEIVF- 114

Query: 119 SQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYV 178
                  L AT +++   G+  L F++SG + +  ++  G +PLPPYIA KRP D +D  
Sbjct: 115 ----SDALSAT-LERVEDGQGHLKFNLSGTDFDAALAEAGAMPLPPYIAAKRPADEQDKT 169

Query: 179 DYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDH 238
           DYQT +A+  G+VAAPTA LHF   LL+ L + G+++ +VTLHVGAGTF+PVKVED   H
Sbjct: 170 DYQTVWARNSGAVAAPTASLHFDDALLAELQAKGVEISYVTLHVGAGTFLPVKVEDVTTH 229

Query: 239 IMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFIT 298
            MH+E G + A  A  + + K+ GGR++ VGTT+LRL+E+A  + G I PW G T+IFI 
Sbjct: 230 RMHAEWGRVSAEAATEIAATKAAGGRVIPVGTTALRLIESA-GQSGAIQPWEGDTDIFIY 288

Query: 299 PGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           PG+ F   D LM+NFHLPKSTLLMLVSA  G +  + +Y HA++  YRF+SYGD SLL
Sbjct: 289 PGFTFHVADALMTNFHLPKSTLLMLVSALMGQDRIRAIYDHALAEEYRFFSYGDASLL 346


>gi|296114522|ref|ZP_06833175.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Gluconacetobacter hansenii ATCC 23769]
 gi|295978878|gb|EFG85603.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Gluconacetobacter hansenii ATCC 23769]
          Length = 352

 Score =  310 bits (794), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 165/358 (46%), Positives = 223/358 (62%), Gaps = 14/358 (3%)

Query: 2   MVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIVF 61
           +V +FDFDLP + IA  P  PRDSAR++ V P  +      D  V DLP  L + D +V 
Sbjct: 4   LVSDFDFDLPVALIADHPARPRDSARMLEVPPQGA----FCDRHVRDLPGCLRAGDILVA 59

Query: 62  NNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQD 121
           N+T VI AQL  +R          I  TL   +   +W   AR S+ +K GDIL F    
Sbjct: 60  NDTAVIPAQLAAMRGA------ARIGITLDRILPDGTWHALARNSRRLKPGDILTF---- 109

Query: 122 GQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDYQ 181
             S + A V+   + G +++ F + G   ++ +   G + LPPYIAR       D  DY 
Sbjct: 110 APSAVTAEVVVCEDAGGVVMRFDVEGEAFDQFLHDTGHLALPPYIARPDGPTEEDRKDYS 169

Query: 182 TTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIMH 241
           T +A+ +G+VAAPTAGLHFT  LLS L + G+    +TLHVGAGTF+P++ E   +H MH
Sbjct: 170 TIFAQHRGAVAAPTAGLHFTPALLSGLEAAGVLRQTLTLHVGAGTFLPMRSEQISEHRMH 229

Query: 242 SEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPGY 301
           +E G I A  A  +N+ ++ GGR+++VGTTSLRLLE+AT EDG+++P+ G T IFI PGY
Sbjct: 230 AERGTITAHAAHRINAARAAGGRVIAVGTTSLRLLESATDEDGVVHPFHGETAIFIRPGY 289

Query: 302 RFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLFQK 359
           RFRAVD+L++NFHLP+STL MLVSAF G    +  Y+HA++  YRFYSYGD  LL + 
Sbjct: 290 RFRAVDMLLTNFHLPRSTLFMLVSAFAGQARMRAAYEHAMAAGYRFYSYGDACLLHRN 347


>gi|329114921|ref|ZP_08243677.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Acetobacter
           pomorum DM001]
 gi|326695818|gb|EGE47503.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Acetobacter
           pomorum DM001]
          Length = 358

 Score =  310 bits (794), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 163/354 (46%), Positives = 224/354 (63%), Gaps = 14/354 (3%)

Query: 3   VKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIVFN 62
            ++FDF LP S IA  P  PR++ARL+    + + P + +D  + DLP+ L   D +V N
Sbjct: 6   TEDFDFHLPESLIAQEPARPREAARLL----DATQPGIFADRHIRDLPSLLKRGDLLVAN 61

Query: 63  NTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQDG 122
           NT VI AQL+G+R       E +I  TL       SW V  R ++ +K GDI+ F     
Sbjct: 62  NTAVIRAQLHGLR------GEAKIGITLDQIQPDGSWHVLVRNARRLKVGDIIAFPGVQD 115

Query: 123 QSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDYQT 182
            +R    V+     G  +L FS  G   +  +   G + LPPYI R     A+D  DY T
Sbjct: 116 IAR----VLALEPGGGAVLRFSAEGDAFDVFLQKAGALALPPYIHRPEGPTAQDTSDYAT 171

Query: 183 TYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIMHS 242
            + + +G+VAAPTAGLHFT  LL  + + G +   +TLHVGAGTF+PV+  +  +H MHS
Sbjct: 172 IFERNKGAVAAPTAGLHFTPALLKAVDATGAQRCTLTLHVGAGTFLPVREAEISEHKMHS 231

Query: 243 EIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPGYR 302
           E G I   TA+ +N+ +  GGRI+++GTTSLRLLETAT E+GI++P+ G T+IFI PGY+
Sbjct: 232 ERGIITPETAERINTTRKAGGRIIAIGTTSLRLLETATDENGIVHPFDGTTSIFIRPGYQ 291

Query: 303 FRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           FRAVD+L++NFHLP+STL MLVSAF G+E  +++Y HA++  YRFYSYGD  LL
Sbjct: 292 FRAVDMLLTNFHLPRSTLFMLVSAFAGVERARQIYAHAVASGYRFYSYGDACLL 345


>gi|83954337|ref|ZP_00963057.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Sulfitobacter sp. NAS-14.1]
 gi|83841374|gb|EAP80544.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Sulfitobacter sp. NAS-14.1]
          Length = 354

 Score =  309 bits (792), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 167/363 (46%), Positives = 226/363 (62%), Gaps = 18/363 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FDF+LP   IA RP  PR SA+++V   +      ++D  V+++  +L   D +V
Sbjct: 1   MKLSDFDFELPERLIATRPAVPRTSAKMLVAQGDH-----MTDTTVANMSDWLRPGDRLV 55

Query: 61  FNNTKVITAQLNGVRFCHINRRE----KEISCTLHMRVSPNSWSVYARPSKVIKKGDILH 116
            N+T+VI A+L+G+R  H N  +      I  TL        W+   +P K +K  + + 
Sbjct: 56  LNDTRVIPARLSGLR--HRNSVQGPVQARIEVTLLEPRGDADWTALIKPLKKLKIDETV- 112

Query: 117 FFSQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARD 176
            FS D  +RL          G+  L F+ SG + +  ++  G +PLPPYIA KRP DA+D
Sbjct: 113 VFSADLSARLVGV-----EDGQGRLRFNCSGDDFDAALNDAGAMPLPPYIAGKRPADAQD 167

Query: 177 YVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTD 236
             DYQT +AK  G+VAAPTA LHF   LL +L  +G++   VTLHVGAGTF+PVKV+D  
Sbjct: 168 MTDYQTVFAKNAGAVAAPTASLHFDQLLLDQLAEMGVRFSHVTLHVGAGTFLPVKVDDIA 227

Query: 237 DHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIF 296
           DH MHSE G + A  A  +++ K+ GGR++ VGTT+LRL+ETA    G I PW G T+IF
Sbjct: 228 DHKMHSEWGQVSAQAAAEISATKAAGGRVIPVGTTALRLVETA-ARSGNIQPWEGDTDIF 286

Query: 297 ITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           ITPG+ F   D LM+NFHLPKSTL+MLVSA  G +  +K+Y HAI   YRF+SYGD SLL
Sbjct: 287 ITPGFEFNVADALMTNFHLPKSTLMMLVSALMGQKTIQKIYNHAIESNYRFFSYGDASLL 346

Query: 357 FQK 359
           F K
Sbjct: 347 FPK 349


>gi|83943202|ref|ZP_00955662.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Sulfitobacter sp. EE-36]
 gi|83846210|gb|EAP84087.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Sulfitobacter sp. EE-36]
          Length = 354

 Score =  309 bits (792), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 166/361 (45%), Positives = 225/361 (62%), Gaps = 14/361 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FDF+LP   IA RP  PR SA+++V   +      ++D  V+++  +L   D +V
Sbjct: 1   MKLSDFDFELPERLIATRPAVPRTSAKMLVAQGDH-----MTDTTVANMSDWLRPGDRLV 55

Query: 61  FNNTKVITAQLNGVRFCHINRR--EKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFF 118
            N+T+VI A+L+G+R     +   +  I  TL        W+   +P K +K  + +  F
Sbjct: 56  LNDTRVIPARLSGLRHRESAQGPVQARIEVTLLEPRGDADWTALIKPLKKLKIDETV-VF 114

Query: 119 SQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYV 178
           S D  +RL          G+  L F+ SG + +  ++  G +PLPPYIA KRP DA+D  
Sbjct: 115 SADLSARLVGV-----EDGQGRLRFNCSGDDFDAALNDAGAMPLPPYIAGKRPADAQDMT 169

Query: 179 DYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDH 238
           DYQT +AK  G+VAAPTA LHF   LL +L +IG+    VTLHVGAGTF+PVKV+D  DH
Sbjct: 170 DYQTVFAKNAGAVAAPTASLHFDQPLLDQLAAIGVCFSHVTLHVGAGTFLPVKVDDIADH 229

Query: 239 IMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFIT 298
            MHSE G + A  A  +++ K+ GGR++ VGTT+LRL+ETA    G I PW G T+IFIT
Sbjct: 230 KMHSEWGQVSAQAAAEISATKAAGGRVIPVGTTALRLVETA-ARSGNIQPWEGDTDIFIT 288

Query: 299 PGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLFQ 358
           PG+ F   D LM+NFHLPKSTL+MLVSA  G +  +K+Y HAI   YRF+SYGD SLLF 
Sbjct: 289 PGFEFNVADALMTNFHLPKSTLMMLVSALMGQKTIQKIYNHAIESNYRFFSYGDASLLFP 348

Query: 359 K 359
           K
Sbjct: 349 K 349


>gi|259418623|ref|ZP_05742540.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Silicibacter sp. TrichCH4B]
 gi|259344845|gb|EEW56699.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Silicibacter sp. TrichCH4B]
          Length = 369

 Score =  308 bits (790), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 165/360 (45%), Positives = 228/360 (63%), Gaps = 17/360 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FDFDLP   IA RP  PR SARL+V   +      I+D  V+DL  +LN+ D +V
Sbjct: 21  MKLSDFDFDLPEDLIATRPAVPRSSARLLVAEQDR-----ITDARVTDLLQWLNAGDRLV 75

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRV----SPNSWSVYARPSKVIKKGDILH 116
            N+T+VI A+L+G R  H    +  +S  + + +    +   WS   +P K IK G+ + 
Sbjct: 76  LNDTRVIPARLSGQR--HRTSAQGPVSARIEVTLLEPQADGCWSGLLKPLKKIKIGETVR 133

Query: 117 FFSQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARD 176
           F   DG S     V++    G+  L F+++G + +  ++  G +PLPPYIA KRP D +D
Sbjct: 134 F--SDGLSAELVDVVE----GQGRLRFNLAGDDFDAALAEAGAMPLPPYIAAKRPADEQD 187

Query: 177 YVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTD 236
             DYQT +A+  G+VAAPTA LHF   LL+ L + G++  +VTLHVGAGTF+PVKVED  
Sbjct: 188 KTDYQTVWARSSGAVAAPTASLHFDEPLLAALAAKGVEFTYVTLHVGAGTFLPVKVEDVT 247

Query: 237 DHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIF 296
            H MH+E G + A  A  + + K+ G R++ VGTT+LRL+E+A  + G I PW G T+IF
Sbjct: 248 SHKMHAEWGQVTAKAAAEIAATKAAGKRVIPVGTTALRLIESAARDSGAIAPWEGETDIF 307

Query: 297 ITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           I PG+ FR  D LM+NFHLPKSTL+MLVSA  G E  + +Y HA++  YRF+SYGD SLL
Sbjct: 308 IYPGFTFRVADALMTNFHLPKSTLMMLVSALMGQERMRSVYAHAVTERYRFFSYGDASLL 367


>gi|159043729|ref|YP_001532523.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Dinoroseobacter shibae DFL 12]
 gi|189038520|sp|A8LI68|QUEA_DINSH RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|157911489|gb|ABV92922.1| queuosine biosynthesis protein [Dinoroseobacter shibae DFL 12]
          Length = 353

 Score =  308 bits (789), Expect = 7e-82,   Method: Compositional matrix adjust.
 Identities = 165/363 (45%), Positives = 225/363 (61%), Gaps = 15/363 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FDFDLP + IA RP  PR SARL+V       P    D  V+DL   L   D +V
Sbjct: 1   MHLSDFDFDLPETLIATRPARPRSSARLLVAEAR--GPF--RDRRVTDLVDELQPGDRLV 56

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRV---SPNSWSVYARPSKVIKKGDILHF 117
            NNTKVI A+L G R  H +  +  +S  + + +   +   W+  A+P + + +G+ + F
Sbjct: 57  LNNTKVIPARLFGTR--HRDSAQGPVSAKVEITLLEPASEGWTALAKPLRKLAEGEEIVF 114

Query: 118 FSQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDY 177
                   L ATV ++     + LVF+ +G + +  ++  G +PLPPYIA KR  DA+D 
Sbjct: 115 -----SDALRATVAER-GADRVRLVFNCTGDDFDAALAQAGAMPLPPYIAAKRAADAQDR 168

Query: 178 VDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDD 237
            DYQT +A  +G+VAAPTA LHF   LL+ L + G++  FVTLHVGAGTF+PVKV+D   
Sbjct: 169 DDYQTVFAARKGAVAAPTASLHFDEALLAALRARGVEFSFVTLHVGAGTFLPVKVDDVTT 228

Query: 238 HIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFI 297
           H MHSE G I    A  + + ++ G R++ VGTT+LRL+ETA  + G   PW G T+IFI
Sbjct: 229 HKMHSEWGEISDQAAAEILATRADGRRVIPVGTTALRLIETAAAQPGGFGPWEGDTDIFI 288

Query: 298 TPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
            PG+ FR  D LM+NFHLPKSTL+MLVSA  G E  +++Y HAI+  YRF+SYGD+SLL 
Sbjct: 289 YPGFEFRITDGLMTNFHLPKSTLMMLVSALMGAERIREIYAHAIAQEYRFFSYGDSSLLL 348

Query: 358 QKR 360
             R
Sbjct: 349 PDR 351


>gi|254450756|ref|ZP_05064193.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Octadecabacter antarcticus 238]
 gi|198265162|gb|EDY89432.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Octadecabacter antarcticus 238]
          Length = 350

 Score =  308 bits (788), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 165/361 (45%), Positives = 232/361 (64%), Gaps = 14/361 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FDFDLP + IA+RPV PR SA+L+V     +      D  V+DL + L + D +V
Sbjct: 1   MKLSDFDFDLPDTLIAVRPVRPRSSAKLLVADGPET-----HDLQVTDLRSVLQAGDHLV 55

Query: 61  FNNTKVITAQLNG--VRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFF 118
            N+TKVI A+L G  +R         +I  TL    +  +W+   +P + ++ G+ +  F
Sbjct: 56  LNDTKVIPARLFGERIRKSPDGAGLAKIEVTLLEPQADGTWAALIKPLRKVRDGERI-VF 114

Query: 119 SQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYV 178
           SQD    L A ++ +++ G   L F++   + +  ++ VG +PLPPYIA KRP D  D  
Sbjct: 115 SQD----LSAMLVHRYD-GMGYLEFNVKDDDFDTALNAVGAMPLPPYIAAKRPADDLDKD 169

Query: 179 DYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDH 238
           DYQT +A+  G+VAAPTA LHF   LL  LI++G+K+ +VTLHVGAGTF+PVKV+D  DH
Sbjct: 170 DYQTVWARASGAVAAPTASLHFEQWLLDDLIAMGVKISYVTLHVGAGTFVPVKVDDVADH 229

Query: 239 IMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFIT 298
           +MHSE G + A  A  + + K+ GGR++ VGTT+ RL+ETA    G +  W G T+IFIT
Sbjct: 230 VMHSEWGQVSALAASDIMATKAAGGRVIPVGTTACRLIETAGAS-GTLVEWEGETDIFIT 288

Query: 299 PGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLFQ 358
           PG+ F+  D LM+NFHLPKSTL+MLVSA  G +  K +Y HAI++ YRF+SYGD S+L  
Sbjct: 289 PGFEFQITDGLMTNFHLPKSTLMMLVSALMGTQRIKDIYAHAIANEYRFFSYGDASILLP 348

Query: 359 K 359
           K
Sbjct: 349 K 349


>gi|84684975|ref|ZP_01012875.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Maritimibacter alkaliphilus HTCC2654]
 gi|84667310|gb|EAQ13780.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Rhodobacterales bacterium HTCC2654]
          Length = 355

 Score =  307 bits (787), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 162/355 (45%), Positives = 225/355 (63%), Gaps = 12/355 (3%)

Query: 3   VKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIVFN 62
           + ++DFDLP   IA RP  PR SARL+V          I+D +V+DL  +L   D +V N
Sbjct: 10  LSDYDFDLPEDLIATRPARPRSSARLLVAERAR-----ITDGVVTDLVDWLRPGDRLVLN 64

Query: 63  NTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQDG 122
           +T+VI A+L G R     +   E++  L     P +WS   +P + +K G+ + F +   
Sbjct: 65  DTRVIPARLEGTRTRGEAQARIEVTL-LAPDAQPGAWSALVKPLRKVKDGETIDFAAG-- 121

Query: 123 QSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDYQT 182
              L ATV+ + + G+ +L F+++G   +  ++  G +PLPPYI  KR  DA+D  DYQT
Sbjct: 122 ---LSATVLSR-SEGQAVLTFNLTGAAFDAALAEAGRMPLPPYIEAKRRADAQDREDYQT 177

Query: 183 TYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIMHS 242
            +A+  G+VAAPTA LHF   LL+ L + G+    VTLHVGAGTF+PVKV+D  DH MH+
Sbjct: 178 VWARQTGAVAAPTASLHFDDALLAALDARGVARTHVTLHVGAGTFLPVKVDDVSDHKMHA 237

Query: 243 EIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPGYR 302
           E G +    A  +N+ ++ GGRI+ VGTT+LRL+E+A    G I PW G T+IFI PGY 
Sbjct: 238 EWGEVTEAAAAEINATRAAGGRIIPVGTTALRLIESAAAAPGRIEPWRGPTDIFIRPGYA 297

Query: 303 FRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           F+  D LM+NFHLPKSTL+MLVSA  G+E  +++Y HAI + YRF+SYGD SLL 
Sbjct: 298 FKITDGLMTNFHLPKSTLMMLVSALMGMERMREVYAHAIENRYRFFSYGDASLLL 352


>gi|126739327|ref|ZP_01755020.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Roseobacter
           sp. SK209-2-6]
 gi|126719427|gb|EBA16136.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Roseobacter
           sp. SK209-2-6]
          Length = 356

 Score =  307 bits (786), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 169/359 (47%), Positives = 222/359 (61%), Gaps = 14/359 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FDFDLP + IA RP  PR SAR++V     + P  I D  V+DL  +L   D +V
Sbjct: 1   MKLSDFDFDLPETLIATRPASPRSSARMLV-----ATPQEIHDQTVTDLIDWLKPGDRLV 55

Query: 61  FNNTKVITAQLNGVRF--CHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFF 118
            N+TKVI A+L+G+R       +    I  TL    S  SW+   +P K IK G+ + F 
Sbjct: 56  LNDTKVIPARLSGLRHRESAQGKTAARIEVTLLEPRSDGSWAGLLKPLKKIKLGERIVF- 114

Query: 119 SQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYV 178
             D  S     V D    G+ LL F++ G + +  ++  G +PLPPYIA KR  DA+D  
Sbjct: 115 -SDALSAELVGVED----GQGLLSFNLQGEDFDAALAQAGAMPLPPYIAAKRAADAQDKT 169

Query: 179 DYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDH 238
           DYQT +AK  G+VAAPTA LHF + LL  L   G+K   VTLHVGAGTF+PVKV+D   H
Sbjct: 170 DYQTVWAKNSGAVAAPTASLHFDTALLEALQEKGVKFTHVTLHVGAGTFLPVKVDDVTTH 229

Query: 239 IMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFIT 298
            MH+E G +    A  +   K+ GGR++ VGTT+LRL+E+A   DG + PW G T+IFI 
Sbjct: 230 KMHAEWGKVSEQAASEIAETKAAGGRVIPVGTTALRLIESA-ARDGRVEPWEGETDIFIY 288

Query: 299 PGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           PG+ F+A D LM+NFHLPKSTLLML+SA  G E  +++Y HA+   YRF+SYGD SLL 
Sbjct: 289 PGFSFQATDALMTNFHLPKSTLLMLISALMGQERVREIYAHAVEGEYRFFSYGDASLLL 347


>gi|99080934|ref|YP_613088.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Ruegeria
           sp. TM1040]
 gi|122398114|sp|Q1GHP0|QUEA_SILST RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|99037214|gb|ABF63826.1| Queuosine biosynthesis protein [Ruegeria sp. TM1040]
          Length = 349

 Score =  306 bits (785), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 166/360 (46%), Positives = 222/360 (61%), Gaps = 17/360 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FDFDLP   IA RP  PR SARL+V   +      ISD  V+DL  +L   D +V
Sbjct: 1   MKLGDFDFDLPEELIATRPAVPRSSARLLVAEQDR-----ISDGRVTDLLDWLAPGDRLV 55

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRV----SPNSWSVYARPSKVIKKGDILH 116
            N+T+VI A+L+G R  H N  +  +S  + + +    +  SW+   +P K IK G+ L 
Sbjct: 56  LNDTRVIPARLSGQR--HRNSAQGPVSARIEVTLLEPQADGSWAGLLKPLKKIKIGETLR 113

Query: 117 FFSQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARD 176
           F   D  S     V+D    G+  L F+++G + +  ++  G +PLPPYIA KRP D +D
Sbjct: 114 F--SDALSAELVDVVD----GQGRLRFNLAGDDFDAALAEAGAMPLPPYIAAKRPADEQD 167

Query: 177 YVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTD 236
             DYQT +A+  G+VAAPTA LHF   LL  L   G+   +VTLHVGAGTF+PVKVED  
Sbjct: 168 KTDYQTVWARNSGAVAAPTASLHFDEPLLKALSEKGVTFTYVTLHVGAGTFLPVKVEDVT 227

Query: 237 DHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIF 296
            H MH+E G +    A  + + K+ G R++ VGTT+LRL+E+A  E G I PW G T+IF
Sbjct: 228 THKMHAEWGQVTPEAAAEIAATKAAGNRVIPVGTTALRLIESAARESGAITPWEGETDIF 287

Query: 297 ITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           I PG+ FR  D LM+NFHLPKSTL+MLVSA  G +  + +Y HA+   YRF+SYGD SLL
Sbjct: 288 IYPGFEFRVADALMTNFHLPKSTLMMLVSALMGQDRIRAIYAHAVKERYRFFSYGDASLL 347


>gi|255261251|ref|ZP_05340593.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Thalassiobium sp. R2A62]
 gi|255103586|gb|EET46260.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Thalassiobium sp. R2A62]
          Length = 348

 Score =  306 bits (784), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 168/361 (46%), Positives = 236/361 (65%), Gaps = 21/361 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FDFDLP  RIA+RP  PR SARL++   +      I D +V+DL   L   D +V
Sbjct: 1   MKLSDFDFDLPDDRIAVRPTQPRSSARLLLARGD-----DILDRVVTDLIDILQPGDRLV 55

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRV----SPNSWSVYARPSKVIKKGDILH 116
            N+T+VI A+L+G R  H N  +  +S  + + +    +  +W+   +P K + +G+ + 
Sbjct: 56  LNDTRVIPARLSGQR--HRNSAQGPVSAAIDVTLLTPQADGAWTALIKPLKKVTEGEDI- 112

Query: 117 FFSQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARD 176
            FS D    L AT+I K + G+  L F+++G + +  ++  G +PLPPYIA KR  DA+D
Sbjct: 113 VFSDD----LSATLIGKED-GQGRLKFNLTGDDFDAALAAAGAMPLPPYIAAKRAADAQD 167

Query: 177 YVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTD 236
           + DYQT +A+ QG+VAAPTA LHF   LL  L + GI+  +VTLHVGAGTF+PVKV++  
Sbjct: 168 HTDYQTVWARHQGAVAAPTASLHFDQPLLEALNAKGIQFTYVTLHVGAGTFLPVKVDNIA 227

Query: 237 DHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIF 296
           DH MHSE G I    A A+NS     GR++ VGTT+LRL+E+A  ++G +  W G T+IF
Sbjct: 228 DHKMHSEWGQITHAAADAINSTT---GRVIPVGTTALRLIESA-AQNGRLAAWEGPTDIF 283

Query: 297 ITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           ITPG++F+  D LM+NFHLPKSTL+MLVSA  G +  K +Y HA+ H YRF+SYGD+SLL
Sbjct: 284 ITPGFKFQIADGLMTNFHLPKSTLMMLVSALMGTQNIKDIYAHALRHEYRFFSYGDSSLL 343

Query: 357 F 357
            
Sbjct: 344 L 344


>gi|119383366|ref|YP_914422.1| queuosine biosynthesis protein [Paracoccus denitrificans PD1222]
 gi|119373133|gb|ABL68726.1| Queuosine biosynthesis protein [Paracoccus denitrificans PD1222]
          Length = 359

 Score =  306 bits (784), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 169/361 (46%), Positives = 223/361 (61%), Gaps = 14/361 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FDF LP + IA RP  PR SARL++   +      I D  V DL   L S D +V
Sbjct: 9   MKLDDFDFHLPETLIATRPARPRSSARLLLAQGD-----SIRDLHVRDLADLLGSGDLLV 63

Query: 61  FNNTKVITAQLNGVRFCHINRREK--EISCTLHMRVSPNSWSVYARPSKVIKKGDILHFF 118
            N+TKVI A+LNG R     + E   ++  TL   V+ + W   A+P + +K G+++ F 
Sbjct: 64  LNDTKVIPARLNGTRARQTPQGEAVAKVEVTLLEPVA-HGWKALAKPLRKLKPGEVIRFG 122

Query: 119 SQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYV 178
           S      L A V +    GE+ L F  +G   +  ++ VG +PLPPYIA  R  D  D  
Sbjct: 123 SA-----LSAEVAEIAG-GELTLRFDATGEAFDAALAQVGAMPLPPYIAALRAPDEADRQ 176

Query: 179 DYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDH 238
           DYQT +A+  G+VAAPTA LHF   LL  L + G++   VTLHVGAGTF+PVKVED   H
Sbjct: 177 DYQTVWARNSGAVAAPTASLHFDGELLDGLAARGVRFTHVTLHVGAGTFLPVKVEDVTTH 236

Query: 239 IMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFIT 298
            MH E G +    A A+N+ ++ GGR++ VGTT+LRL+E+A  EDG ++P+ G T IFI 
Sbjct: 237 KMHGEWGEVTPEAAAAINATRAAGGRVIPVGTTALRLIESAAAEDGTVHPFQGVTEIFIY 296

Query: 299 PGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLFQ 358
           PGYRFR  D LM+NFHLPKSTLLMLVSA  G +  + +Y+HA+   YRF+SYGD SLL  
Sbjct: 297 PGYRFRVTDALMTNFHLPKSTLLMLVSALMGQDRIRGIYRHAVESGYRFFSYGDASLLIP 356

Query: 359 K 359
           K
Sbjct: 357 K 357


>gi|260575224|ref|ZP_05843224.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase [Rhodobacter
           sp. SW2]
 gi|259022484|gb|EEW25780.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase [Rhodobacter
           sp. SW2]
          Length = 345

 Score =  306 bits (783), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 165/356 (46%), Positives = 218/356 (61%), Gaps = 13/356 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FDFDLP + IA RP  PR +ARL++   +      ISD  VSDL       D +V
Sbjct: 1   MKLSDFDFDLPEALIATRPARPRTAARLLLAEGD-----AISDRQVSDLVDIFRPGDRLV 55

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NNT+VI A+L G R          +  TL    +   W   A+P + +  G+++ F   
Sbjct: 56  LNNTRVIPARLTGTRAR--GNAVARVEVTLLEPAADGGWRALAKPLRKLALGEVVRF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
                  ATV  K  T ++ LVF + G   +  ++  G +PLPPYIA KR  DA+D VDY
Sbjct: 111 --SDHFSATVAGKSET-DLRLVFDLEGAAFDAALAEAGAMPLPPYIAAKRAPDAQDRVDY 167

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT +A+  G+VAAPTA LHF + LL+ L + G+    VTLHVGAGTF+PVKVED   H M
Sbjct: 168 QTVFARHSGAVAAPTASLHFDAALLAALAAKGVDFTEVTLHVGAGTFLPVKVEDVTTHRM 227

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           H+E G +    A  +N+  + GGR++ VGTT+LRL+E+A   DG++  W+G T+IFI PG
Sbjct: 228 HAEWGEVTTVAAAQINATHAAGGRVIPVGTTALRLIESAAAADGLVRAWAGTTDIFIYPG 287

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           YRFR  D LM+NFHLPKSTLLMLVSA  G     ++YQHA+   YRF+SYGD SLL
Sbjct: 288 YRFRVADALMTNFHLPKSTLLMLVSALMGQGRITRIYQHAVVQRYRFFSYGDASLL 343


>gi|114764580|ref|ZP_01443784.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Pelagibaca
           bermudensis HTCC2601]
 gi|114542956|gb|EAU45976.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Roseovarius
           sp. HTCC2601]
          Length = 349

 Score =  306 bits (783), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 166/358 (46%), Positives = 223/358 (62%), Gaps = 13/358 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FDFDLP   IA RP  PR SARL+V   +      I+D +V DL  +L   D +V
Sbjct: 1   MHLSDFDFDLPDELIATRPANPRSSARLLVAEGD-----TITDAVVRDLTQWLRPGDRLV 55

Query: 61  FNNTKVITAQLNGVRFCHINR--REKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFF 118
            N+TKVI A+L+G R     +   + +I  TL        W+   +P K +++G+ +  F
Sbjct: 56  LNDTKVIPARLSGARTRESAQGVTQAQIEITLLEPRPGGLWAALVKPLKKLREGETV-VF 114

Query: 119 SQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYV 178
           S+   + LEA        G+ LL F++ G + +  ++  G +PLPPYIA KR  DA+D  
Sbjct: 115 SEALSATLEAR-----EDGQGLLRFNLEGEDFDAALAEAGAMPLPPYIAAKRAADAQDKT 169

Query: 179 DYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDH 238
           DYQT +A+  G+VAAPTA LHF + LL+ L + G+    VTLHVGAGTF+PVKV+D   H
Sbjct: 170 DYQTVWAERTGAVAAPTASLHFDAGLLAALEAHGVAFTKVTLHVGAGTFLPVKVDDVTTH 229

Query: 239 IMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFIT 298
            MH E G +    A  + + K+ GGR++ VGTT+LRLLETA  + G I  W G T+IFI 
Sbjct: 230 KMHGEWGEVSESAAAEIAATKAAGGRVIPVGTTALRLLETAARDSGAIAAWQGVTDIFIY 289

Query: 299 PGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           PG+ FR  D LM+NFHLPKSTL+MLVSA  G E    +Y+HAIS  YRF+SYGD+SLL
Sbjct: 290 PGFAFRVTDALMTNFHLPKSTLMMLVSALMGRERMMGIYEHAISERYRFFSYGDSSLL 347


>gi|329850831|ref|ZP_08265676.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Asticcacaulis biprosthecum C19]
 gi|328841146|gb|EGF90717.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Asticcacaulis biprosthecum C19]
          Length = 356

 Score =  305 bits (781), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 167/345 (48%), Positives = 219/345 (63%), Gaps = 15/345 (4%)

Query: 15  IALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIVFNNTKVITAQLNGV 74
           IALRP  PR+SARL+ +         ++D  V D+ AFL S D +V N+TKV+ AQL+G+
Sbjct: 15  IALRPAEPRESARLLRIDAQGG----LTDARVGDIAAFLKSGDLLVVNDTKVLPAQLHGI 70

Query: 75  RFCHINRREKE---ISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQDGQSRLEATVI 131
           R     RR+     I  TL        W  + +P + ++ GD LHF S     +L+ATV 
Sbjct: 71  R-----RRDGADVAIEATLIKATGATQWQAFLKPGRKVRIGDDLHFGSD---IKLQATVA 122

Query: 132 DKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDYQTTYAKIQGSV 191
            K   G   L F  +   L  ++ ++G +PLPPYI  KR  D +D  DYQT +A  +GSV
Sbjct: 123 AKAEDGRYTLDFHHTPEVLVERLHVIGAMPLPPYIRSKRREDDQDKRDYQTVFANEEGSV 182

Query: 192 AAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIMHSEIGFIDAPT 251
           AAPTAGLHFTS LL  L S G+ +  +TLHVGAGTF+P+KVEDT DHIMH+E+G I A +
Sbjct: 183 AAPTAGLHFTSQLLEVLQSQGVGIERITLHVGAGTFLPMKVEDTRDHIMHAELGVISAES 242

Query: 252 AQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPGYRFRAVDILMS 311
           A  +N+ +  GGRIV VGTTSLRLLE+A    G I+ ++  T IFITPG   R+ D++++
Sbjct: 243 AARINAARIAGGRIVCVGTTSLRLLESACDPQGTIHAFASETAIFITPGVVVRSCDLVLT 302

Query: 312 NFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           NFHLPKSTL MLVSA  G +  K  Y+HAI   YRF+SYGD  L+
Sbjct: 303 NFHLPKSTLFMLVSALAGTDTMKAAYRHAIETGYRFFSYGDACLI 347


>gi|254487456|ref|ZP_05100661.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Roseobacter
           sp. GAI101]
 gi|214044325|gb|EEB84963.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Roseobacter
           sp. GAI101]
          Length = 358

 Score =  305 bits (780), Expect = 9e-81,   Method: Compositional matrix adjust.
 Identities = 172/358 (48%), Positives = 226/358 (63%), Gaps = 14/358 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           + + +FDFDLP + IA RP  PR SARL+V       P V+ D +V+DLP +L + D +V
Sbjct: 5   LKLSDFDFDLPEALIATRPAVPRTSARLLVA----DGP-VLHDKVVTDLPDWLRAGDRLV 59

Query: 61  FNNTKVITAQLNGVRFCHINRR--EKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFF 118
            N+T+VI A+L G R     +   +  I  TL    S  +W+   +P K +K G+ +  F
Sbjct: 60  LNDTRVIPARLTGARHRDSAQGPVQARIEITLLEPRSDGTWAALIKPLKKLKVGEDV-VF 118

Query: 119 SQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYV 178
           S D    L AT+I   + G+  L F+ +G + +  ++  G +PLPPYIA KRP DA+D  
Sbjct: 119 SPD----LRATLIGTAD-GQGHLQFNCAGDDFDAALNAAGAMPLPPYIAAKRPADAQDLT 173

Query: 179 DYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDH 238
           DYQT +A+  G+VAAPTA LHF   LL  L   G+    VTLHVGAGTF+PVKV+D  DH
Sbjct: 174 DYQTVFARNLGAVAAPTASLHFDDALLQTLADKGVTFSHVTLHVGAGTFLPVKVDDIADH 233

Query: 239 IMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFIT 298
            MHSE G + A  A  + + K+ GGR++ VGTT+LRL+ETA    G I  W G T+IFIT
Sbjct: 234 KMHSEWGKVSAQAAAEIAATKAAGGRVIPVGTTALRLVETA-ARGGTIKAWEGDTDIFIT 292

Query: 299 PGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           PG+ F   D LM+NFHLPKSTL+MLV+A  G E  K +Y HAIS  YRF+SYGD SLL
Sbjct: 293 PGFTFNVADALMTNFHLPKSTLMMLVAALMGQEAIKTLYAHAISSNYRFFSYGDASLL 350


>gi|254437697|ref|ZP_05051191.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Octadecabacter antarcticus 307]
 gi|198253143|gb|EDY77457.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Octadecabacter antarcticus 307]
          Length = 350

 Score =  304 bits (779), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 163/361 (45%), Positives = 230/361 (63%), Gaps = 14/361 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FDFDLP S IA+RP  PR SA+L+V   + +      D  V+DL + L + D +V
Sbjct: 1   MKLSDFDFDLPDSLIAVRPARPRSSAKLLVAGGDGT-----RDLRVTDLVSVLRAGDHLV 55

Query: 61  FNNTKVITAQLNGVRFCHINRRE--KEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFF 118
            N+TKVI A+L G R           +I  TL    +  +W+   +P + ++ G+ +  F
Sbjct: 56  LNDTKVIPARLVGERMRKSTDGAGLAKIEVTLLEPQADGTWAALIKPLRKVRDGERV-VF 114

Query: 119 SQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYV 178
           S D    L A ++ +++ G   L F+++G + +  ++  G +PLPPYIA KRP D  D  
Sbjct: 115 SDD----LSAVLVHRFD-GMGYLDFNVTGDDFDAALNAAGAMPLPPYIAAKRPADDLDKE 169

Query: 179 DYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDH 238
           DYQT +A   G+VAAPTA LHF   LL  L ++G+K  +VTLHVGAGTF+PVKV+D  DH
Sbjct: 170 DYQTVWAARSGAVAAPTASLHFEQWLLDDLAAMGVKFSYVTLHVGAGTFLPVKVDDVADH 229

Query: 239 IMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFIT 298
           +MHSE G + A +A  + + K+ GGR++ VGTT+ RL+ETA    G +  W G T+IFIT
Sbjct: 230 VMHSEWGQVSALSASDIMATKAAGGRVIPVGTTACRLIETAGAS-GTLAAWEGETDIFIT 288

Query: 299 PGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLFQ 358
           PG+ F+  D LM+NFHLPKSTL+MLVSA  G +  K +Y HAI++ YRF+SYGD+S+L  
Sbjct: 289 PGFEFQITDGLMTNFHLPKSTLMMLVSALMGSQRIKDIYAHAIANEYRFFSYGDSSILLP 348

Query: 359 K 359
           K
Sbjct: 349 K 349


>gi|89054208|ref|YP_509659.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Jannaschia
           sp. CCS1]
 gi|122498901|sp|Q28RM8|QUEA_JANSC RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|88863757|gb|ABD54634.1| Queuosine biosynthesis protein [Jannaschia sp. CCS1]
          Length = 355

 Score =  304 bits (778), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 165/345 (47%), Positives = 221/345 (64%), Gaps = 15/345 (4%)

Query: 15  IALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIVFNNTKVITAQLNGV 74
           IA RP  PR SARL+V     +  L      V+DLP+ L   D +V N+T+VI A+L G 
Sbjct: 15  IATRPARPRSSARLLVADGPETHDLT-----VADLPSMLRRGDRLVLNDTRVIPARLTGT 69

Query: 75  RFCHINRRE--KEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQDGQSRLEATVID 132
           R     + E    I  TL    +  +WS  A+P + +K G+ +  FS   Q+ + A  +D
Sbjct: 70  RTRMSAQGEVTARIEVTLMEPQADGTWSALAKPMRKLKAGEKI-IFSNALQADVHA--MD 126

Query: 133 KWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDYQTTYAKIQGSVA 192
           +     + L F++ G + +  ++  G +PLPPYIA KR  DARDY DYQT +AK  G+VA
Sbjct: 127 E----GLRLAFNVEGDDFDAALNAAGAMPLPPYIAGKRAPDARDYHDYQTIWAKRAGAVA 182

Query: 193 APTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIMHSEIGFIDAPTA 252
           APTA LHF  +L+  L S G+ V FVTLHVGAGTF+PV V+D   H MH+E G + A  A
Sbjct: 183 APTASLHFDEHLMDALTSRGVDVTFVTLHVGAGTFLPVTVDDVTTHKMHAEWGEVRATAA 242

Query: 253 QALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPGYRFRAVDILMSN 312
             +N+ K+ GGRI+ VGTT+LRL+E+A  +DG I+P+ G T+IFI PGYR++  D LM+N
Sbjct: 243 AEINATKAAGGRIIPVGTTALRLIESA-AQDGTIHPFEGTTDIFIYPGYRWQITDALMTN 301

Query: 313 FHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           FHLPKSTLLMLVSA  G +    +Y HAI++ YRF+SYGD SLLF
Sbjct: 302 FHLPKSTLLMLVSALMGKDRMDAVYAHAIANQYRFFSYGDASLLF 346


>gi|84515554|ref|ZP_01002916.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Loktanella
           vestfoldensis SKA53]
 gi|84510837|gb|EAQ07292.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Loktanella
           vestfoldensis SKA53]
          Length = 351

 Score =  304 bits (778), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 169/362 (46%), Positives = 232/362 (64%), Gaps = 14/362 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FDFDLP + IA RP  PR SARL++   +      I+D +V+DL   L   D +V
Sbjct: 1   MKLSDFDFDLPEALIATRPARPRSSARLLLAQGDR-----IADQIVTDLVDILQPGDRLV 55

Query: 61  FNNTKVITAQLNGVRF--CHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFF 118
            N+TKVI A+LNG R            I  TL    +  SWS   +P K ++ G+++  F
Sbjct: 56  LNDTKVIPARLNGTRARSGEAGDTSARIEVTLLEPRADGSWSALVKPLKKLRDGEVV-VF 114

Query: 119 SQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYV 178
           S D    L AT+  + + G+  L F+++G + +  ++ VG +PLPPYIA KR  DA D  
Sbjct: 115 SAD----LSATMTGRGD-GQAYLQFNLTGDDFDAALNAVGAMPLPPYIAAKRAADAADMD 169

Query: 179 DYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDH 238
           DYQT +AK  G+VAAPTA LHF   LL  L + G+ + +VTLHVGAGTF+PVKV+D  +H
Sbjct: 170 DYQTYWAKHAGAVAAPTASLHFDGPLLQALAARGVTMSYVTLHVGAGTFLPVKVDDVSEH 229

Query: 239 IMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFIT 298
            MH+E G + A  A  +N+ K+ G R++ VGTT+LRL+E+A  + G + PW+G T+IFIT
Sbjct: 230 KMHAEWGEVTATAAAQINATKAAGKRVIPVGTTALRLIESA-AKGGQLQPWTGPTDIFIT 288

Query: 299 PGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLFQ 358
           PG+ F+  D LM+NFHLPKSTL+MLVSA  G++  K +Y HAI+  YRF+SYGD SLL  
Sbjct: 289 PGFTFQIADGLMTNFHLPKSTLMMLVSALMGMDRIKAIYAHAIAERYRFFSYGDASLLLP 348

Query: 359 KR 360
            R
Sbjct: 349 DR 350


>gi|296536218|ref|ZP_06898336.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Roseomonas
           cervicalis ATCC 49957]
 gi|296263440|gb|EFH09947.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Roseomonas
           cervicalis ATCC 49957]
          Length = 360

 Score =  302 bits (774), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 154/359 (42%), Positives = 218/359 (60%), Gaps = 14/359 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           +  ++FDF LP + IA  P  PRD+ARL+V     + P  + D  V DLPA+L   D +V
Sbjct: 12  LRAEDFDFALPEALIAQAPARPRDAARLLV-----AAPEGLRDQGVRDLPAWLRPGDLMV 66

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+VI A+L         R E  +   L+   S   W    R +K ++ GDIL     
Sbjct: 67  VNDTRVIPARLRA------RRGEARLEIMLNRAESGGMWHALVRNAKKLRPGDILTI--- 117

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
           +G   L   V+++   G  L+ F     +L   +   G IPLPPYIAR       D  DY
Sbjct: 118 EGAPELAPRVVERQEGGAALIDFGPDQGKLAAALEKAGEIPLPPYIARPDGPRPEDREDY 177

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           Q  +A+  G+VAAPTA LHFT  LL+ L   G+    +TLHVGAGTF+P++ ++  +H +
Sbjct: 178 QPIFAREPGAVAAPTASLHFTPGLLAALAERGVGQVSLTLHVGAGTFLPIRGDNPREHKL 237

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           H+E G I    A ++N  ++RGGRIV++GTT+LRLLE+A  E G+++P+ G T+IF+ PG
Sbjct: 238 HAEWGHISEAAAASINETRARGGRIVAIGTTALRLLESAVDERGVVHPFRGLTDIFLLPG 297

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLFQK 359
           + FR+ D+L++NFHLPKS+L MLVSAF G    +  Y HA++  YRFYSYGD SLLF++
Sbjct: 298 HVFRSADLLLTNFHLPKSSLFMLVSAFAGQARMRDAYAHAVAQGYRFYSYGDASLLFRE 356


>gi|163736612|ref|ZP_02144031.1| Queuosine biosynthesis protein [Phaeobacter gallaeciensis BS107]
 gi|161390482|gb|EDQ14832.1| Queuosine biosynthesis protein [Phaeobacter gallaeciensis BS107]
          Length = 356

 Score =  302 bits (774), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 165/358 (46%), Positives = 228/358 (63%), Gaps = 14/358 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FDFDLP  RIA RP  PR SARL+V   +      I D  V++L  +L S D +V
Sbjct: 1   MKLSDFDFDLPDDRIATRPAVPRSSARLLVAEGDR-----IRDARVANLGQWLRSGDRLV 55

Query: 61  FNNTKVITAQLNGVRFCHINR--REKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFF 118
            N+TKVI A+L+G+R     +     ++  TL    +  SW+   +P K +K G+ + F 
Sbjct: 56  LNDTKVIPARLSGLRHRDTAQGPMAAKVEVTLLDPGADGSWAALLKPLKKVKLGEEIIF- 114

Query: 119 SQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYV 178
                  L AT +++   G+  L F++SG + +  ++  G +PLPPYIA KRP D +D  
Sbjct: 115 ----SDTLSAT-LERIEDGQGHLKFNLSGTDFDAALAEAGAMPLPPYIAAKRPADEQDKT 169

Query: 179 DYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDH 238
           DYQT +A+  G+VAAPTA LHF   LL+ L + G+++ +VTLHVGAGTF+PVKVED   H
Sbjct: 170 DYQTVWARNSGAVAAPTASLHFDDALLAELQAKGVEISYVTLHVGAGTFLPVKVEDVTTH 229

Query: 239 IMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFIT 298
            MH+E G + A  A  + + K+ GGR++ VGTT+LRL+E+A  + G I PW G T+IFI 
Sbjct: 230 RMHAEWGRVSAEAATEIAATKAAGGRVIPVGTTALRLIESA-GQSGAIQPWEGDTDIFIY 288

Query: 299 PGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           PG+ F   D LM+NFHLPKSTLLMLVSA  G +  + +Y HA++  YRF+SYGD SLL
Sbjct: 289 PGFTFHVADALMTNFHLPKSTLLMLVSALMGQDRIRAIYDHALAEEYRFFSYGDASLL 346


>gi|84503044|ref|ZP_01001140.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Oceanicola
           batsensis HTCC2597]
 gi|84388588|gb|EAQ01460.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Oceanicola
           batsensis HTCC2597]
          Length = 348

 Score =  302 bits (773), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 165/358 (46%), Positives = 226/358 (63%), Gaps = 14/358 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FDFDLP   IA RP  PR SARL+V   +      I D +V DL  +L   D +V
Sbjct: 1   MKLSDFDFDLPEGLIATRPARPRSSARLLVAEGD-----AIHDAVVRDLTDWLRPGDRLV 55

Query: 61  FNNTKVITAQLNGVRFCHINR--REKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFF 118
            N+T+VI A+L G R    ++   E  I  TL    +   W+   +P K +++G+++ F 
Sbjct: 56  LNDTRVIPARLAGKRARDSDQGPTEARIDVTLLEPRASGHWAALIKPLKKVREGEVIRF- 114

Query: 119 SQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYV 178
           S D  +RL        + G+ LL F++ G + +R ++  G +PLPPYIA  RP D RD  
Sbjct: 115 SDDLSARLTGR-----DEGQGLLEFNLKGEDFDRALAEAGAMPLPPYIAAMRPPDDRDKD 169

Query: 179 DYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDH 238
           DYQT +A+  G+VAAPTA LHF + LL R+  +G+++  VTLHVGAGTF+PVKVED   H
Sbjct: 170 DYQTVWARRSGAVAAPTASLHFDAPLLDRIAGMGVEMTHVTLHVGAGTFLPVKVEDVTTH 229

Query: 239 IMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFIT 298
            MH+E G + A  A  + + ++ GGRI+ VGTT+LRL+E+A    G I PW G T+IFI 
Sbjct: 230 RMHAEWGEVTAQAADEIAATRAGGGRIIPVGTTALRLIESA-ARSGQIGPWRGETDIFIY 288

Query: 299 PGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           PG+ FR  D LM+NFHLP+STL+MLVSA  G E  + +Y HA++  YRF+SYGD SLL
Sbjct: 289 PGFEFRVTDALMTNFHLPRSTLMMLVSALMGQERIRSVYDHAVARKYRFFSYGDASLL 346


>gi|330991057|ref|ZP_08315011.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Gluconacetobacter sp. SXCC-1]
 gi|329761878|gb|EGG78368.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Gluconacetobacter sp. SXCC-1]
          Length = 397

 Score =  301 bits (772), Expect = 7e-80,   Method: Compositional matrix adjust.
 Identities = 169/358 (47%), Positives = 224/358 (62%), Gaps = 14/358 (3%)

Query: 2   MVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIVF 61
           +V +FDF LPP RIA  P  PRDSARL+ V   ++ P  I D  V DLP  L + D +V 
Sbjct: 49  LVSDFDFTLPPDRIADHPARPRDSARLLDV--PVAGP--IMDRHVRDLPGCLRAGDILVA 104

Query: 62  NNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQD 121
           N+T VI AQL+  R          I  TL   +   SW V AR ++ +  GD L F    
Sbjct: 105 NDTAVIPAQLSATRGA------ARIGITLDRILPDGSWHVLARNARRLHPGDTLAF---- 154

Query: 122 GQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDYQ 181
           G S + A V+   + G++ L FS+ G   ++ +   G + LPPYIAR      +D  DY 
Sbjct: 155 GASPVTADVLACGDAGDVTLRFSVEGAAFDQFLHDTGHLALPPYIARPEGPTEQDRKDYA 214

Query: 182 TTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIMH 241
           T +A+ +G+VAAPTAGLHFT +LL+ L   G+    +TLHVGAGTF+P++ E    H MH
Sbjct: 215 TIFAQHRGAVAAPTAGLHFTPDLLAALDHAGVLRQTLTLHVGAGTFLPMRSEQISAHRMH 274

Query: 242 SEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPGY 301
           +E G I    A+ +N+ ++ GGRI++VGTTSLRLLE+AT EDG+++P+ G T IFI PGY
Sbjct: 275 AERGTITPHAARRINAARAAGGRIIAVGTTSLRLLESATDEDGVVHPFHGETAIFIKPGY 334

Query: 302 RFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLFQK 359
           RFRAVD+L++NFHLP+STL MLV AF G    +  Y HAI+  YRFYSYGD  LL + 
Sbjct: 335 RFRAVDMLLTNFHLPRSTLFMLVCAFGGYRRMQAAYAHAIAKGYRFYSYGDACLLHRS 392


>gi|86138785|ref|ZP_01057357.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Roseobacter
           sp. MED193]
 gi|85824432|gb|EAQ44635.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Roseobacter
           sp. MED193]
          Length = 356

 Score =  301 bits (772), Expect = 8e-80,   Method: Compositional matrix adjust.
 Identities = 163/362 (45%), Positives = 227/362 (62%), Gaps = 14/362 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FDFDLP + IA RP  PR SARL+V  P+      ++D  + DL   L   D +V
Sbjct: 1   MKLSDFDFDLPDALIATRPATPRSSARLLVATPD-----QMTDGHIGDLVDLLQPGDRLV 55

Query: 61  FNNTKVITAQLNGVRF--CHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFF 118
            N+TKVI A+L+G+R       R   +I  TL    +  SWS   +P K +K G+ + F 
Sbjct: 56  LNDTKVIPARLSGLRHRDTAQGRMAAKIEVTLLDPKADGSWSALLKPLKKVKIGETVAF- 114

Query: 119 SQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYV 178
                  L A ++     G+ LL F++ G + +  ++  G +PLPPYIA KR  D +D  
Sbjct: 115 ----SDALTAELVGV-TEGQGLLRFNLVGDDFDAALNAAGAMPLPPYIAAKRAADDQDKE 169

Query: 179 DYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDH 238
           DYQT +A+  G+VAAPTA LHF  +LL+ L + G++  +VTLHVGAGTF+PVKVED   H
Sbjct: 170 DYQTVWARHSGAVAAPTASLHFDQDLLAVLKAKGVQFTYVTLHVGAGTFLPVKVEDVTSH 229

Query: 239 IMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFIT 298
            MH+E G + A  A  + + K+ GGR++ VGTT+LRL+E+A    G + PW G T+IFI 
Sbjct: 230 KMHAEWGRVSAEAAAEIAATKAAGGRVIPVGTTALRLIESA-ARGGTVQPWEGETDIFIY 288

Query: 299 PGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLFQ 358
           PG+ F A D LM+NFHLPKSTLLML+SA  G +  +++Y+HA++  YRF+SYGD SLL  
Sbjct: 289 PGFVFHAADALMTNFHLPKSTLLMLISALMGQDRVREIYEHAVNSRYRFFSYGDGSLLLP 348

Query: 359 KR 360
           + 
Sbjct: 349 QE 350


>gi|146277887|ref|YP_001168046.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Rhodobacter
           sphaeroides ATCC 17025]
 gi|166216745|sp|A4WTM7|QUEA_RHOS5 RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|145556128|gb|ABP70741.1| Queuosine biosynthesis protein [Rhodobacter sphaeroides ATCC 17025]
          Length = 346

 Score =  300 bits (768), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 166/358 (46%), Positives = 218/358 (60%), Gaps = 18/358 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FDFDLP   IA RP  PR +ARL++   +      I D  V DL    +  D +V
Sbjct: 1   MKLSDFDFDLPERLIATRPARPRTAARLLLAEGDR-----IEDRHVRDLVGIFHPGDRLV 55

Query: 61  FNNTKVITAQLNGVRFCHINRREK--EISCTLHMRVSPNSWSVYARPSKVIKKGDILHFF 118
            NNT+VI A+L G R     R E   +I  TL    +   W   A+P + +K+G+ + F 
Sbjct: 56  LNNTRVIPARLVGTR----TRGEACAKIEITLMEPAAAGGWRALAKPLRKLKEGETIRF- 110

Query: 119 SQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYV 178
                  L A V +K  T ++ LVF  +G + +  ++  G +PLPPYIA +R  DA+D  
Sbjct: 111 ----SDALSAEVAEKGET-DLRLVFDRAGEDFDAALAEAGAMPLPPYIAARRAPDAQDRE 165

Query: 179 DYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDH 238
           DYQT +A+  G+VAAPTA LHF   LL  L + G+    VTLHVGAGTF+PVKVED   H
Sbjct: 166 DYQTVFARHAGAVAAPTASLHFDRPLLEALAANGVAFTEVTLHVGAGTFLPVKVEDVTTH 225

Query: 239 IMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFIT 298
            MH+E G +    A  + + K+ GGR++ VGTT+LRL+E+A+   G I PW G T+IFI 
Sbjct: 226 RMHAEWGEVTEAAAAEIAATKAAGGRVIPVGTTALRLIESASAA-GTIRPWRGETDIFIY 284

Query: 299 PGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           PGYRFR  D LM+NFHLPKSTLLMLVSA  G    + +Y HA+ H YRF+SYGD SLL
Sbjct: 285 PGYRFRVTDALMTNFHLPKSTLLMLVSALMGEARIRAIYDHAVRHDYRFFSYGDASLL 342


>gi|126728575|ref|ZP_01744390.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Sagittula
           stellata E-37]
 gi|126710505|gb|EBA09556.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Sagittula
           stellata E-37]
          Length = 354

 Score =  299 bits (765), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 164/358 (45%), Positives = 230/358 (64%), Gaps = 14/358 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FDF+LP   IA RP  PR +ARL+V         VISD  V++LP +L   D +V
Sbjct: 1   MKLSDFDFELPERLIATRPARPRTAARLLVCDGG-----VISDATVAELPDWLRPGDRLV 55

Query: 61  FNNTKVITAQLNGVR--FCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFF 118
            N+T+VI A+L+GVR         E +I  TL    +   WS   +P K ++ G+I+ F 
Sbjct: 56  LNDTQVIPARLSGVRRRVGEAGETEAQIEVTLLEPRADGCWSALLKPLKKVRDGEIVRF- 114

Query: 119 SQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYV 178
           S D    LEA ++ + + G+ +L F+++  + +  ++  G +PLPPYIA +RP DA+D  
Sbjct: 115 SDD----LEAMLMSRQD-GQAILRFNLAAADFDAALNAAGAMPLPPYIAARRPADAQDKE 169

Query: 179 DYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDH 238
           DYQT +A+ +G+VAAPTA LHF  +LL R+  +G+    VTLHVGAGTF+PVKVED   H
Sbjct: 170 DYQTVWARNRGAVAAPTASLHFDESLLKRIADMGVAFTHVTLHVGAGTFLPVKVEDVTTH 229

Query: 239 IMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFIT 298
            MH E G +    A  + + ++ GGR++ VGTT+LRL+E+A  E G I P+ G T+IFI 
Sbjct: 230 RMHGEWGEVTPQAAAEIAATRAAGGRVIPVGTTALRLIESAARE-GEIAPFHGVTDIFIY 288

Query: 299 PGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           PG+ F   D LM+NFHLPKSTLLMLVSA  G +  +++Y HA++  YRF+SYGD SLL
Sbjct: 289 PGFSFNVTDALMTNFHLPKSTLLMLVSALMGQDCIREVYAHAVAEDYRFFSYGDASLL 346


>gi|260433384|ref|ZP_05787355.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Silicibacter lacuscaerulensis ITI-1157]
 gi|260417212|gb|EEX10471.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Silicibacter lacuscaerulensis ITI-1157]
          Length = 348

 Score =  298 bits (764), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 163/360 (45%), Positives = 223/360 (61%), Gaps = 18/360 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FDFDLP   IA RP  PR SARL+V   +      I+D  V +LP +L   D +V
Sbjct: 1   MKLSDFDFDLPEDLIATRPANPRTSARLLVAQGD-----DIADDRVFNLPDWLRPGDRLV 55

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRV----SPNSWSVYARPSKVIKKGDILH 116
            N+T+VI A+L+G R  H N  +  +S  +   +    +  +W+   +P K ++ G+ + 
Sbjct: 56  LNDTRVIPARLSGRR--HRNSAQGPVSAAIEATLLDPQADGTWAALLKPLKKVRVGEEI- 112

Query: 117 FFSQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARD 176
            FS D      + V+++   G+  L F+++G + +R +   G +PLPPYIA KRP D RD
Sbjct: 113 VFSGD-----LSAVLERVAEGQAYLRFNLTGEDFDRALEQAGAMPLPPYIAAKRPADERD 167

Query: 177 YVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTD 236
             DYQT +A+  G+VAAPTA LHF   LL  L   G++   VTLHVGAGTF+PVKVED  
Sbjct: 168 KTDYQTVWARHSGAVAAPTASLHFDEALLKTLTERGVEFTHVTLHVGAGTFLPVKVEDVT 227

Query: 237 DHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIF 296
            H MH+E G +    A  + + K+ GGR++ VGTT+LRL+E+A    G I PW G T+IF
Sbjct: 228 THKMHAEWGRVSPQAAAEIAATKAAGGRVIPVGTTALRLIESA-ARGGRIEPWEGETDIF 286

Query: 297 ITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           I PG+ F   D LM+NFHLPKSTLLMLVSA  G +   ++Y HAI+  YRF+SYGD SLL
Sbjct: 287 IYPGFTFHVTDALMTNFHLPKSTLLMLVSALMGKDRMLRIYDHAIACRYRFFSYGDASLL 346


>gi|294083598|ref|YP_003550355.1| Queuosine biosynthesis protein [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292663170|gb|ADE38271.1| Queuosine biosynthesis protein [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 386

 Score =  298 bits (762), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 171/368 (46%), Positives = 222/368 (60%), Gaps = 28/368 (7%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FDFDLPP RIA  P  PRDSARL+    +LS    I+D  V DLP  L + D ++
Sbjct: 17  MKLSDFDFDLPPDRIATAPAQPRDSARLL----DLSGA-AIADRHVGDLPDLLRAGDLLI 71

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHM----RVSPNS-WSVYARPSKVIKKGDIL 115
            N+T VI A+L G       R +  IS TLH     +   N+ W V+A+P+K  +  DI+
Sbjct: 72  VNDTAVIPARLIG------KRGDARISVTLHKYEGHKNGGNAIWRVFAKPAKKCRPDDII 125

Query: 116 HFFSQDGQSRLEATVIDKWNTGEILLVF-------SISGIELERQISLVGTIPLPPYIAR 168
            F    G     A V+ +   G++ L F       ++    L   +   GT+PLPPYIAR
Sbjct: 126 MFAPDFG-----ARVLGRGEGGDVELAFIDPRSGNALDTDSLNAGLDTYGTMPLPPYIAR 180

Query: 169 KRPIDARDYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFM 228
              +   D+ DYQT +A  +G+VAAPTAGLHFT  L S L + G+ +  VTLHVGAGTF+
Sbjct: 181 PDGVLDSDHEDYQTMFASQRGAVAAPTAGLHFTDGLTSALQAKGVAIAAVTLHVGAGTFL 240

Query: 229 PVKVEDTDDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINP 288
           PV VE   +H MHSE G I A  A  + + K  GGR+++VGTTSLR+LE +    G I  
Sbjct: 241 PVTVETIAEHKMHSEWGAIPADVAAKIIATKQAGGRVIAVGTTSLRILEASFAALGHIGH 300

Query: 289 WSGFTNIFITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFY 348
           ++G T+IFITPG+ F  VD+LM+NFHLPKSTLLMLVSAF G       Y HAI+  YRF+
Sbjct: 301 FAGETDIFITPGFSFNVVDMLMTNFHLPKSTLLMLVSAFAGHAPIMAAYDHAIASGYRFF 360

Query: 349 SYGDTSLL 356
           SYGD  LL
Sbjct: 361 SYGDACLL 368


>gi|149914724|ref|ZP_01903254.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Roseobacter
           sp. AzwK-3b]
 gi|149811517|gb|EDM71352.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Roseobacter
           sp. AzwK-3b]
          Length = 350

 Score =  296 bits (758), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 168/363 (46%), Positives = 225/363 (61%), Gaps = 23/363 (6%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FDFDLP   IA RP  PR SARL+V   +      I D +V DL  FL   D +V
Sbjct: 1   MKLSDFDFDLPEDLIATRPARPRSSARLLVAQGD-----AIRDAIVRDLGDFLRPGDRLV 55

Query: 61  FNNTKVITAQLNGVRFCHINRRE-------KEISCTLHMRVSPNSWSVYARPSKVIKKGD 113
            N+T VI A+L+G+R     RRE        +I  TL        WS   +P K ++ G+
Sbjct: 56  LNDTAVIPARLSGMR-----RREGPEGVTQAKIEVTLLEPGPEGDWSALVKPLKKVRDGE 110

Query: 114 ILHFFSQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPID 173
           ++ F      + LEA V+ +   G+ LL F++ G   +  ++  G +PLPPYIA +R  D
Sbjct: 111 VIVF-----GAGLEAEVLAR-REGQGLLRFNLEGEAFDTALNDAGAMPLPPYIAARRAAD 164

Query: 174 ARDYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVE 233
           A+D  DYQT +A+ +G+VAAPTA LHF + LL RL ++G+    VTLHVGAGTF+PVKVE
Sbjct: 165 AQDRTDYQTVWARHKGAVAAPTASLHFDAELLERLEAMGVTFSHVTLHVGAGTFLPVKVE 224

Query: 234 DTDDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFT 293
           D   H MH+E G +    A  + + K+ GGR++ VGTT+LRL+E+A    G I PW G T
Sbjct: 225 DVTTHRMHAEWGRVSEAAAAEIAATKAAGGRVIPVGTTALRLIESAAQASGAIAPWEGET 284

Query: 294 NIFITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDT 353
           +IFI PG+ FR  D LM+NFHLPKSTL+MLVSA  G +  K +Y HA+ + YRF+SYGD 
Sbjct: 285 DIFIYPGFTFRVADALMTNFHLPKSTLMMLVSALMGQDRIKDIYDHAVENRYRFFSYGDA 344

Query: 354 SLL 356
           SLL
Sbjct: 345 SLL 347


>gi|56697089|ref|YP_167452.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Ruegeria
           pomeroyi DSS-3]
 gi|81558479|sp|Q5LRA3|QUEA_SILPO RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|56678826|gb|AAV95492.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Ruegeria
           pomeroyi DSS-3]
          Length = 349

 Score =  295 bits (755), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 162/345 (46%), Positives = 217/345 (62%), Gaps = 14/345 (4%)

Query: 15  IALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIVFNNTKVITAQLNGV 74
           IA RP  PR SARL+V   +      ISD +V DLP +L   D +V N+T+VI A+L+G 
Sbjct: 15  IATRPAQPRSSARLLVARGD-----AISDAVVRDLPDWLRPGDRLVLNDTRVIPARLSGT 69

Query: 75  RFCHINRR--EKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQDGQSRLEATVID 132
           R     +      I  TL    +  SWS  A+P + +++G+ +  FS D  + +EA    
Sbjct: 70  RQRQSAQGPVTARIEITLLEPRADGSWSALAKPLRKLREGETI-IFSNDLSADVEAI--- 125

Query: 133 KWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDYQTTYAKIQGSVA 192
               G+ LL F+++G + +  ++  G +PLPPYIA KR  D +D  DYQT +A+  G+VA
Sbjct: 126 --EDGQALLRFNLTGPDFDAALAQAGAMPLPPYIAAKRAADEQDKTDYQTVWARHSGAVA 183

Query: 193 APTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIMHSEIGFIDAPTA 252
           APTA LHF   LL+ L + G+    VTLHVGAGTF+PVKVED   H MH+E G + A  A
Sbjct: 184 APTASLHFDDTLLAALAAHGVTFTHVTLHVGAGTFLPVKVEDVTTHKMHAEWGRVSAEAA 243

Query: 253 QALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPGYRFRAVDILMSN 312
             + + K+ GGR++ VGTT+LRL+E+A    G I PW G T+IFI PG+ FR  D LM+N
Sbjct: 244 AEIAATKAAGGRVIPVGTTALRLIESA-ARGGQIAPWEGDTDIFIYPGFDFRVADGLMTN 302

Query: 313 FHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           FHLPKSTLLMLVSA  G E  +K+Y HA+ + YRF+SYGD SLL 
Sbjct: 303 FHLPKSTLLMLVSALMGQESIRKIYAHAVENRYRFFSYGDASLLL 347


>gi|77463529|ref|YP_353033.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Rhodobacter
           sphaeroides 2.4.1]
 gi|91207401|sp|Q3J252|QUEA_RHOS4 RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|77387947|gb|ABA79132.1| S-adenosylmethionine tRNA ribosyltransferase-isomerase [Rhodobacter
           sphaeroides 2.4.1]
          Length = 346

 Score =  295 bits (755), Expect = 8e-78,   Method: Compositional matrix adjust.
 Identities = 164/356 (46%), Positives = 212/356 (59%), Gaps = 14/356 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FDFDLP   IA RP  PR +ARL++   +      I D  V DL       D +V
Sbjct: 1   MQLSDFDFDLPERLIATRPARPRTAARLLLAEGDR-----IEDRHVRDLVGIFRPGDRLV 55

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NNT+VI A+L G R       E  +  TL    +   W   A+P + +K G+ + F   
Sbjct: 56  LNNTRVIPARLTGTRTR--GEAEARVEVTLMEPAAAGGWRAMAKPLRKLKPGETIRF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
                L A V +K  T ++ LVF  +G   +  ++  G +PLPPYIA +R  D +D  DY
Sbjct: 111 --SDALSAEVAEKGET-DLRLVFDRAGAAFDAALAEAGAMPLPPYIAARRAPDTQDDEDY 167

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT +A+  G+VAAPTA LHF   LL  L + G+    VTLHVGAGTF+PVKVED   H M
Sbjct: 168 QTVFARHAGAVAAPTASLHFDRPLLEALAARGVGFTEVTLHVGAGTFLPVKVEDVTTHRM 227

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           H+E G +    A  + + K+ GGR++ VGTT+LRL+E+A    G I PW G T+IFI PG
Sbjct: 228 HAEWGEVTETAAAEIAATKAAGGRVIPVGTTALRLIESAAAS-GAIRPWRGETDIFIYPG 286

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           YRFR  D LM+NFHLPKSTLLMLVSA  G E  + +Y HA+ H YRF+SYGD SLL
Sbjct: 287 YRFRVTDALMTNFHLPKSTLLMLVSALMGQERIRAIYDHAVRHDYRFFSYGDASLL 342


>gi|254509984|ref|ZP_05122051.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Rhodobacteraceae bacterium KLH11]
 gi|221533695|gb|EEE36683.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Rhodobacteraceae bacterium KLH11]
          Length = 353

 Score =  295 bits (754), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 165/360 (45%), Positives = 221/360 (61%), Gaps = 18/360 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FDF LP   IA RP  PR SARL+V   +      I D  V  LP  L   D +V
Sbjct: 6   MKLSDFDFHLPEHLIATRPASPRSSARLLVAQED-----AIQDRNVFHLPDLLQPGDRLV 60

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLH---MRVSPNS-WSVYARPSKVIKKGDILH 116
            N+T+VI A+L+G R  H +  +  +S  +    +   P+  W+   +P K +K G+ + 
Sbjct: 61  LNDTRVIPARLSGRR--HRDSAQGPVSAAIEATLLEPQPDGCWAALIKPLKKVKPGEEI- 117

Query: 117 FFSQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARD 176
            FS D    L AT +D+ + G+  L F+++G + +  +   G +PLPPYIA KR  D +D
Sbjct: 118 VFSDD----LSAT-LDRVSDGQAYLRFNLTGEDFDHALEQAGAMPLPPYIAAKRAADEQD 172

Query: 177 YVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTD 236
             DYQT +A+  G+VAAPTA LHF   LL  L + G+    VTLHVGAGTF+PVKVED  
Sbjct: 173 KTDYQTVWARNAGAVAAPTASLHFDDTLLRALAARGVAFTHVTLHVGAGTFLPVKVEDVT 232

Query: 237 DHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIF 296
            H MH+E G + A  A  + + K+ GGR++ VGTT+LRL+E+A    G I PW G T+IF
Sbjct: 233 THKMHAEWGRVSAQAAAEIAATKAAGGRVIPVGTTALRLIESA-ARGGQIAPWEGETDIF 291

Query: 297 ITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           I PG+RF   D LM+NFHLPKSTLLMLVSA  G +  + +Y HAI+  YRF+SYGD SLL
Sbjct: 292 IYPGFRFHVTDALMTNFHLPKSTLLMLVSALMGQDRVRTIYDHAIAEEYRFFSYGDASLL 351


>gi|89069964|ref|ZP_01157296.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Oceanicola
           granulosus HTCC2516]
 gi|89044412|gb|EAR50543.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Oceanicola
           granulosus HTCC2516]
          Length = 349

 Score =  294 bits (752), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 162/359 (45%), Positives = 225/359 (62%), Gaps = 13/359 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FDFDLP   IA+RP  PR SARL++   +      I D +VS+LP  L   D +V
Sbjct: 1   MQLSDFDFDLPDELIAVRPARPRSSARLLLAEGD-----AIGDRIVSELPRILQPGDRLV 55

Query: 61  FNNTKVITAQLNGVRFCHINRRE--KEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFF 118
            N+T+VI A+L G R       E    I  TL    +   WS   +P + +++G+ + F 
Sbjct: 56  LNDTRVIPARLTGTRTRPGAAGEGVARIEVTLLEPRADGLWSALVKPLRKLREGEEVVF- 114

Query: 119 SQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYV 178
                 RL A+ ++    G+ LL F+ +G + +  ++  G +PLPPYIA +RP DA D  
Sbjct: 115 ----SPRLTAS-LEAREAGQGLLRFNCTGEDFDAALAEAGAMPLPPYIAARRPADAADKD 169

Query: 179 DYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDH 238
           DYQT +A+  G+VAAPTA LHF + LL  + + G+++  VTLHVGAGTF+PVKVED   H
Sbjct: 170 DYQTVWAERPGAVAAPTASLHFDAPLLEAIAARGVEITRVTLHVGAGTFLPVKVEDVTTH 229

Query: 239 IMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFIT 298
            MH+E G +    A  + + +  GGR++ VGTT+LRL+ETA    G I PW+G T+IFI 
Sbjct: 230 RMHAEWGEVTEAAAAEIAATRGAGGRVIPVGTTALRLIETAARASGEIAPWTGETDIFIY 289

Query: 299 PGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           PG+ FR  D LM+NFHLP+STL+MLVSAF G+E  + +Y HA++  YRF+SYGD SLL 
Sbjct: 290 PGFEFRVADGLMTNFHLPRSTLMMLVSAFMGMERVRAIYAHAVAERYRFFSYGDASLLL 348


>gi|126462385|ref|YP_001043499.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Rhodobacter
           sphaeroides ATCC 17029]
 gi|166216744|sp|A3PK61|QUEA_RHOS1 RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|126104049|gb|ABN76727.1| Queuosine biosynthesis protein [Rhodobacter sphaeroides ATCC 17029]
          Length = 346

 Score =  294 bits (752), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 164/356 (46%), Positives = 212/356 (59%), Gaps = 14/356 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FDFDLP   IA RP  PR +ARL++   +      I D  V DL       D +V
Sbjct: 1   MQLSDFDFDLPERLIATRPARPRTAARLLLAEGDR-----IEDRHVRDLVGIFRPGDRLV 55

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NNT+VI A+L G R       E  +  TL    +   W   A+P + +K G+ + F   
Sbjct: 56  LNNTRVIPARLTGTRTR--GEAEARVEVTLMEPAAAGGWRAMAKPLRKLKPGETIRF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
                L A V +K  T ++ LVF  +G   +  ++  G +PLPPYIA +R  DA+D  DY
Sbjct: 111 --SDALSAEVAEKGET-DLRLVFDRAGAAFDAALAEAGAMPLPPYIAARRAPDAQDDEDY 167

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT +A+  G+VAAPTA LHF   LL  L +  +    VTLHVGAGTF+PVKVED   H M
Sbjct: 168 QTVFARHAGAVAAPTASLHFDRPLLEALAARSVGFTEVTLHVGAGTFLPVKVEDVTTHRM 227

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           H+E G +    A  + + K+ GGR++ VGTT+LRL+E+A    G I PW G T+IFI PG
Sbjct: 228 HAEWGEVTEAAAAEIAATKAAGGRVIPVGTTALRLIESAAAS-GAIRPWRGETDIFIYPG 286

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           YRFR  D LM+NFHLPKSTLLMLVSA  G E  + +Y HA+ H YRF+SYGD SLL
Sbjct: 287 YRFRVTDALMTNFHLPKSTLLMLVSALMGQERIRAIYDHAVRHDYRFFSYGDASLL 342


>gi|221639392|ref|YP_002525654.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Rhodobacter
           sphaeroides KD131]
 gi|254764285|sp|B9KT07|QUEA_RHOSK RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|221160173|gb|ACM01153.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Rhodobacter
           sphaeroides KD131]
          Length = 346

 Score =  293 bits (751), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 166/356 (46%), Positives = 213/356 (59%), Gaps = 14/356 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FDFDLP   IA RP  PR +ARL++   +      I D  V DL       D +V
Sbjct: 1   MQLSDFDFDLPERLIATRPARPRTAARLLLAEGDR-----IEDRHVRDLVGIFRPGDRLV 55

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NNT+VI A+L G R       E  I  TL    +   W   A+P + +K G+ + F   
Sbjct: 56  LNNTRVIPARLTGTRTR--GEAEARIEVTLMEPAAAGGWRAMAKPLRKLKPGETIRF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
                L A V +K  T ++ LVF  +G   +  ++  G +PLPPYIA +R  DA+D  DY
Sbjct: 111 --SDALSAEVAEKGET-DLRLVFDRAGAAFDAALADAGAMPLPPYIAARRAPDAQDDEDY 167

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT +A+  G+VAAPTA LHF   LL  L + G+    VTLHVGAGTF+PVKVED   H M
Sbjct: 168 QTVFARHAGAVAAPTASLHFDRPLLEALAARGVGFTEVTLHVGAGTFLPVKVEDVTTHRM 227

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           H+E G +    A  + + K+ GGR++ VGTT+LRL+E+A    G I PW G T+IFI PG
Sbjct: 228 HAEWGEVTEAAAAEIAATKAAGGRVIPVGTTALRLIESAAAS-GAIRPWRGETDIFIYPG 286

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           YRFR  D LM+NFHLPKSTLLMLVSA  G E  + +Y HA+ H YRF+SYGD SLL
Sbjct: 287 YRFRVTDALMTNFHLPKSTLLMLVSALMGQERIRAIYDHAVRHDYRFFSYGDASLL 342


>gi|313623657|gb|EFR93813.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Listeria
           innocua FSL J1-023]
          Length = 342

 Score =  293 bits (750), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 158/353 (44%), Positives = 221/353 (62%), Gaps = 17/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V++FDFDLP   IA  P+  R S+RLMV+         I D   +D+ ++LN  DA+V
Sbjct: 1   MKVEDFDFDLPEELIAQTPLLDRTSSRLMVLDKESGE---IKDQHFTDIISYLNKGDALV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+V+ A+L+G++    +     I   L  +   N+W    +P+K I+KG  + F   
Sbjct: 58  LNDTRVLPARLHGIK----DETGAHIEVLLLKQKEGNAWETLVKPAKRIRKGATITF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G   L+AT +++   G  +L FS  GI  E  +  +G +PLPPYI  +     R    Y
Sbjct: 111 -GDGALKATCLEELEHGGRILEFSYEGIFYE-VLEQLGEMPLPPYIKEQLADQDR----Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL+++ + G+++ FVTLHVG GTF PV VEDT +H M
Sbjct: 165 QTVYAKENGSAAAPTAGLHFTEELLAQISAKGVEIIFVTLHVGLGTFRPVDVEDTQNHKM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLET-ATTEDGIINPWSGFTNIFITP 299
           HSE   +   +A  +N +KS GG++V+VGTTS+R LET A+  DG +   SG+T+IFI+P
Sbjct: 225 HSEFYRLTEESADRINKIKSAGGKVVAVGTTSIRTLETIASRHDGKLIAESGWTDIFISP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           GY+F+AVD L++NFHLPKSTL+MLVSA     +    Y HA+   YRF+S+GD
Sbjct: 285 GYKFQAVDALITNFHLPKSTLIMLVSALSDRTKILAAYNHAVEQQYRFFSFGD 337


>gi|290893933|ref|ZP_06556909.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Listeria
           monocytogenes FSL J2-071]
 gi|290556471|gb|EFD90009.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Listeria
           monocytogenes FSL J2-071]
          Length = 342

 Score =  293 bits (749), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 157/353 (44%), Positives = 222/353 (62%), Gaps = 17/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V++FDFDLP   IA  P+  R S+RLMV+         I D   +D+ ++LN  DA+V
Sbjct: 1   MKVEDFDFDLPEELIAQTPLLDRTSSRLMVLDKESGD---IKDQHFTDIISYLNEGDALV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+V+ A+L+G++    +     I   L  +   N+W    +P+K I+KG  + F   
Sbjct: 58  LNDTRVLPARLHGIK----DETGAHIEVLLLKQKEGNAWETLVKPAKRIRKGATITF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G   L+AT +++   G  +L FS  GI  E  +  +G +PLPPYI  +     R    Y
Sbjct: 111 -GDGALKATCLEELEHGGRILEFSYEGIFYE-VLEQLGEMPLPPYIKEQLADQDR----Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT +LL+++ + G+++ FVTLHVG GTF PV VEDT +H M
Sbjct: 165 QTVYAKENGSAAAPTAGLHFTEDLLAKISAKGVEIIFVTLHVGLGTFRPVDVEDTANHKM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLET-ATTEDGIINPWSGFTNIFITP 299
           HSE   +   +A+ +N +K++GG++V+VGTTS+R LET A+  DG +   SG+T IFI+P
Sbjct: 225 HSEFYRLTEESAERINKIKAQGGKVVAVGTTSIRTLETIASRHDGKLVAESGWTEIFISP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           GY F+AVD L++NFHLPKSTL+MLVSA     +    Y HA+   YRF+S+GD
Sbjct: 285 GYTFQAVDALITNFHLPKSTLIMLVSALSDRTKILAAYNHAVEQQYRFFSFGD 337


>gi|16800634|ref|NP_470902.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Listeria
           innocua Clip11262]
 gi|21263888|sp|Q92BI3|QUEA_LISIN RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|16414053|emb|CAC96797.1| lin1566 [Listeria innocua Clip11262]
 gi|313618792|gb|EFR90688.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Listeria
           innocua FSL S4-378]
          Length = 342

 Score =  292 bits (748), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 158/353 (44%), Positives = 220/353 (62%), Gaps = 17/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V++FDFDLP   IA  P+  R S+RLMV+         I D   +D+ ++LN  DA+V
Sbjct: 1   MKVEDFDFDLPEELIAQTPLLDRTSSRLMVLDKESGE---IKDQHFTDIISYLNKGDALV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+V+ A+L+G++    +     I   L  +   N+W    +P+K I+KG  + F   
Sbjct: 58  LNDTRVLPARLHGIK----DETGAHIEVLLLKQKEGNAWETLVKPAKRIRKGATITF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G   L+AT +++   G  +L FS  GI  E  +  +G +PLPPYI  +     R    Y
Sbjct: 111 -GDGALKATCLEELEHGGRILEFSYEGIFYEV-LEQLGEMPLPPYIKEQLADQDR----Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL+++ + G+++ FVTLHVG GTF PV VEDT +H M
Sbjct: 165 QTVYAKENGSAAAPTAGLHFTEELLAQISAKGVEIIFVTLHVGLGTFRPVDVEDTQNHKM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLET-ATTEDGIINPWSGFTNIFITP 299
           HSE   +   +A  +N +KS GG++V+VGTTS+R LET A+  DG +   SG+T+IFI+P
Sbjct: 225 HSEFYRLTEESADRINKIKSAGGKVVAVGTTSIRTLETIASRHDGKLIAESGWTDIFISP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           GY F+AVD L++NFHLPKSTL+MLVSA     +    Y HA+   YRF+S+GD
Sbjct: 285 GYEFQAVDALITNFHLPKSTLIMLVSALSDRTKILAAYNHAVEQQYRFFSFGD 337


>gi|260427502|ref|ZP_05781481.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Citreicella
           sp. SE45]
 gi|260421994|gb|EEX15245.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Citreicella
           sp. SE45]
          Length = 349

 Score =  292 bits (748), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 164/358 (45%), Positives = 225/358 (62%), Gaps = 13/358 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FDFDLP + IA RP  PR SARL+V   +      ++D +V DL  +L   D +V
Sbjct: 1   MKLSDFDFDLPEALIATRPANPRSSARLLVADGD-----TLTDAVVRDLTQWLRPGDRLV 55

Query: 61  FNNTKVITAQLNGVRFCHINR--REKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFF 118
            N+TKVI A+L+G R     +     +I  TL    +   W+   +P K +++G+ + F 
Sbjct: 56  LNDTKVIPARLSGTRERDGAQGLTRAQIEVTLLEPRADGCWAALVKPLKKLREGETVVF- 114

Query: 119 SQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYV 178
                S   + V++  + G+ LL F++ G + +  ++  G +PLPPYIA +R  DA+D  
Sbjct: 115 -----SDALSAVLESRDEGQGLLRFNLVGEDFDAALAEAGAMPLPPYIAARRAADAQDKQ 169

Query: 179 DYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDH 238
           DYQT +A+ +G+VAAPTA LHF   LL  L + G+    VTLHVGAGTF+PVKVED   H
Sbjct: 170 DYQTVWAERKGAVAAPTASLHFDEPLLESLRAHGVAFTKVTLHVGAGTFLPVKVEDVTTH 229

Query: 239 IMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFIT 298
            MH E G +    A  + + K+ GGR++ VGTT+LRLLETA  + G I PW G T+IFI 
Sbjct: 230 RMHGEWGEVSDSAAAEIAATKAAGGRVIPVGTTALRLLETAARDTGAIAPWQGVTDIFIY 289

Query: 299 PGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           PG+ FR  D LM+NFHLPKSTL+MLVSA  G E  K++Y HAI+  YRF+SYGD+SLL
Sbjct: 290 PGFTFRVTDALMTNFHLPKSTLMMLVSALMGQERMKRIYDHAITERYRFFSYGDSSLL 347


>gi|16803571|ref|NP_465056.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Listeria
           monocytogenes EGD-e]
 gi|47097028|ref|ZP_00234601.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Listeria
           monocytogenes str. 1/2a F6854]
 gi|224499808|ref|ZP_03668157.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Listeria
           monocytogenes Finland 1988]
 gi|224501529|ref|ZP_03669836.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Listeria
           monocytogenes FSL R2-561]
 gi|254828235|ref|ZP_05232922.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Listeria
           monocytogenes FSL N3-165]
 gi|254829710|ref|ZP_05234365.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Listeria
           monocytogenes 10403S]
 gi|254898303|ref|ZP_05258227.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Listeria
           monocytogenes J0161]
 gi|254912205|ref|ZP_05262217.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Listeria
           monocytogenes J2818]
 gi|254936533|ref|ZP_05268230.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Listeria
           monocytogenes F6900]
 gi|21263872|sp|Q8Y6Z9|QUEA_LISMO RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|16410960|emb|CAC99609.1| lmo1531 [Listeria monocytogenes EGD-e]
 gi|47014610|gb|EAL05570.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Listeria
           monocytogenes str. 1/2a F6854]
 gi|258600623|gb|EEW13948.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Listeria
           monocytogenes FSL N3-165]
 gi|258609127|gb|EEW21735.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Listeria
           monocytogenes F6900]
 gi|293590178|gb|EFF98512.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Listeria
           monocytogenes J2818]
          Length = 342

 Score =  292 bits (747), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 157/353 (44%), Positives = 221/353 (62%), Gaps = 17/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V++FDFDLP   IA  P+  R S+RLMV+         I D   +D+ ++LN  DA+V
Sbjct: 1   MKVEDFDFDLPEELIAQTPLLDRTSSRLMVLDKESGD---IKDQHFTDIISYLNEGDALV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+V+ A+L+G++    +     I   L  +   N+W    +P+K I+KG  + F   
Sbjct: 58  LNDTRVLPARLHGIK----DETGAHIEVLLLKQKEGNAWETLVKPAKRIRKGATITF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G   L+AT +++   G  +L FS  GI  E  +  +G +PLPPYI  +     R    Y
Sbjct: 111 -GDGALKATCLEELEHGGRILEFSYEGIFYE-VLEQLGEMPLPPYIKEQLADQDR----Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT +LL ++ + G+++ FVTLHVG GTF PV VEDT +H M
Sbjct: 165 QTVYAKENGSAAAPTAGLHFTEDLLEQISAKGVEIIFVTLHVGLGTFRPVDVEDTTNHKM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLET-ATTEDGIINPWSGFTNIFITP 299
           HSE   +   +A+ +N +K++GG++V+VGTTS+R LET A+  DG +   SG+T IFI+P
Sbjct: 225 HSEFYRLTEESAERINKIKAQGGKVVAVGTTSIRTLETIASRHDGKLVAESGWTEIFISP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           GY F+AVD L++NFHLPKSTL+MLVSA     +    Y HA+   YRF+S+GD
Sbjct: 285 GYTFQAVDALITNFHLPKSTLIMLVSALSDRTKILAAYNHAVEEQYRFFSFGD 337


>gi|284801921|ref|YP_003413786.1| hypothetical protein LM5578_1676 [Listeria monocytogenes 08-5578]
 gi|284995063|ref|YP_003416831.1| hypothetical protein LM5923_1628 [Listeria monocytogenes 08-5923]
 gi|284057483|gb|ADB68424.1| hypothetical protein LM5578_1676 [Listeria monocytogenes 08-5578]
 gi|284060530|gb|ADB71469.1| hypothetical protein LM5923_1628 [Listeria monocytogenes 08-5923]
          Length = 342

 Score =  291 bits (746), Expect = 8e-77,   Method: Compositional matrix adjust.
 Identities = 157/353 (44%), Positives = 221/353 (62%), Gaps = 17/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V++FDFDLP   IA  P+  R S+RLMV+         I D   +D+ ++LN  DA+V
Sbjct: 1   MKVEDFDFDLPEELIAQTPLLDRTSSRLMVLDKESGD---IKDQHFTDIISYLNEGDALV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+V+ A+L+G++    +     I   L  +   N+W    +P+K I+KG  + F   
Sbjct: 58  LNDTRVLPARLHGIK----DETGAHIEVLLLKQKEGNAWETLVKPAKRIRKGATITF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G   L+AT +++   G  +L FS  GI  E  +  +G +PLPPYI  +     R    Y
Sbjct: 111 -GDGALKATCLEELEHGGRILEFSYEGIFYE-VLEQLGEMPLPPYIKEQLADQDR----Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT +LL ++ + G+++ FVTLHVG GTF PV VEDT +H M
Sbjct: 165 QTVYAKENGSAAAPTAGLHFTEDLLEQISAKGVEIIFVTLHVGLGTFRPVDVEDTTNHKM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLET-ATTEDGIINPWSGFTNIFITP 299
           HSE   +   +A+ +N +K++GG++V+VGTTS+R LET A+  DG +   SG+T IFI+P
Sbjct: 225 HSEFYRLTEESAERINKIKAQGGKVVAVGTTSIRTLETIASRHDGKLVAESGWTEIFISP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           GY F+AVD L++NFHLPKSTL+MLVSA     +    Y HA+   YRF+S+GD
Sbjct: 285 GYTFQAVDALITNFHLPKSTLIMLVSALSDRTKILAAYNHAVGEQYRFFSFGD 337


>gi|217964322|ref|YP_002350000.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Listeria
           monocytogenes HCC23]
 gi|254764281|sp|B8DHL7|QUEA_LISMH RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|217333592|gb|ACK39386.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Listeria
           monocytogenes HCC23]
 gi|307571112|emb|CAR84291.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Listeria
           monocytogenes L99]
          Length = 342

 Score =  291 bits (746), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 157/353 (44%), Positives = 221/353 (62%), Gaps = 17/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V++FDFDLP   IA  P+  R S+RLMV+         I D   +D+ ++LN  DA+V
Sbjct: 1   MKVEDFDFDLPEELIAQTPLLDRTSSRLMVLDKESGD---IKDQHFTDIISYLNEGDALV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+V+ A+L+G++    +     I   L  +   N+W    +P+K I+KG  + F   
Sbjct: 58  LNDTRVLPARLHGIK----DETGAHIEVLLLKQKEGNAWETLVKPAKRIRKGATITF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G   L+AT +++   G  +L FS  GI  E  +  +G +PLPPYI  +     R    Y
Sbjct: 111 -GDGALKATCLEELEHGGRILEFSYEGIFYE-VLEQLGEMPLPPYIKEQLADQDR----Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT +LL+++ + G+++ FVTLHVG GTF PV VEDT +H M
Sbjct: 165 QTVYAKENGSAAAPTAGLHFTEDLLAKISAKGVEIIFVTLHVGLGTFRPVDVEDTANHKM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLET-ATTEDGIINPWSGFTNIFITP 299
           HSE   +   +A+ +N +K +GG++V+VGTTS+R LET A+  DG +   SG+T IFI+P
Sbjct: 225 HSEFYRLTEESAERINKIKVQGGKVVAVGTTSIRTLETIASRHDGKLVAESGWTEIFISP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           GY F+AVD L++NFHLPKSTL+MLVSA     +    Y HA+   YRF+S+GD
Sbjct: 285 GYTFQAVDALITNFHLPKSTLIMLVSALSDRTKILAAYNHAVEQQYRFFSFGD 337


>gi|315282447|ref|ZP_07870859.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Listeria
           marthii FSL S4-120]
 gi|313613910|gb|EFR87642.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Listeria
           marthii FSL S4-120]
          Length = 342

 Score =  290 bits (743), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 156/353 (44%), Positives = 221/353 (62%), Gaps = 17/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V++FDFDLP   IA  P+  R S+RLMV+         I D   +D+ ++LN  DA+V
Sbjct: 1   MKVEDFDFDLPEELIAQTPLLDRTSSRLMVLDKESGE---IKDQHFTDIISYLNEGDALV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+V+ A+L+G++    +     I   L  +   N+W    +P+K I+KG  + F   
Sbjct: 58  LNDTRVLPARLHGIK----DETGAHIEVLLLKQKEGNAWETLVKPAKRIRKGATITF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G   L+AT +++   G  +L F+  GI  E  +  +G +PLPPYI  +     R    Y
Sbjct: 111 -GDGALKATCLEELEHGGRILEFTYEGIFYE-VLEQLGEMPLPPYIKEQLADQDR----Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT +LL+++ + G+++ FVTLHVG GTF PV VEDT +H M
Sbjct: 165 QTVYAKENGSAAAPTAGLHFTEDLLAKISAKGVEIIFVTLHVGLGTFRPVDVEDTTNHKM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLET-ATTEDGIINPWSGFTNIFITP 299
           HSE   +   +A  +N +K++GG++V+VGTTS+R LET A+  DG +   SG+T IFI+P
Sbjct: 225 HSEFYRLTEESAARINQIKAQGGKVVAVGTTSIRTLETIASRHDGKLVAESGWTEIFISP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           GY F+AVD L++NFHLPKSTL+MLVSA     +    Y HA+   YRF+S+GD
Sbjct: 285 GYTFQAVDALITNFHLPKSTLIMLVSALSDRTKILAAYNHAVEEQYRFFSFGD 337


>gi|254852155|ref|ZP_05241503.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Listeria
           monocytogenes FSL R2-503]
 gi|254931466|ref|ZP_05264825.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Listeria
           monocytogenes HPB2262]
 gi|300764802|ref|ZP_07074792.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Listeria
           monocytogenes FSL N1-017]
 gi|258605458|gb|EEW18066.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Listeria
           monocytogenes FSL R2-503]
 gi|293583018|gb|EFF95050.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Listeria
           monocytogenes HPB2262]
 gi|300514478|gb|EFK41535.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Listeria
           monocytogenes FSL N1-017]
 gi|328465567|gb|EGF36796.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Listeria
           monocytogenes 1816]
 gi|328474891|gb|EGF45691.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Listeria
           monocytogenes 220]
          Length = 342

 Score =  290 bits (743), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 156/353 (44%), Positives = 221/353 (62%), Gaps = 17/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V++FDFDLP   IA  P+  R S+RLMV+         I D   +D+ ++LN  DA+V
Sbjct: 1   MKVEDFDFDLPEELIAQTPLLDRTSSRLMVLDKKSGD---IKDQHFTDIISYLNEGDALV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+V+ A+L+G++    +     I   L  +   N+W    +P+K I+KG  + F   
Sbjct: 58  LNDTRVLPARLHGIK----DETGAHIEVLLLKQKEGNAWETLVKPAKRIRKGATITF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G   L+A  +++   G  +L FS  GI  E  +  +G +PLPPYI  +     R    Y
Sbjct: 111 -GDGALKAICLEELEHGGRILEFSYEGIFYE-VLEQLGEMPLPPYIKEQLADQDR----Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT +LL+++ + G+++ FVTLHVG GTF PV VEDT +H M
Sbjct: 165 QTVYAKENGSAAAPTAGLHFTEDLLAKISAKGVEIIFVTLHVGLGTFRPVDVEDTTNHKM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLET-ATTEDGIINPWSGFTNIFITP 299
           HSE   +   +A+ +N +K++GG++V+VGTTS+R LET A+  DG +   SG+T IFI+P
Sbjct: 225 HSEFYRLTEESAERINKIKAQGGKVVAVGTTSIRTLETIASRHDGKLVAESGWTEIFISP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           GY F+AVD L++NFHLPKSTL+MLVSA     +    Y HA+   YRF+S+GD
Sbjct: 285 GYTFQAVDALITNFHLPKSTLIMLVSALSDRTKILAAYNHAVEEQYRFFSFGD 337


>gi|254518553|ref|ZP_05130609.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           sp. 7_2_43FAA]
 gi|226912302|gb|EEH97503.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           sp. 7_2_43FAA]
          Length = 342

 Score =  290 bits (742), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 153/356 (42%), Positives = 211/356 (59%), Gaps = 16/356 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V +FDFDLP   IA  P+  RDS+RLMV+  N      I      D+  +LN  D +V
Sbjct: 1   MKVSDFDFDLPEELIAQHPLEKRDSSRLMVLDKNTG---EIEHKSFHDVIEYLNEGDTLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NNT+V+ A+L G +     +    I   L  R+  + W   A+P K  K G    F   
Sbjct: 58  LNNTRVMPARLIGEKEGTGGK----IEFLLLKRIEGDRWECLAKPGKRAKVGQKFTF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G+ +L  TV+D    G  ++ FS  GI  E+ +  +G +PLPPYI  K     R    Y
Sbjct: 111 -GEGKLICTVVDIVEEGNRIIEFSYEGI-FEQVLDELGEMPLPPYITEKLEDKER----Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT Y+K +GS AAPTAGLHFT  LL  + + G+ + ++TLHVG GTF PVKVED ++HIM
Sbjct: 165 QTVYSKEKGSAAAPTAGLHFTEELLKEIKAKGVNIAYLTLHVGLGTFRPVKVEDINEHIM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   +D   A  +N  K RG ++++VGTTS R LET   ++G +   SG+T+IFI PG
Sbjct: 225 HSEYYHLDNENADLINETKKRGNKVIAVGTTSTRTLETIGDDNGFVREQSGWTDIFIYPG 284

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           Y+++ +D L++NFHLP+STL+MLVSA  G E     Y  A+   YRF+S+GD+ L+
Sbjct: 285 YKYKVIDELITNFHLPESTLIMLVSALAGKEHVMNAYNEAVKEKYRFFSFGDSMLI 340


>gi|226224132|ref|YP_002758239.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Listeria
           monocytogenes Clip81459]
 gi|254824410|ref|ZP_05229411.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Listeria
           monocytogenes FSL J1-194]
 gi|254992899|ref|ZP_05275089.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Listeria
           monocytogenes FSL J2-064]
 gi|255520699|ref|ZP_05387936.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Listeria
           monocytogenes FSL J1-175]
 gi|259551458|sp|C1KVH8|QUEA_LISMC RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|225876594|emb|CAS05303.1| Putative S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Listeria monocytogenes serotype 4b str. CLIP 80459]
 gi|293593645|gb|EFG01406.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Listeria
           monocytogenes FSL J1-194]
          Length = 342

 Score =  290 bits (742), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 156/353 (44%), Positives = 221/353 (62%), Gaps = 17/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V++FDFDLP   IA  P+  R S+RLMV+         I D   +D+ ++LN  DA+V
Sbjct: 1   MKVEDFDFDLPEELIAQTPLLDRTSSRLMVLDKKSGD---IKDQHFTDIISYLNEGDALV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+V+ A+L+G++    +     I   L  +   N+W    +P+K I+KG  + F   
Sbjct: 58  LNDTRVLPARLHGIK----DETGAHIEVLLLKQKEGNAWETLVKPAKRIRKGATITF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G   L+A  +++   G  +L FS  GI  E  +  +G +PLPPYI  +     R    Y
Sbjct: 111 -GDGALKAICLEELEHGGRILEFSYEGIFYE-VLEQLGEMPLPPYIKEQLADQDR----Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT +LL+++ + G+++ FVTLHVG GTF PV VEDT +H M
Sbjct: 165 QTVYAKENGSAAAPTAGLHFTEDLLAKISAKGVEIIFVTLHVGLGTFRPVDVEDTANHKM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLET-ATTEDGIINPWSGFTNIFITP 299
           HSE   +   +A+ +N +K++GG++V+VGTTS+R LET A+  DG +   SG+T IFI+P
Sbjct: 225 HSEFYRLTEESAERINKIKAQGGKVVAVGTTSIRTLETIASRHDGKLVAESGWTEIFISP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           GY F+AVD L++NFHLPKSTL+MLVSA     +    Y HA+   YRF+S+GD
Sbjct: 285 GYTFQAVDALITNFHLPKSTLIMLVSALSDRTKILAAYNHAVEEQYRFFSFGD 337


>gi|223933305|ref|ZP_03625294.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Streptococcus suis 89/1591]
 gi|330832602|ref|YP_004401427.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Streptococcus suis ST3]
 gi|223898035|gb|EEF64407.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Streptococcus suis 89/1591]
 gi|329306825|gb|AEB81241.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Streptococcus suis ST3]
          Length = 342

 Score =  290 bits (741), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 166/355 (46%), Positives = 216/355 (60%), Gaps = 21/355 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVIS--DHLVSDLPAFLNSNDA 58
           M   +FDFDLP   IA  P+  RDS++L+++       +V S  DH++  L    N  DA
Sbjct: 1   MNTADFDFDLPEELIAQVPLEKRDSSKLLILDREKQS-MVDSHFDHIIDQL----NPGDA 55

Query: 59  IVFNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFF 118
           +V NNT+V+ A+L G +   +      +   L      N W V A+P+K +K G  + F 
Sbjct: 56  LVMNNTRVLPARLYGYKPETMGH----VELLLLKNTQGNQWEVLAKPAKRLKVGTTVAF- 110

Query: 119 SQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYV 178
              G  RL AT++++   G  ++ FS  GI LE   SL G +PLPPYI  K      D  
Sbjct: 111 ---GDGRLTATIVEELEHGGRIVEFSYEGIFLEVLESL-GEMPLPPYIHEK----LEDRE 162

Query: 179 DYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDH 238
            YQT YAK  GS AAPTAGLHFT  LL ++ + G+K+ ++TLHVG GTF PV V++ D+H
Sbjct: 163 RYQTVYAKENGSAAAPTAGLHFTQELLEKIEAKGVKLVYLTLHVGLGTFRPVSVDNVDEH 222

Query: 239 IMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFI 297
            MHSE   + A  AQ LN VK  GGRIV+VGTTS+R LET   + DG +   SG+TNIFI
Sbjct: 223 EMHSEFYNLSAEAAQTLNQVKDSGGRIVAVGTTSIRTLETIGNKFDGRLEADSGWTNIFI 282

Query: 298 TPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
            PGY FR VD   +NFHLPKSTL+MLVSAF G E T   Y+HA+   YRF+S+GD
Sbjct: 283 KPGYTFRIVDAFSTNFHLPKSTLVMLVSAFAGREFTLDAYKHAVEERYRFFSFGD 337


>gi|51892303|ref|YP_074994.1| S-adenosylmethionine:tRNA-ribosyltransferase- isomerase
           [Symbiobacterium thermophilum IAM 14863]
 gi|81610582|sp|Q67Q93|QUEA_SYMTH RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|51855992|dbj|BAD40150.1| S-adenosylmethionine:tRNA-ribosyltransferase- isomerase
           [Symbiobacterium thermophilum IAM 14863]
          Length = 341

 Score =  290 bits (741), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 155/357 (43%), Positives = 213/357 (59%), Gaps = 16/357 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FD+DLP   IA +PV PRD++RLMVVH        I      DLP +L   D +V
Sbjct: 1   MRLSDFDYDLPKELIAQKPVEPRDASRLMVVH---RASGAIEHRCFRDLPEYLRPGDGLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N T+V+ A+L G R     +    +   L  R+  + W    +P K  + G+ + F   
Sbjct: 58  INETRVMPARLLGSR----EQTGGAMEVLLLKRLDRDRWETLVKPGKKARPGERIVF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G   L  TV+   + G  ++ F   G+  E  +  +G +PLPPYI  +     R    Y
Sbjct: 111 -GDGLLVGTVVGPTDYGGRVIDFHYEGV-FENLLERLGQMPLPPYIHEQLEEPER----Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YA+  GS AAPTAGLHFT+ LL RL + G++++ +TLHVG GTF PV+VED   H M
Sbjct: 165 QTVYAREWGSAAAPTAGLHFTAELLDRLAARGVEIHRITLHVGLGTFRPVEVEDPTQHKM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   +    A  +N+V+  GGR+V+VGTTS+R LET   EDG + P  G+T+IFI PG
Sbjct: 225 HSEFYHVSPEAAAGINAVRKGGGRLVAVGTTSVRTLETVADEDGTVRPGEGWTDIFIYPG 284

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           YRF+AVD L++NFHLPKSTLLMLVSA  G +   + Y+ A++  YRF+S+GD  L+ 
Sbjct: 285 YRFKAVDALVTNFHLPKSTLLMLVSALAGHDLIMRAYREAVAQRYRFFSFGDAMLIL 341


>gi|222153368|ref|YP_002562545.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus uberis 0140J]
 gi|222114181|emb|CAR42709.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus uberis 0140J]
          Length = 342

 Score =  289 bits (740), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 163/353 (46%), Positives = 214/353 (60%), Gaps = 17/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +FDFDLP   IA  P+  RDS+RL+++         ++D     +   LN  DA+V
Sbjct: 1   MHTNDFDFDLPEELIAQTPLEKRDSSRLLIIDHQTKE---MTDSHFDQIVDQLNPGDALV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NNT+V+ A+L+G +          +   L      + W V A+P+K +K G  + F   
Sbjct: 58  MNNTRVLPARLHGEK----PDTHGHVELLLLKNTKEDQWEVLAKPAKRLKVGSKVSF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL ATVI++ + G  ++ FS SGI LE   SL G +PLPPYI  K     R    Y
Sbjct: 111 -GDGRLTATVIEELDHGGRIVEFSYSGIFLEVLESL-GEMPLPPYIHEKLEDSER----Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL ++   G+ + ++TLHVG GTF PV V+  D+H M
Sbjct: 165 QTVYAKENGSAAAPTAGLHFTEALLKKIKDKGVHLVYLTLHVGLGTFRPVSVDSVDEHEM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           HSE   +    AQ L  VK+ GGR+V+VGTTS+R LET  T+ DG I   SG+TNIFI P
Sbjct: 225 HSEFYHLSEEAAQTLRQVKANGGRLVAVGTTSIRTLETIGTKFDGDIQADSGWTNIFIKP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           GY+F+ VD   +NFHLPKSTL+MLVSAF G E   + YQHA++  YRF+S+GD
Sbjct: 285 GYQFKVVDAFSTNFHLPKSTLVMLVSAFAGREFVLEAYQHAVNEKYRFFSFGD 337


>gi|46907759|ref|YP_014148.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Listeria
           monocytogenes str. 4b F2365]
 gi|67460874|sp|Q71ZD9|QUEA_LISMF RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|46881028|gb|AAT04325.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Listeria
           monocytogenes serotype 4b str. F2365]
          Length = 342

 Score =  289 bits (739), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 155/353 (43%), Positives = 220/353 (62%), Gaps = 17/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V++FDFDLP   IA  P+  R S+RLMV+         I D   +D+ ++LN  DA+V
Sbjct: 1   MKVEDFDFDLPEELIAQTPLLDRTSSRLMVLDKKSGD---IKDQHFTDIISYLNEGDALV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+V+ A+L+G++    +     I   L  +   N+W    +P+K I+KG  + F   
Sbjct: 58  LNDTRVLPARLHGIK----DETGAHIEVLLLKQKEGNAWETLVKPAKRIRKGATITF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G   L+A  +++   G  +L FS  GI  E  +  +G +PLPPYI  +     R    Y
Sbjct: 111 -GDGALKAICLEELEHGGRILEFSYEGIFYE-VLEQLGEMPLPPYIKEQLADQDR----Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT Y K  GS AAPTAGLHFT +LL+++ + G+++ FVTLHVG GTF PV VEDT +H M
Sbjct: 165 QTVYGKENGSAAAPTAGLHFTEDLLAKISAKGVEIIFVTLHVGLGTFRPVDVEDTTNHKM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLET-ATTEDGIINPWSGFTNIFITP 299
           HSE   +   +A+ +N +K++GG++V+VGTTS+R LET A+  DG +   SG+T IFI+P
Sbjct: 225 HSEFYRLTEESAERINKIKAQGGKVVAVGTTSIRTLETIASRHDGKLVAESGWTEIFISP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           GY F+AVD L++NFHLPKSTL+MLVSA     +    Y HA+   YRF+S+GD
Sbjct: 285 GYTFQAVDALITNFHLPKSTLIMLVSALSDRTKILAAYNHAVEEQYRFFSFGD 337


>gi|266622484|ref|ZP_06115419.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           hathewayi DSM 13479]
 gi|288865792|gb|EFC98090.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           hathewayi DSM 13479]
          Length = 365

 Score =  288 bits (738), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 155/352 (44%), Positives = 213/352 (60%), Gaps = 16/352 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M VK+F+F+LP   IA  P+  R S+RL+V+         I      D+ ++L   D +V
Sbjct: 1   MNVKDFNFELPQELIAQDPLEDRSSSRLLVLDKKTG---EIEHRTFRDILSYLRKGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+TKVI A+L GV+       E +I   L  R   + W    +P K  K G ++ F   
Sbjct: 58  INDTKVIPARLFGVK----EGTEAKIEILLLKRRENDIWETLVKPGKKAKIGTVITF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G+  L  TV+D  + G  L+ FS  GI  E  +  +G +PLPPYI  +     +D   Y
Sbjct: 111 -GEGLLTGTVVDIVDEGNRLIQFSYEGI-FEEILDRLGQMPLPPYITHQ----LKDQTRY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK +GS AAPTAGLHFT  LL+ + ++G+ +  VTLHVG GTF PVKV++ +DH M
Sbjct: 165 QTVYAKHEGSAAAPTAGLHFTKELLAEIEAMGVVIAHVTLHVGLGTFRPVKVDEIEDHHM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   +D   A+ +N  K  GGRIV VGTTS R +E+A+++DG++   SG+T IFI PG
Sbjct: 225 HSEFYIVDEAEAKKVNDTKKNGGRIVCVGTTSCRTVESASSDDGVLKAGSGWTEIFIYPG 284

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           YRF+ +D L++NFHLP+STL+MLVSA  G E     Y+ AI   YRF+S+GD
Sbjct: 285 YRFKTLDCLITNFHLPESTLVMLVSALAGREHVLNAYEEAIRERYRFFSFGD 336


>gi|254476236|ref|ZP_05089622.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Ruegeria
           sp. R11]
 gi|214030479|gb|EEB71314.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Ruegeria
           sp. R11]
          Length = 353

 Score =  288 bits (738), Expect = 8e-76,   Method: Compositional matrix adjust.
 Identities = 161/344 (46%), Positives = 216/344 (62%), Gaps = 14/344 (4%)

Query: 15  IALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIVFNNTKVITAQLNGV 74
           IA RP  PR SARL+V   +      ISD  V+DL  +L   D +V N+TKVI A+L+G 
Sbjct: 15  IATRPAVPRTSARLLVAEADQ-----ISDATVADLGQWLRPGDRLVLNDTKVIPARLSGQ 69

Query: 75  RFCHINR--REKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQDGQSRLEATVID 132
           R     +     ++  TL    +  SWS   +P K +K G+ +  FS    +RL     D
Sbjct: 70  RHRDTAQGPMAAKVEVTLLEPGADGSWSALLKPLKKVKLGEEI-IFSDQLSARL-----D 123

Query: 133 KWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDYQTTYAKIQGSVA 192
           +   G+  L F++SG + +  ++  G +PLPPYIA KR  D +D  DYQT +A+  G+VA
Sbjct: 124 RVEDGQGYLAFNLSGDDFDTALAEAGAMPLPPYIAAKRAADEQDKTDYQTVWARNSGAVA 183

Query: 193 APTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIMHSEIGFIDAPTA 252
           APTA LHF   LL++L  +G+   +VTLHVGAGTF+PVKVED   H MHSE G + A  A
Sbjct: 184 APTASLHFDETLLAQLREMGVSFSYVTLHVGAGTFLPVKVEDVTTHKMHSEWGRVSADAA 243

Query: 253 QALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPGYRFRAVDILMSN 312
             + + K+ GGR++ VGTT+LRL+E+A    G I PW G T+IFI PG+ F   D LM+N
Sbjct: 244 AEIAATKAAGGRVIPVGTTALRLIESA-ARSGAIEPWEGDTDIFIYPGFTFNVADALMTN 302

Query: 313 FHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           FHLPKSTL+MLVSA  G E  +++Y+HA+S  YRF+SYGD SLL
Sbjct: 303 FHLPKSTLMMLVSALMGQERIREIYEHAVSQRYRFFSYGDASLL 346


>gi|315303291|ref|ZP_07873926.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Listeria
           ivanovii FSL F6-596]
 gi|313628338|gb|EFR96836.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Listeria
           ivanovii FSL F6-596]
          Length = 342

 Score =  288 bits (737), Expect = 8e-76,   Method: Compositional matrix adjust.
 Identities = 156/353 (44%), Positives = 219/353 (62%), Gaps = 17/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V++FDFDLP   IA  P+  R S+RLMV+         I D   +D+ ++L+  DA+V
Sbjct: 1   MKVEDFDFDLPEELIAQTPLLDRTSSRLMVLDKATGE---IKDQHFTDILSYLHEGDALV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+V+ A+L+G++    +     I   L  +   N+W    +P+K I++G  + F   
Sbjct: 58  LNDTRVLPARLHGIK----DETGAHIEVLLLKQKEGNTWEALVKPAKRIRQGATITF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G   L+AT +++   G  +L FS  GI  E  +  +G +PLPPYI  +     R    Y
Sbjct: 111 -GDGALQATCLEELEHGGRILEFSYEGIFYE-VLEQLGEMPLPPYIKEQLADQDR----Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT +LL+++   G+++ FVTLHVG GTF PV VEDT +H M
Sbjct: 165 QTVYAKENGSAAAPTAGLHFTEDLLAKIKEKGVEIIFVTLHVGLGTFRPVDVEDTTNHKM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLET-ATTEDGIINPWSGFTNIFITP 299
           HSE   +    A+ +N VK  GG++++VGTTS+R LET A+  +G I   SG+T+IFI+P
Sbjct: 225 HSEFYRLTEEAAERINRVKETGGKVIAVGTTSIRTLETIASRHEGNIVAESGWTDIFISP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           GY FRAVD L++NFHLPKSTL+MLVSA     +    Y HA+   YRF+S+GD
Sbjct: 285 GYTFRAVDALITNFHLPKSTLIMLVSALSDRNKILTAYNHAVEEQYRFFSFGD 337


>gi|83309697|ref|YP_419961.1| S-adenosylmethionine tRNA-ribosyltransferase-isomerase
           [Magnetospirillum magneticum AMB-1]
 gi|82944538|dbj|BAE49402.1| S-adenosylmethionine tRNA-ribosyltransferase-isomerase
           [Magnetospirillum magneticum AMB-1]
          Length = 291

 Score =  288 bits (737), Expect = 8e-76,   Method: Compositional matrix adjust.
 Identities = 153/298 (51%), Positives = 198/298 (66%), Gaps = 12/298 (4%)

Query: 59  IVFNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFF 118
           +VFN+TKVI A+L G       R    +  TLH R   + W  +ARP+K +K GD + F 
Sbjct: 1   MVFNDTKVIPARLLG------RRGLAGVELTLHQRTGLSQWKAFARPAKKLKPGDRVDF- 53

Query: 119 SQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYV 178
                    A V +K   GE+ L F  SG +L   +   G +PLPPYI R+   D RD  
Sbjct: 54  ----AEGFSAVVAEKGEMGEVTLDFDRSGEDLMVALETHGHLPLPPYI-RQGTADERDKG 108

Query: 179 DYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDH 238
           DYQT +A+ +G+VAAPTAGLHFT  LL+ L + G+K   VTLHVGAGTF+PVKV+DTDDH
Sbjct: 109 DYQTVFAREKGAVAAPTAGLHFTPELLAALDARGVKRVTVTLHVGAGTFLPVKVDDTDDH 168

Query: 239 IMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFIT 298
            MH EIG +   TA A+N+ ++ GGR+V+VGTTS RLLE+A    G ++P+ G T+IFIT
Sbjct: 169 RMHQEIGVVTPETAAAVNAARAAGGRVVAVGTTSARLLESAADPLGTLHPFDGATDIFIT 228

Query: 299 PGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           PG+ FR VD+L++NFHLP+STL ML+SAF G+E  K  Y+HA +  YRFYSYGD  LL
Sbjct: 229 PGHVFRQVDVLLTNFHLPRSTLFMLISAFAGLERMKAAYEHAKAAGYRFYSYGDCCLL 286


>gi|303230199|ref|ZP_07316967.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Veillonella
           atypica ACS-134-V-Col7a]
 gi|302515125|gb|EFL57099.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Veillonella
           atypica ACS-134-V-Col7a]
          Length = 341

 Score =  288 bits (736), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 158/356 (44%), Positives = 216/356 (60%), Gaps = 16/356 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V +FD+DLP   IA  PV PRD++RL+ +   ++       H   DL   L + D +V
Sbjct: 1   MKVTDFDYDLPEELIAQHPVEPRDTSRLLTLD-KITGEYTHKAHFY-DLLDELQAGDVLV 58

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FNNTKVI A+L G R         ++   L      N W    +P K    G ++ F   
Sbjct: 59  FNNTKVIPARLYGQR----EGSGGKVEVLLLTPCGENRWECLVKPGKKCPIGQVIVF--- 111

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
               RL+ATV+DK + G  ++ F+  G+  +  I  +G +PLPPYI  K      D   Y
Sbjct: 112 --DERLKATVLDKTDFGGRIVEFTCDGV-FDDIIQEIGEMPLPPYIHEK----LEDKDRY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK +GS AAPTAGLHFT  LL ++ + G+++ FVTLHVG GTF PV VE  +DH M
Sbjct: 165 QTVYAKEKGSAAAPTAGLHFTPELLEKIKAKGVELEFVTLHVGLGTFRPVSVETIEDHDM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   +   TA+ +N  KS+G RI++VGTTS+R LE+A+T+DGI++  SG+T IFI PG
Sbjct: 225 HSEFYSVSEDTARRINEAKSKGKRIIAVGTTSIRTLESASTDDGILHATSGWTKIFIYPG 284

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           Y+F+ VD L++NFHLP+STLLML+SA  G E     Y+ A+   YRF+S+GD   +
Sbjct: 285 YKFKMVDALVTNFHLPQSTLLMLISALAGREHCLAAYKAAVKERYRFFSFGDAMFI 340


>gi|154483721|ref|ZP_02026169.1| hypothetical protein EUBVEN_01425 [Eubacterium ventriosum ATCC
           27560]
 gi|149735631|gb|EDM51517.1| hypothetical protein EUBVEN_01425 [Eubacterium ventriosum ATCC
           27560]
          Length = 380

 Score =  288 bits (736), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 156/356 (43%), Positives = 209/356 (58%), Gaps = 16/356 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + ++ +DLP   IA  P+  R S+RLMV+  +      I  H+  D+  +LN ND +V
Sbjct: 39  MSLHDYYYDLPEELIAQDPLEDRSSSRLMVLDKDTG---EIEHHIFKDIIDYLNPNDCLV 95

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+TKVI A+L G +       + +I   L  R   + W    +P K  K G ++ F   
Sbjct: 96  INDTKVIPARLYGSKVG----TDAKIEVLLLKRKENDVWETLVKPGKKCKPGTVISF--- 148

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G   L   VID    G  L+ F+  GI  E  +  +G +PLPPYI  K     R    Y
Sbjct: 149 -GDGILTGEVIDVVEEGNRLIKFTYEGI-FEEVLDKLGEMPLPPYITHKLEDKNR----Y 202

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK +GS AAPTAGLHFT  LL ++   GIK+  VTLHVG GTF PVKVE+  +H M
Sbjct: 203 QTVYAKYEGSAAAPTAGLHFTKELLEKIKEKGIKIAHVTLHVGLGTFRPVKVENILEHHM 262

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   +D   A  +N  ++ GGR+++VGTTS R LET T E+GI++  SG+T IFI PG
Sbjct: 263 HSEFYMVDEEDANMINECRANGGRVIAVGTTSTRTLETVTDENGIVHSGSGWTQIFIYPG 322

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           Y+F+A+D L++NFHLP+STLLMLVSA  G E     Y  A+   YRF+S+GD   +
Sbjct: 323 YQFKAIDCLITNFHLPESTLLMLVSALAGRENVLNAYNKAVEEKYRFFSFGDAMFI 378


>gi|303231808|ref|ZP_07318524.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Veillonella
           atypica ACS-049-V-Sch6]
 gi|302513515|gb|EFL55541.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Veillonella
           atypica ACS-049-V-Sch6]
          Length = 341

 Score =  288 bits (736), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 158/356 (44%), Positives = 216/356 (60%), Gaps = 16/356 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V +FD+DLP   IA  PV PRD++RL+ +   ++       H   DL   L + D +V
Sbjct: 1   MKVTDFDYDLPEELIAQHPVEPRDTSRLLTLD-KITGEYTHKAHFY-DLLDELQAGDVLV 58

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FNNTKVI A+L G R         ++   L      N W    +P K    G ++ F   
Sbjct: 59  FNNTKVIPARLYGQR----EGSGGKVEVLLLTPCGENRWECLVKPGKKCPIGQVIVF--- 111

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
               RL+ATV+DK + G  ++ F+  G+  +  I  +G +PLPPYI  K      D   Y
Sbjct: 112 --DDRLKATVLDKTDFGGRIVEFTCDGV-FDDIIQEIGEMPLPPYIHEK----LEDKDRY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK +GS AAPTAGLHFT  LL ++ + G+++ FVTLHVG GTF PV VE  +DH M
Sbjct: 165 QTVYAKEKGSAAAPTAGLHFTPELLEKIKAKGVELEFVTLHVGLGTFRPVSVETIEDHDM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   +   TA+ +N  KS+G RI++VGTTS+R LE+A+T+DGI++  SG+T IFI PG
Sbjct: 225 HSEFYSVSEDTARRINEAKSKGKRIIAVGTTSIRTLESASTDDGILHATSGWTKIFIYPG 284

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           Y+F+ VD L++NFHLP+STLLML+SA  G E     Y+ A+   YRF+S+GD   +
Sbjct: 285 YKFKMVDALVTNFHLPQSTLLMLISALAGREHCLAAYKAAVKERYRFFSFGDAMFI 340


>gi|304317012|ref|YP_003852157.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Thermoanaerobacterium thermosaccharolyticum DSM 571]
 gi|302778514|gb|ADL69073.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Thermoanaerobacterium thermosaccharolyticum DSM 571]
          Length = 341

 Score =  288 bits (736), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 157/356 (44%), Positives = 216/356 (60%), Gaps = 16/356 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + EF +DLP   IA  P+  RD +RLM+++        I   +  ++ ++LN ND +V
Sbjct: 1   MNLHEFYYDLPEELIAQEPLKNRDESRLMILN---RLTGEIKHDIFKNIISYLNPNDVLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+TKVI A+L GVR         +I   L  R+S + W +  +P +  K G    F   
Sbjct: 58  LNDTKVIPARLIGVR----EDTGGKIEFVLLKRLSSDEWEILVKPGRRAKIGSKFIF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G   L+A VI   + G  ++ FS  GI  E  +  +G +P+PPYI +K      D   Y
Sbjct: 111 -GNGELKAEVISNTDVGGRIVRFSYEGI-FEEVLDKLGEMPVPPYIKKK----LEDKNMY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK +GS AAPTAGLHFT+ LL  +   G+K  FVTLHVG GTF PVK E  + H M
Sbjct: 165 QTVYAKHEGSAAAPTAGLHFTNKLLDDIRKYGVKTVFVTLHVGLGTFRPVKEEVIEKHKM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   +    AQA+N+ +  GGRI+SVGTTS R LET   E+GII+  SG+T+IFI PG
Sbjct: 225 HSEFYTVTEEAAQAINTARESGGRIISVGTTSTRTLETVADENGIIHAGSGWTDIFIYPG 284

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           Y+++A+D +++NFHLP+STL+M++SAF G E     Y+ AI + YRFYS+GD  L+
Sbjct: 285 YKYKAIDGIITNFHLPESTLIMMISAFAGKENVMNAYKTAIDNKYRFYSFGDAMLI 340


>gi|146318286|ref|YP_001197998.1| S-adenosylmethionine:tRNA-ribosyltransferase-isomerase (queuine
           synthetase) [Streptococcus suis 05ZYH33]
 gi|146320479|ref|YP_001200190.1| S-adenosylmethionine:tRNA-ribosyltransferase-isomerase (queuine
           synthetase) [Streptococcus suis 98HAH33]
 gi|145689092|gb|ABP89598.1| S-adenosylmethionine:tRNA-ribosyltransferase-isomerase (queuine
           synthetase) [Streptococcus suis 05ZYH33]
 gi|145691285|gb|ABP91790.1| S-adenosylmethionine:tRNA-ribosyltransferase-isomerase (queuine
           synthetase) [Streptococcus suis 98HAH33]
 gi|292558081|gb|ADE31082.1| Queuosine biosynthesis protein [Streptococcus suis GZ1]
          Length = 344

 Score =  287 bits (735), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 165/355 (46%), Positives = 216/355 (60%), Gaps = 21/355 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVIS--DHLVSDLPAFLNSNDA 58
           M   +FDFDLP   IA  P+  RDS++L+++       +V S  DH++  L    N  DA
Sbjct: 3   MNTADFDFDLPEELIAQVPLEKRDSSKLLILDREKRS-MVDSHFDHIIDQL----NPGDA 57

Query: 59  IVFNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFF 118
           +V NNT+V+ A+L G +   +      +   L      + W V A+P+K +K G  + F 
Sbjct: 58  LVMNNTRVLPARLYGYKPETMGH----VELLLLKNTQGDQWEVLAKPAKRLKVGTTVAF- 112

Query: 119 SQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYV 178
              G  RL AT++++   G  ++ FS  GI LE   SL G +PLPPYI  K      D  
Sbjct: 113 ---GDGRLTATIVEELEHGGRIVEFSYEGIFLEVLESL-GEMPLPPYIHEK----LEDRE 164

Query: 179 DYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDH 238
            YQT YAK  GS AAPTAGLHFT  LL ++ + G+K+ ++TLHVG GTF PV V++ D+H
Sbjct: 165 RYQTVYAKENGSAAAPTAGLHFTQELLEKIEAKGVKLVYLTLHVGLGTFRPVSVDNVDEH 224

Query: 239 IMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFI 297
            MHSE   + A  AQ LN VK  GGRIV+VGTTS+R LET   + DG +   SG+TNIFI
Sbjct: 225 EMHSEFYNLSAEAAQTLNQVKDSGGRIVAVGTTSIRTLETIGNKFDGRLQADSGWTNIFI 284

Query: 298 TPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
            PGY FR VD   +NFHLPKSTL+MLVSAF G E T   Y+HA+   YRF+S+GD
Sbjct: 285 KPGYTFRIVDAFSTNFHLPKSTLVMLVSAFAGREFTLDAYKHAVEERYRFFSFGD 339


>gi|253751451|ref|YP_003024592.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus suis SC84]
 gi|253753352|ref|YP_003026493.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus suis P1/7]
 gi|253755819|ref|YP_003028959.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus suis BM407]
 gi|251815740|emb|CAZ51341.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus suis SC84]
 gi|251818283|emb|CAZ56092.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus suis BM407]
 gi|251819598|emb|CAR45300.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus suis P1/7]
 gi|319757868|gb|ADV69810.1| S-adenosylmethionine:tRNA-ribosyltransferase-isomerase (queuine
           synthetase) [Streptococcus suis JS14]
          Length = 342

 Score =  287 bits (735), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 165/355 (46%), Positives = 216/355 (60%), Gaps = 21/355 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVIS--DHLVSDLPAFLNSNDA 58
           M   +FDFDLP   IA  P+  RDS++L+++       +V S  DH++  L    N  DA
Sbjct: 1   MNTADFDFDLPEELIAQVPLEKRDSSKLLILDREKRS-MVDSHFDHIIDQL----NPGDA 55

Query: 59  IVFNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFF 118
           +V NNT+V+ A+L G +   +      +   L      + W V A+P+K +K G  + F 
Sbjct: 56  LVMNNTRVLPARLYGYKPETMGH----VELLLLKNTQGDQWEVLAKPAKRLKVGTTVAF- 110

Query: 119 SQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYV 178
              G  RL AT++++   G  ++ FS  GI LE   SL G +PLPPYI  K      D  
Sbjct: 111 ---GDGRLTATIVEELEHGGRIVEFSYEGIFLEVLESL-GEMPLPPYIHEK----LEDRE 162

Query: 179 DYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDH 238
            YQT YAK  GS AAPTAGLHFT  LL ++ + G+K+ ++TLHVG GTF PV V++ D+H
Sbjct: 163 RYQTVYAKENGSAAAPTAGLHFTQELLEKIEAKGVKLVYLTLHVGLGTFRPVSVDNVDEH 222

Query: 239 IMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFI 297
            MHSE   + A  AQ LN VK  GGRIV+VGTTS+R LET   + DG +   SG+TNIFI
Sbjct: 223 EMHSEFYNLSAEAAQTLNQVKDSGGRIVAVGTTSIRTLETIGNKFDGRLQADSGWTNIFI 282

Query: 298 TPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
            PGY FR VD   +NFHLPKSTL+MLVSAF G E T   Y+HA+   YRF+S+GD
Sbjct: 283 KPGYTFRIVDAFSTNFHLPKSTLVMLVSAFAGREFTLDAYKHAVEERYRFFSFGD 337


>gi|302023597|ref|ZP_07248808.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus suis 05HAS68]
          Length = 342

 Score =  287 bits (734), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 165/355 (46%), Positives = 215/355 (60%), Gaps = 21/355 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVIS--DHLVSDLPAFLNSNDA 58
           M   +FDFDLP   IA  P+  RDS++L+++       +V S  DH++  L    N  DA
Sbjct: 1   MNTADFDFDLPEELIAQVPLEKRDSSKLLILDREKQS-MVDSHFDHIIDQL----NPGDA 55

Query: 59  IVFNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFF 118
           +V NNT+V+ A+L G +   +      +   L      N W V A+P+K +K G  + F 
Sbjct: 56  LVMNNTRVLPARLYGYKPETMGH----VELLLLKNTQGNQWEVLAKPAKRLKVGTTVAF- 110

Query: 119 SQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYV 178
              G  RL AT++++   G  ++ FS  GI LE   SL G +PLPPYI  K      D  
Sbjct: 111 ---GDGRLTATIVEELEHGGRIVEFSYEGIFLEVLESL-GEMPLPPYIHEK----LEDRE 162

Query: 179 DYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDH 238
            YQT YAK  GS AAPTAGLHFT  LL ++ + G+K+ ++TLHVG GTF PV V++ D+H
Sbjct: 163 RYQTVYAKENGSAAAPTAGLHFTQELLEKIEAKGVKLVYLTLHVGLGTFRPVSVDNVDEH 222

Query: 239 IMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFI 297
            MHSE   + A  AQ LN VK   GRIV+VGTTS+R LET   + DG +   SG+TNIFI
Sbjct: 223 EMHSEFYNLSAEAAQTLNQVKDSSGRIVAVGTTSIRTLETIGNKFDGRLEADSGWTNIFI 282

Query: 298 TPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
            PGY FR VD   +NFHLPKSTL+MLVSAF G E T   Y+HA+   YRF+S+GD
Sbjct: 283 KPGYTFRIVDAFSTNFHLPKSTLVMLVSAFAGREFTLDAYKHAVEERYRFFSFGD 337


>gi|323485700|ref|ZP_08091037.1| hypothetical protein HMPREF9474_02788 [Clostridium symbiosum
           WAL-14163]
 gi|323400963|gb|EGA93324.1| hypothetical protein HMPREF9474_02788 [Clostridium symbiosum
           WAL-14163]
          Length = 347

 Score =  286 bits (733), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 155/359 (43%), Positives = 217/359 (60%), Gaps = 16/359 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M VK+F +DLP   IA  P+  R S+RL+V++ +      I   +  D+ ++L   D +V
Sbjct: 1   MDVKDFYYDLPEELIAQDPLEDRSSSRLLVLNKDTG---EIQHKVFRDILSYLRKGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+TKVI A+L G +       + +I   L  R   + W    +P K  K G +++F   
Sbjct: 58  INDTKVIPARLIGSK----EGTDAKIEVLLLKRRENDIWETLVKPGKKAKIGTVINF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G+  L+ TV+D    G  L+ FS  GI  E  +  +G +PLPPYI  +     +D   Y
Sbjct: 111 -GEGLLKGTVVDVVEEGNRLIQFSYKGI-FEEILDELGQMPLPPYITHQ----LQDKKRY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK +GS AAPTAGLHFT+ LL ++   GI++  VTLHVG GTF PVKV++  +H M
Sbjct: 165 QTVYAKHEGSAAAPTAGLHFTNELLGKIAEKGIEIAHVTLHVGLGTFRPVKVDNVLEHHM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   ++   A+ +N  K +GGR++ VGTTS R LE+A  EDGI+   SG+T+IFI PG
Sbjct: 225 HSEFYIVEEEEARKINDTKKKGGRVICVGTTSCRTLESAAGEDGILKAGSGWTDIFIYPG 284

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLFQK 359
           YRF+ +D L++NFHLP+STL+MLVSA  G E   K Y+ AI   YRF+S+GD   +  K
Sbjct: 285 YRFKILDCLITNFHLPESTLVMLVSALAGREHVLKAYEEAIKERYRFFSFGDAMFIASK 343


>gi|160935784|ref|ZP_02083159.1| hypothetical protein CLOBOL_00674 [Clostridium bolteae ATCC
           BAA-613]
 gi|158441528|gb|EDP19238.1| hypothetical protein CLOBOL_00674 [Clostridium bolteae ATCC
           BAA-613]
          Length = 349

 Score =  286 bits (733), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 151/356 (42%), Positives = 212/356 (59%), Gaps = 16/356 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M VK+FD++LP   IA  P+  R ++RLMV+         I   +  D+  +L   D +V
Sbjct: 1   MDVKDFDYELPEELIAQDPLEDRSASRLMVLDRETG---EIQHRIFKDITEYLRPGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+TKVI A+L GV+         +I   L  R   + W    RP K  K G ++ F   
Sbjct: 58  INDTKVIPARLFGVK----KDTGAKIEILLLKRRENDVWETLVRPGKKAKPGTVIEF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G+  L  TV+D  + G  L+ F   GI  E  +  +G +PLPPYI  +     +D   Y
Sbjct: 111 -GEGLLTGTVVDTVDDGNRLIQFHYKGI-FEEILDQLGQMPLPPYITHQ----LKDKNRY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YA+ +GS AAPTAGLHFT  LL+ +  +G+K+  VTLHVG GTF PVKVE+  DH M
Sbjct: 165 QTVYARHEGSAAAPTAGLHFTQELLAEIEGMGVKIAHVTLHVGLGTFRPVKVENVQDHHM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   ++   A+ +N  ++ GGR++ VGTTS R +E+A+TEDG++   +G+T IFI PG
Sbjct: 225 HSEFYIVEESEAKKVNDTRAAGGRVICVGTTSCRTVESASTEDGVLKAGTGWTEIFIYPG 284

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           YRF+ +D L++NFHLP+STL+MLVSA  G E     Y+ A+   YRF+S+GD   +
Sbjct: 285 YRFKVLDALITNFHLPQSTLVMLVSALAGREHILDAYREAVKEGYRFFSFGDAMFI 340


>gi|294795131|ref|ZP_06760265.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Veillonella
           sp. 3_1_44]
 gi|294453923|gb|EFG22298.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Veillonella
           sp. 3_1_44]
          Length = 341

 Score =  286 bits (732), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 154/356 (43%), Positives = 212/356 (59%), Gaps = 16/356 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V +FD++LP   IA  PV PRD+ARL+ +   +S  +    H   DL   L+  D +V
Sbjct: 1   MKVTDFDYELPEELIAQHPVEPRDTARLLTLD-KVSGEVKHKGHFY-DLLEELHEGDVLV 58

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FNNTKVI A+L G    H      ++   L      N W    +P K    G ++ F   
Sbjct: 59  FNNTKVIPARLYG----HRQGSGGKVEVLLLTPCGENRWECLVKPGKKCPIGQVIEF--- 111

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
               RL   +IDK N G  ++ F+ +G+  +  I  +G +PLPPYI  K      D   Y
Sbjct: 112 --DDRLSGVIIDKTNFGGRIIQFTCNGV-FDDVIQEIGEMPLPPYIHEK----LEDKDRY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK +GS AAPTAGLHFT +LL ++ + G+++ FVTLHVG GTF PV  E  +DH M
Sbjct: 165 QTVYAKEKGSAAAPTAGLHFTPDLLEKIKAKGVELEFVTLHVGLGTFRPVSAETIEDHEM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   +   TA  +N+ K +G RI++VGTTS+R LE+AT +DG++   SG+T IFI PG
Sbjct: 225 HSEFFVVPQDTANRINAAKQKGSRIIAVGTTSVRTLESATNDDGVLQGMSGWTQIFIYPG 284

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           Y+F+ +D L++NFHLP+STLLML+SA  G E     Y+ A+   YRF+S+GD   +
Sbjct: 285 YKFKMIDALVTNFHLPQSTLLMLISALAGREHCLAAYEEAVRERYRFFSFGDAMFI 340


>gi|289434811|ref|YP_003464683.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Listeria
           seeligeri serovar 1/2b str. SLCC3954]
 gi|289171055|emb|CBH27597.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Listeria
           seeligeri serovar 1/2b str. SLCC3954]
          Length = 342

 Score =  286 bits (732), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 155/353 (43%), Positives = 219/353 (62%), Gaps = 17/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V++FDFDLP   IA  P+  R S+RLMV+         I D   +D+ ++L+  DA+V
Sbjct: 1   MKVEDFDFDLPEELIAQTPLLDRTSSRLMVLDKATGE---IKDQHFTDILSYLHEGDALV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+V+ A+L+G++    +     I   L  +   N+W    +P+K I++G  + F   
Sbjct: 58  LNDTRVLPARLHGIK----DETGAHIEVLLLKQKEGNAWETLVKPAKRIRQGATITF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G   L+AT +++   G  +L FS  GI  E  +  +G +PLPPYI  +     R    Y
Sbjct: 111 -GDGALKATCLEELEHGGRILEFSYEGIFYE-VLEQLGEMPLPPYIKEQLADQDR----Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT +LL+++ + G+++ FVTLHVG GTF PV VEDT +H M
Sbjct: 165 QTVYAKENGSAAAPTAGLHFTEDLLAKIKAKGVEIIFVTLHVGLGTFRPVDVEDTANHKM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLET-ATTEDGIINPWSGFTNIFITP 299
           HSE   +    A+ +N VK  GG++V+VGTTS+R LET A+  +G +   SG+T IFI+P
Sbjct: 225 HSEFYRLTEEAAERINKVKETGGKVVAVGTTSIRTLETIASRHEGKLVAESGWTEIFISP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           GY F+AVD L++NFHLPKSTL+MLVSA     +    Y HA+   YRF+S+GD
Sbjct: 285 GYTFQAVDALITNFHLPKSTLIMLVSALSDRNKILTAYNHAVEQQYRFFSFGD 337


>gi|323706517|ref|ZP_08118076.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Thermoanaerobacterium xylanolyticum LX-11]
 gi|323534147|gb|EGB23939.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Thermoanaerobacterium xylanolyticum LX-11]
          Length = 341

 Score =  286 bits (732), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 151/356 (42%), Positives = 217/356 (60%), Gaps = 16/356 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + EF +DLP   IA  P+  RD +RLMV++ +      I   +  ++  +L  ND +V
Sbjct: 1   MNLHEFYYDLPEELIAQEPLQNRDESRLMVLNKDTGE---IKHDIFKNILTYLKPNDVLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+TKVI A+L GVR         +I   L  R+  + W +  +P +  K G    F   
Sbjct: 58  LNDTKVIPARLYGVR----EDTGGKIEFVLLKRLGIDEWEILVKPGRRAKIGSKFIF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G   L+A ++   + G  ++ FS  G+  E  +  +G +P+PPYI +K     +D   Y
Sbjct: 111 -GNGELKALILSDTDAGGRIVRFSYEGV-FEEVLDKLGEMPIPPYIKKK----LKDKNMY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK +GS AAPTAGLHFT+ LL ++   G+K  F+TLHVG GTF PVK E  ++H M
Sbjct: 165 QTVYAKHEGSAAAPTAGLHFTNELLDKIREFGVKTVFITLHVGLGTFRPVKEEVIENHKM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   ++   A A+N+ +  GGRI+SVGTTS R LET   +DGII+  SG+T+IFI PG
Sbjct: 225 HSEFYIVNEDAADAINAARKAGGRIISVGTTSTRTLETVADDDGIIHAGSGWTDIFIYPG 284

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           Y+++A+D +++NFHLP+STL+M++SAF G E     Y+ AI + YRFYS+GD  L+
Sbjct: 285 YKYKAIDGIITNFHLPESTLIMMISAFAGKENVMNAYKTAIENKYRFYSFGDAMLI 340


>gi|323695094|ref|ZP_08109236.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           symbiosum WAL-14673]
 gi|323500849|gb|EGB16769.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           symbiosum WAL-14673]
          Length = 347

 Score =  286 bits (732), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 155/359 (43%), Positives = 217/359 (60%), Gaps = 16/359 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M VK+F +DLP   IA  P+  R S+RL+V++ +      I   +  D+ ++L   D +V
Sbjct: 1   MDVKDFYYDLPEELIAQDPLEDRSSSRLLVLNKDTG---EIQHKVFRDILSYLRKGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+TKVI A+L G +       + +I   L  R   + W    +P K  K G +++F   
Sbjct: 58  INDTKVIPARLIGSK----EGTDAKIEVLLLKRRENDIWETLVKPGKKAKIGTVINF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G+  L+ TV+D    G  L+ FS  GI  E  +  +G +PLPPYI  +     +D   Y
Sbjct: 111 -GEGLLKGTVVDVVEEGNRLIQFSYKGI-FEEILDELGQMPLPPYITHQ----LQDKNRY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK +GS AAPTAGLHFT+ LL ++   GI++  VTLHVG GTF PVKV++  +H M
Sbjct: 165 QTVYAKHEGSAAAPTAGLHFTNELLGKIAEKGIEIAHVTLHVGLGTFRPVKVDNVLEHHM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   ++   A+ +N  K +GGR++ VGTTS R LE+A  EDGI+   SG+T+IFI PG
Sbjct: 225 HSEFYIVEEEEARKINDTKKKGGRVICVGTTSCRTLESAAGEDGILKAGSGWTDIFIYPG 284

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLFQK 359
           YRF+ +D L++NFHLP+STL+MLVSA  G E   K Y+ AI   YRF+S+GD   +  K
Sbjct: 285 YRFKILDCLITNFHLPESTLVMLVSALAGREHVLKAYEEAIKERYRFFSFGDAMFIASK 343


>gi|313894608|ref|ZP_07828171.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Veillonella
           sp. oral taxon 158 str. F0412]
 gi|313440798|gb|EFR59227.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Veillonella
           sp. oral taxon 158 str. F0412]
          Length = 341

 Score =  286 bits (731), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 155/356 (43%), Positives = 211/356 (59%), Gaps = 16/356 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V +FD++LP   IA  PV PRD+ARL+ +   ++  +V  +H   DL   L+  D +V
Sbjct: 1   MKVIDFDYELPEELIAQHPVEPRDTARLLTLD-KVTGEVVHKEHFY-DLLEELHEGDVLV 58

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FNNTKVI A+L G    H      ++   L      N W    +P K    G ++ F   
Sbjct: 59  FNNTKVIPARLYG----HRQGSGGKVEVLLLTPCGENRWECLVKPGKKCPVGQVIEF--- 111

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
               RL  TVIDK   G  ++ F+ +G+  +  I  +G +PLPPYI  K      D   Y
Sbjct: 112 --DDRLSGTVIDKTEFGGRIIEFTCNGV-FDDVIQEIGEMPLPPYIHEK----LEDKDRY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL ++ + G+++ FVTLHVG GTF PV  E  +DH M
Sbjct: 165 QTVYAKENGSAAAPTAGLHFTPELLEKIKAKGVELEFVTLHVGLGTFRPVSAETIEDHEM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   +   TA  +N+ K +G RI++VGTTS+R LE+AT ++GI+   SG T IFI PG
Sbjct: 225 HSEFFVVSQDTADRINAAKQKGSRIIAVGTTSVRTLESATNDEGILQGISGTTQIFIYPG 284

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           Y+F+ +D L++NFHLP+STLLML+SA  G E     Y+ A+   YRF+S+GD   +
Sbjct: 285 YKFKMIDALVTNFHLPQSTLLMLISALAGREHCLAAYEEAVKERYRFFSFGDAMFI 340


>gi|294793309|ref|ZP_06758454.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Veillonella
           sp. 6_1_27]
 gi|294455740|gb|EFG24105.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Veillonella
           sp. 6_1_27]
          Length = 341

 Score =  285 bits (730), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 153/356 (42%), Positives = 212/356 (59%), Gaps = 16/356 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V +FD++LP   IA  PV PRD+ARL+ +   +S  +    H   DL   L+  D +V
Sbjct: 1   MKVTDFDYELPEELIAQHPVEPRDTARLLTLD-KVSGEVKHKGHFY-DLLEELHEGDVLV 58

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FNNTKVI A+L G    H      ++   L      N W    +P K    G ++ F   
Sbjct: 59  FNNTKVIPARLYG----HRQGSGGKVEVLLLTPCGENRWECLVKPGKKCPVGQVIEF--- 111

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
               RL   +IDK + G  ++ F+ +G+  +  I  +G +PLPPYI  K      D   Y
Sbjct: 112 --DDRLSGVIIDKTDFGGRIIQFTCNGV-FDDVIQEIGEMPLPPYIHEK----LEDKDRY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK +GS AAPTAGLHFT +LL ++ + G+++ FVTLHVG GTF PV  E  +DH M
Sbjct: 165 QTVYAKEKGSAAAPTAGLHFTPDLLEKIKAKGVELEFVTLHVGLGTFRPVSAETIEDHEM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   +   TA  +N+ K +G RI++VGTTS+R LE+AT +DG++   SG+T IFI PG
Sbjct: 225 HSEFFVVSQDTADRINAAKQKGSRIIAVGTTSVRTLESATNDDGVLQGMSGWTQIFIYPG 284

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           Y+F+ +D L++NFHLP+STLLML+SA  G E     Y+ A+   YRF+S+GD   +
Sbjct: 285 YKFKMIDALVTNFHLPQSTLLMLISALAGREHCLAAYEEAVRERYRFFSFGDAMFI 340


>gi|313633141|gb|EFS00030.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Listeria
           seeligeri FSL N1-067]
          Length = 342

 Score =  285 bits (730), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 155/353 (43%), Positives = 218/353 (61%), Gaps = 17/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V++FDFDLP   IA  P+  R S+RLMV+         I D   +D+ ++L+  DA+V
Sbjct: 1   MKVEDFDFDLPEELIAQTPLLDRTSSRLMVLDKATGE---IKDQHFTDILSYLHEGDALV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+V+ A+L+G +    +     I   L  +   N+W    +P+K I++G  + F   
Sbjct: 58  LNDTRVLPARLHGTK----DETGAHIEVLLLKQKEGNAWETLVKPAKRIRQGATITF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G   L+AT +++   G  +L FS  GI  E  +  +G +PLPPYI  +     R    Y
Sbjct: 111 -GDGALKATCLEELEHGGRILEFSYEGIFYE-VLEQLGEMPLPPYIKEQLADQDR----Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT +LL+++ + G+++ FVTLHVG GTF PV VEDT +H M
Sbjct: 165 QTVYAKENGSAAAPTAGLHFTEDLLAKIKAKGVEIIFVTLHVGLGTFRPVDVEDTANHKM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLET-ATTEDGIINPWSGFTNIFITP 299
           HSE   +    A+ +N VK  GG++V+VGTTS+R LET A+  +G +   SG+T IFI+P
Sbjct: 225 HSEFYRLTEEAAERINKVKETGGKVVAVGTTSIRTLETIASRHEGELVAESGWTEIFISP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           GY F+AVD L++NFHLPKSTL+MLVSA     +    Y HA+   YRF+S+GD
Sbjct: 285 GYTFQAVDALITNFHLPKSTLIMLVSALSDRNKILTAYNHAVEQQYRFFSFGD 337


>gi|114797801|ref|YP_761436.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Hyphomonas
           neptunium ATCC 15444]
 gi|123322972|sp|Q0BYK7|QUEA_HYPNA RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|114737975|gb|ABI76100.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Hyphomonas
           neptunium ATCC 15444]
          Length = 351

 Score =  285 bits (728), Expect = 9e-75,   Method: Compositional matrix adjust.
 Identities = 159/359 (44%), Positives = 211/359 (58%), Gaps = 11/359 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M +  F FDLP   IALRP  P+D+ARL+VVH +      + D  V DLP +LN+ D +V
Sbjct: 1   MDLSVFQFDLPEDLIALRPAQPQDAARLLVVHGDGR----LIDATVRDLPKYLNTGDVLV 56

Query: 61  FNNTKVITAQLNGVRFCHIN-RREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFS 119
           FN+T+V+ A L GVR       R+ E+   L  R     W   ARP + +K GD + FF+
Sbjct: 57  FNDTRVLPAALKGVRPARDGASRDVEVDVNLVERQGDCLWLALARPGRRLKDGDEI-FFA 115

Query: 120 QDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVD 179
           +   +R    +  +   GEILL F+  G  +   +   G +PLPPYIAR+RP DA D   
Sbjct: 116 EGFSAR----IASRREGGEILLDFNCEGEAMIAALDAHGAMPLPPYIARRRPADAEDRET 171

Query: 180 YQTTYA-KIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDH 238
           YQT +A +   SVAAPTAGLHFT  LL+ + + G+K   V LHVG GTF P++     ++
Sbjct: 172 YQTRFAGEDAASVAAPTAGLHFTPRLLAEVEAAGLKRETVRLHVGLGTFKPLEDRHLSEN 231

Query: 239 IMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFIT 298
            +H E   I    A  LN+ ++ G R+V VGTT++R LE+   EDG I+  +G T+IF+ 
Sbjct: 232 RLHEEWRRITPEVADRLNAARAAGARLVPVGTTAMRTLESCAGEDGQIHAATGPTDIFLK 291

Query: 299 PGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           PG   RA D LM+NFHLP S+L MLVSA  G    +  Y HAI   YRFYSYGD  LL 
Sbjct: 292 PGDPVRATDALMTNFHLPGSSLFMLVSALMGTSLMRAAYAHAIEEKYRFYSYGDACLLL 350


>gi|116872960|ref|YP_849741.1| S-adenosylmethionine:tRNA ribosyltransferase- isomerase [Listeria
           welshimeri serovar 6b str. SLCC5334]
 gi|123461090|sp|A0AIY0|QUEA_LISW6 RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|116741838|emb|CAK20962.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Listeria
           welshimeri serovar 6b str. SLCC5334]
          Length = 342

 Score =  285 bits (728), Expect = 9e-75,   Method: Compositional matrix adjust.
 Identities = 155/353 (43%), Positives = 217/353 (61%), Gaps = 17/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V++FDFDLP   IA  P+  R S+RLMV+         I D   +D+ ++LN  DA+V
Sbjct: 1   MKVEDFDFDLPEELIAQTPLLDRTSSRLMVLDKKSGE---IKDQHFTDILSYLNEGDALV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+V+ A+L+G +    +     I   L  +   N+W    +P+K I+KG  + F   
Sbjct: 58  LNDTRVLPARLHGTK----DETGAHIEVLLLKQKEGNAWETLVKPAKRIRKGGTITF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G   L+AT +++   G  +L FS  GI  E  +  +G +PLPPYI  +     R    Y
Sbjct: 111 -GNGALKATCLEELEHGGRILEFSYEGIFYE-VLEQLGEMPLPPYIKEQLADQDR----Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT +LL+++ + G+++ FVTLHVG GTF PV VEDT +H M
Sbjct: 165 QTVYAKENGSAAAPTAGLHFTEDLLAQISAKGVEIIFVTLHVGLGTFRPVDVEDTANHKM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLET-ATTEDGIINPWSGFTNIFITP 299
           HSE   +    A  +N +K+ GG++V+VGTTS+R LET A+  +G +   SG+T+IFI+P
Sbjct: 225 HSEFYRLTEDAANRINKIKATGGKVVAVGTTSIRTLETIASHNEGKLVAESGWTDIFISP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           GY F+AVD L++N HLPKSTL+MLVSA          Y HA+   YRF+S+GD
Sbjct: 285 GYTFQAVDALITNLHLPKSTLIMLVSALSNRTNILAAYNHAVEQQYRFFSFGD 337


>gi|134299522|ref|YP_001113018.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Desulfotomaculum reducens MI-1]
 gi|172044286|sp|A4J540|QUEA_DESRM RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|134052222|gb|ABO50193.1| S-adenosylmethionine--tRNA ribosyltransferase-isomerase
           [Desulfotomaculum reducens MI-1]
          Length = 341

 Score =  285 bits (728), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 150/357 (42%), Positives = 219/357 (61%), Gaps = 18/357 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLV-SDLPAFLNSNDAI 59
           M + +FDF+LP   IA  P+  RD +RLM+VH ++      ++H    DL  +L   D +
Sbjct: 1   MQLSDFDFELPEELIAQEPIKQRDQSRLMIVHRDIDR----TEHKTFKDLLQYLQPGDVL 56

Query: 60  VFNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFS 119
           V N++KV+ A++ G +     +    I   L  ++S N W    +P K  K G+IL F  
Sbjct: 57  VMNDSKVLPARIYGEKVSTGAK----IEVLLLRQISANQWETLVKPGKRAKIGEILDF-- 110

Query: 120 QDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVD 179
             G  +++  ++D  + G  ++ FS     L+  +  +G++PLPPYI  K+P+   D   
Sbjct: 111 --GSGKMKGKIVDHTDVGGRVIEFSCQEPFLQV-LEQIGSMPLPPYI--KKPLT--DKQR 163

Query: 180 YQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHI 239
           YQT YA+ +GS AAPTAGLHFT  LL  + + G+ +  V LHVG GTF PV+VED   H 
Sbjct: 164 YQTVYARQEGSAAAPTAGLHFTRELLEEIRNRGVSIVTVLLHVGLGTFRPVQVEDVTSHR 223

Query: 240 MHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITP 299
           MH E   I    A+ +N  K RGGR+++VGTTS+R LET++ E G + P SGFT+IFI P
Sbjct: 224 MHEEYYEITPQAAEEINQAKLRGGRVIAVGTTSVRCLETSSNEAGQVLPGSGFTDIFIYP 283

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           GY+F+ ++ L++NFHLPKS+LLML+SA  G E+  K YQ A++  YRF+S+GD  L+
Sbjct: 284 GYQFKVIEGLVTNFHLPKSSLLMLISALAGREKILKAYQQAVTEQYRFFSFGDAMLI 340


>gi|269797657|ref|YP_003311557.1| S-adenosylmethionine/tRNA-ribosyltransferase-iso merase
           [Veillonella parvula DSM 2008]
 gi|269094286|gb|ACZ24277.1| S-adenosylmethionine/tRNA-ribosyltransferase-iso merase
           [Veillonella parvula DSM 2008]
          Length = 341

 Score =  284 bits (726), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 153/356 (42%), Positives = 211/356 (59%), Gaps = 16/356 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V +FD++LP   IA  P+ PRD+ARL+ +   +S  +   +H   DL   L+  D +V
Sbjct: 1   MKVTDFDYELPEELIAQHPIEPRDTARLLTLD-KVSGKVSHKEHFY-DLLEELHEGDVLV 58

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FNNTKVI A+L G    H      ++   L      N W    +P K    G ++ F   
Sbjct: 59  FNNTKVIPARLYG----HRQGSGGKVEVLLLTPCGENRWECLVKPGKKCPVGQVIEF--- 111

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
               RL   VIDK   G  ++ F+ +G+  +  I  +G +PLPPYI  K      D   Y
Sbjct: 112 --DDRLRGIVIDKTEFGGRIIEFTCNGV-FDDVIQEIGEMPLPPYIHEK----LEDKDRY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK +GS AAPTAGLHFT +LL ++ + G+++ FVTLHVG GTF PV  E  +DH M
Sbjct: 165 QTVYAKEKGSAAAPTAGLHFTPDLLEKIKAKGVELEFVTLHVGLGTFRPVSAETIEDHEM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   +   TA  +N+ K  G RI++VGTTS+R LE+AT +DG++   SG+T IFI PG
Sbjct: 225 HSEFFVVSQETADRINAAKRNGRRIIAVGTTSVRTLESATNDDGVLQGMSGWTQIFIYPG 284

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           Y+F+ +D L++NFHLP+STLLML+SA  G E     Y+ A+   YRF+S+GD   +
Sbjct: 285 YKFKMIDALVTNFHLPQSTLLMLISALAGREHCLAAYEEAVKERYRFFSFGDAMFI 340


>gi|325295633|ref|YP_004282147.1| S-adenosylmethionine:tRNAribosyltransferase-isomerase
           [Desulfurobacterium thermolithotrophum DSM 11699]
 gi|325066081|gb|ADY74088.1| S-adenosylmethionine:tRNAribosyltransferase-isomerase
           [Desulfurobacterium thermolithotrophum DSM 11699]
          Length = 343

 Score =  284 bits (726), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 155/358 (43%), Positives = 214/358 (59%), Gaps = 16/358 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V +FD+ LP   IA  PV PRDS+RLMV++ N      I   +  D+  +L + D +V
Sbjct: 1   MKVSDFDYKLPKELIAKFPVEPRDSSRLMVLNKNTGK---IEHRIFKDIVEYLKAGDVLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+TKVI A+L    F  ++   K +   L  +   N+W V A+P++ +KKG  + F   
Sbjct: 58  INDTKVIPARL----FGKLDTGGK-VEILLVRQPGLNTWEVMAKPARKLKKGRKISF--- 109

Query: 121 DGQSRLEATVIDKWNTGEILLVFSI-SGIELERQISLVGTIPLPPYIARKRPIDARDYVD 179
                LEA V +    G+ ++ F I S  +   +I  +G IPLPPYI R+   + R+   
Sbjct: 110 --DEELEAVVKEYSGEGKRIIEFVIKSNKDFMEKIEEIGHIPLPPYIEREEKPEDRE--K 165

Query: 180 YQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHI 239
           YQT +A+ +G+VAAPTAGLHFT+ LL  L S GI +  +TLHVG GTF PVKVE+ +DH 
Sbjct: 166 YQTVFARKEGAVAAPTAGLHFTTELLENLKSKGIIIKNITLHVGPGTFKPVKVENVEDHQ 225

Query: 240 MHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITP 299
           M  E  ++   TA  +N  K  G R+++VGTT  R LE+A  E G +      TN+FI P
Sbjct: 226 MDYETYYVPEDTAIEINRAKEEGRRVIAVGTTVTRTLESAADESGKVKQGEDSTNLFIYP 285

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           GY+F+ +D L++NFHLP+STLLMLVSAF G E     Y+ A+   YRFYSYGD   +F
Sbjct: 286 GYKFKVIDALITNFHLPRSTLLMLVSAFAGKERILNAYKEAVRKGYRFYSYGDAMFIF 343


>gi|146295225|ref|YP_001178996.1| S-adenosylmethionine--tRNA-ribosyltransferase-isomerase
           [Caldicellulosiruptor saccharolyticus DSM 8903]
 gi|145408801|gb|ABP65805.1| S-adenosylmethionine--tRNA ribosyltransferase-isomerase
           [Caldicellulosiruptor saccharolyticus DSM 8903]
          Length = 345

 Score =  284 bits (726), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 156/358 (43%), Positives = 213/358 (59%), Gaps = 24/358 (6%)

Query: 5   EFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIVFNNT 64
           +F +DLP   IA +P+ PRDS+RLMV+HP+      I   +  D+  +LN  D +V NN+
Sbjct: 8   DFHYDLPEELIAQKPIEPRDSSRLMVIHPDGR----IDHRIFRDIIEYLNEGDCLVLNNS 63

Query: 65  KVITAQLNGVRFCHINRREKE---ISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQD 121
           KVI A+L       I +RE     I   L  R+S ++W V  RP K  +KG    F    
Sbjct: 64  KVIPARL-------IGQREDTGSFIEFLLVKRLSIDTWEVMTRPGKKARKGRRFVF---- 112

Query: 122 GQSRLEATVID-KWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
           G  RL+A V+    + G  ++ F   G+  E  +  +G IPLPPYI  K     R    Y
Sbjct: 113 GDGRLKAEVLHVNQDEGTRIVRFEYEGV-FEDILESLGEIPLPPYIKEKLENVER----Y 167

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT Y+KI GS AAPTAGLHFT  LLSR+   G++  +VTLHVG GTF PVKVE+ ++H M
Sbjct: 168 QTVYSKIPGSAAAPTAGLHFTEELLSRISKKGVQTLYVTLHVGLGTFKPVKVENIEEHKM 227

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           H E   I    A+ +N  K  G R+++VGTTS R+LE+A  E G++    G+T+IFI PG
Sbjct: 228 HEEYYEISEDVAERINEAKRLGKRVIAVGTTSCRVLESAAVEKGLVKAQKGWTDIFIYPG 287

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLFQ 358
           Y F+ +D L++NFHLP +TL+MLV AF G E     Y+ A+   YRF+S+GD  L+ +
Sbjct: 288 YEFKILDGLVTNFHLPDTTLMMLVCAFGGYERIMNAYKIAVEQRYRFFSFGDAMLILK 345


>gi|238019734|ref|ZP_04600160.1| hypothetical protein VEIDISOL_01609 [Veillonella dispar ATCC 17748]
 gi|237863775|gb|EEP65065.1| hypothetical protein VEIDISOL_01609 [Veillonella dispar ATCC 17748]
          Length = 341

 Score =  284 bits (726), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 154/356 (43%), Positives = 210/356 (58%), Gaps = 16/356 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V +FD++LP   IA  PV PRD+ARL+ +   ++  +   +H   DL   L+  D +V
Sbjct: 1   MKVTDFDYELPEELIAQHPVEPRDTARLLTLD-KVTGEVAHKEHFY-DLLDELHEGDVLV 58

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FNNTKVI A+L G R         ++   L      N W    +P K    G ++ F   
Sbjct: 59  FNNTKVIPARLYGQR----QGSGGKVEVLLLTPCGENRWECLVKPGKKCPIGQVIEF--- 111

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
               RL  TVIDK   G  ++ F+  G+  +  I  +G +PLPPYI  K      D   Y
Sbjct: 112 --DDRLSGTVIDKTEFGGRIIEFTCDGV-FDDVIQEIGEMPLPPYIHEK----LEDKDRY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK +GS AAPTAGLHFT  LL ++ + G+++ FVTLHVG GTF PV  E  +DH M
Sbjct: 165 QTVYAKEKGSAAAPTAGLHFTPELLEKIKAKGVELEFVTLHVGLGTFRPVSAETIEDHEM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   +   TA  +N+ K  G RI++VGTTS+R LE+AT +DG++   SG+T IFI PG
Sbjct: 225 HSEFFVVSQDTADRINAAKRNGRRIIAVGTTSVRTLESATNDDGVLQGISGWTQIFIYPG 284

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           Y+F+ +D L++NFHLP+STLLML+SA  G E     Y+ A+   YRF+S+GD   +
Sbjct: 285 YKFKMIDALVTNFHLPQSTLLMLISALAGREHCLAAYEEAVRERYRFFSFGDAMFI 340


>gi|282850102|ref|ZP_06259484.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Veillonella
           parvula ATCC 17745]
 gi|282580291|gb|EFB85692.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Veillonella
           parvula ATCC 17745]
          Length = 341

 Score =  284 bits (726), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 153/356 (42%), Positives = 211/356 (59%), Gaps = 16/356 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V +FD++LP   IA  PV PRD+ARL+ +   +S  +    H   DL   L+  D +V
Sbjct: 1   MKVTDFDYELPEELIAQHPVEPRDTARLLTLD-KVSGEVKHKGHFY-DLLEELHEGDVLV 58

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FNNTKVI A+L G    H      ++   L      N W    +P K    G ++ F   
Sbjct: 59  FNNTKVIPARLYG----HRQGSGGKVEVLLLTPCGENRWECLVKPGKKCPIGQVIEF--- 111

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
               RL   +IDK N G  ++ F+ +G+  +  I  +G +PLPPYI  K      D   Y
Sbjct: 112 --DDRLSGVIIDKTNFGGRIIQFTCNGV-FDDVIQEIGEMPLPPYIHEK----LEDKDRY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK +GS AAPTAGLHFT +LL ++ + G+++ FVTLHVG GTF PV  E  +DH M
Sbjct: 165 QTVYAKEKGSAAAPTAGLHFTPDLLEKIKAKGVELEFVTLHVGLGTFRPVSAETIEDHEM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   +   TA  +N+ K +G RI++VGTTS+R LE+AT +DG++   SG+T IFI PG
Sbjct: 225 HSEFFVVPQDTANRINAAKQKGSRIIAVGTTSVRTLESATNDDGVLQGMSGWTQIFIYPG 284

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           Y+F+ +D L++NFHLP+STLLML+SA    E     Y+ A+   YRF+S+GD   +
Sbjct: 285 YKFKMIDALVTNFHLPQSTLLMLISALASREHCLAAYEEAVRERYRFFSFGDAMFI 340


>gi|297544495|ref|YP_003676797.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Thermoanaerobacter mathranii subsp. mathranii str. A3]
 gi|296842270|gb|ADH60786.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Thermoanaerobacter mathranii subsp. mathranii str. A3]
          Length = 341

 Score =  283 bits (725), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 152/359 (42%), Positives = 209/359 (58%), Gaps = 22/359 (6%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   EF F+LP   IA  P+  R S+RLMV++        I   +  ++  +L + D +V
Sbjct: 1   MKRSEFYFELPKELIAQEPLEDRSSSRLMVLNKKTGE---IEHDIFKNITKYLKAGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREK---EISCTLHMRVSPNSWSVYARPSKVIKKGDILHF 117
            N+TKVI A+L       I RRE    +I   L  R+S N W    +P +  K G    F
Sbjct: 58  LNDTKVIPARL-------IGRREDSGGKIEFVLIKRISSNEWETLVKPGRRAKIGSRFVF 110

Query: 118 FSQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDY 177
               G   L A V+D    G  ++ F   G+  E  +  +G +P+PPYI +K     R  
Sbjct: 111 ----GTGELIAEVLDATEAGGRIVRFYYEGV-FEEVLDKLGEMPVPPYIKKKLKNKDR-- 163

Query: 178 VDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDD 237
             YQT YAK +GS AAPTAGLHFT  LL ++  +G+K  F+TLHVG GTF PVK E+ ++
Sbjct: 164 --YQTVYAKYEGSAAAPTAGLHFTKELLEKIKQMGVKTVFITLHVGLGTFRPVKEEEIEN 221

Query: 238 HIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFI 297
           H MH E   +    A  +N  +  GGRI++VGTTS R LET   E+G +   SG+T+IFI
Sbjct: 222 HKMHEEFYIVTKEAANEINETRKSGGRIIAVGTTSTRTLETVADENGYVKEKSGWTDIFI 281

Query: 298 TPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
            PGY+F+A+D +++NFHLP+STL+M+VSAF G E   + YQ AI H YRF+S+GD  L+
Sbjct: 282 YPGYKFKAIDGMITNFHLPESTLIMMVSAFAGRENIMRAYQVAIEHKYRFFSFGDAMLI 340


>gi|289578214|ref|YP_003476841.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Thermoanaerobacter italicus Ab9]
 gi|289527927|gb|ADD02279.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Thermoanaerobacter italicus Ab9]
          Length = 341

 Score =  283 bits (725), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 152/359 (42%), Positives = 209/359 (58%), Gaps = 22/359 (6%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   EF F+LP   IA  P+  R S+RLMV++        I   +  ++  +L + D +V
Sbjct: 1   MKRSEFYFELPKELIAQEPLEDRSSSRLMVLNKKTGE---IEHDIFKNITKYLKAGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREK---EISCTLHMRVSPNSWSVYARPSKVIKKGDILHF 117
            N+TKVI A+L       I RRE    +I   L  R+S N W    +P +  K G    F
Sbjct: 58  LNDTKVIPARL-------IGRREDSGGKIEFVLIKRISSNEWETLVKPGRRAKIGSRFVF 110

Query: 118 FSQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDY 177
               G   L A V+D    G  ++ F   G+  E  +  +G +P+PPYI +K     R  
Sbjct: 111 ----GTGELIAEVLDTTEAGGRIVRFYYEGV-FEEVLDKLGEMPVPPYIKKKLKNKDR-- 163

Query: 178 VDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDD 237
             YQT YAK +GS AAPTAGLHFT  LL ++  +G+K  F+TLHVG GTF PVK E+ ++
Sbjct: 164 --YQTVYAKYEGSAAAPTAGLHFTKELLEKIKQMGVKTVFITLHVGLGTFRPVKEEEIEN 221

Query: 238 HIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFI 297
           H MH E   +    A  +N  +  GGRI++VGTTS R LET   E+G +   SG+T+IFI
Sbjct: 222 HKMHEEFYIVTKEAANEINETRKSGGRIIAVGTTSTRTLETVADENGYVKEKSGWTDIFI 281

Query: 298 TPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
            PGY+F+A+D +++NFHLP+STL+M+VSAF G E   + YQ AI H YRF+S+GD  L+
Sbjct: 282 YPGYKFKAIDGMITNFHLPESTLIMMVSAFAGRENIMRAYQVAIEHKYRFFSFGDAMLI 340


>gi|55820620|ref|YP_139062.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus thermophilus LMG 18311]
 gi|81560864|sp|Q5M5E8|QUEA_STRT2 RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|55736605|gb|AAV60247.1| S-adenosylmethionine-tRNA ribosyltransferase-isomerase
           [Streptococcus thermophilus LMG 18311]
          Length = 347

 Score =  283 bits (725), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 163/355 (45%), Positives = 221/355 (62%), Gaps = 21/355 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVIS--DHLVSDLPAFLNSNDA 58
           M   +FDF+LP   IA  P+  RD+++L+V+ P ++  +  +  DH++  L    N  DA
Sbjct: 1   MNTNDFDFELPEELIAQTPLEQRDASKLLVIDP-VTREMTDTHFDHIIDQL----NPGDA 55

Query: 59  IVFNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFF 118
           +V NNT+V+ A+L G +          +   L      + W V A+P+K +K G  + F 
Sbjct: 56  LVMNNTRVLPARLYGEK----TDTHGHVEFLLLKNTQGDQWEVLAKPAKRLKVGAKVSF- 110

Query: 119 SQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYV 178
              G  RL ATV ++ + G  ++ FS +GI LE   SL G +PLPPYI  K  ++ RD  
Sbjct: 111 ---GDGRLTATVTEELDHGGRIVEFSYNGIFLEVLESL-GEMPLPPYIHEK--LEDRDR- 163

Query: 179 DYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDH 238
            YQT YAK  GS AAPTAGLHFT  LL ++ + G+K+ ++TLHVG GTF PV V++ D+H
Sbjct: 164 -YQTVYAKENGSAAAPTAGLHFTPELLQKIEAKGVKLVYLTLHVGLGTFRPVSVDNVDEH 222

Query: 239 IMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFI 297
            MHSE   +    A  LNSVK+ GGRIV+VGTTS+R LET   + DG +   SG+TNIFI
Sbjct: 223 EMHSEFYTLSQEAADTLNSVKAAGGRIVAVGTTSIRTLETIGNKYDGQLQADSGWTNIFI 282

Query: 298 TPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
            PGY+F  VD   +NFHLPKSTL+MLVSAF G E   + Y+HAI   YRF+S+GD
Sbjct: 283 KPGYQFTVVDAFSTNFHLPKSTLVMLVSAFAGREFVLEAYKHAIQERYRFFSFGD 337


>gi|322517220|ref|ZP_08070102.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus vestibularis ATCC 49124]
 gi|322124207|gb|EFX95731.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus vestibularis ATCC 49124]
          Length = 347

 Score =  283 bits (725), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 163/362 (45%), Positives = 222/362 (61%), Gaps = 21/362 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVIS--DHLVSDLPAFLNSNDA 58
           M   +FDF+LP   IA  P+  RD+++L+V+ P ++  +  +  DH++  L    N  DA
Sbjct: 1   MNTNDFDFELPEELIAQTPLEQRDASKLLVIDP-VTKEMTDTHFDHIIDQL----NPGDA 55

Query: 59  IVFNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFF 118
           +V NNT+V+ A+L G +    N     +   L      + W V A+P+K +K G  + F 
Sbjct: 56  LVMNNTRVLPARLYGEK----NDTHGHVEFLLLKNTQGDQWEVLAKPAKRLKVGAKVSF- 110

Query: 119 SQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYV 178
              G  RL ATV ++ + G  ++ FS  GI LE   SL G +PLPPYI  K  ++ RD  
Sbjct: 111 ---GDGRLTATVTEELDHGGRIVEFSYDGIFLEVLESL-GEMPLPPYIHEK--LEDRDR- 163

Query: 179 DYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDH 238
            YQT YAK  GS AAPTAGLHFT  LL  + + G+K+ ++TLHVG GTF PV V++ D+H
Sbjct: 164 -YQTVYAKENGSAAAPTAGLHFTPELLQNIEAKGVKLVYLTLHVGLGTFRPVSVDNVDEH 222

Query: 239 IMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFI 297
            MHSE   +    A  LNSVK+ GGRIV+VGTTS+R LET   + +G +   SG+TNIFI
Sbjct: 223 EMHSEFYTLSQEAADTLNSVKATGGRIVAVGTTSIRTLETIGNKYNGRLQADSGWTNIFI 282

Query: 298 TPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
            PGY+F  VD   +NFHLPKSTL+MLVSAF G E     Y+HA+   YRF+S+GD   + 
Sbjct: 283 KPGYQFTVVDAFSTNFHLPKSTLVMLVSAFAGREFVLDAYKHAVQERYRFFSFGDAMFVT 342

Query: 358 QK 359
           Q+
Sbjct: 343 QR 344


>gi|322372469|ref|ZP_08047005.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus sp. C150]
 gi|321277511|gb|EFX54580.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus sp. C150]
          Length = 347

 Score =  283 bits (725), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 164/355 (46%), Positives = 219/355 (61%), Gaps = 21/355 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVIS--DHLVSDLPAFLNSNDA 58
           M   +FDF+LP   IA  P+  RD+++L+V+ P ++  +  +  DH++  L    N  DA
Sbjct: 1   MNTNDFDFELPEELIAQTPLKQRDASKLLVIDP-VTKEMTDTHFDHIIDQL----NPGDA 55

Query: 59  IVFNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFF 118
           +V NNT+V+ A+L G +          +   L      + W V A+P+K +K G  + F 
Sbjct: 56  LVMNNTRVLPARLYGEK----PDTHGHVEFLLLKNTQGDQWEVLAKPAKRLKVGAKVSF- 110

Query: 119 SQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYV 178
              G  RL ATV ++ + G  ++ FS  GI LE   SL G +PLPPYI  K  ++ RD  
Sbjct: 111 ---GDGRLTATVTEELDHGGRIVEFSYDGIFLEVLESL-GEMPLPPYIHEK--LEDRDR- 163

Query: 179 DYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDH 238
            YQT YAK  GS AAPTAGLHFT  LL ++ S G+K+ ++TLHVG GTF PV VE+ D+H
Sbjct: 164 -YQTVYAKENGSAAAPTAGLHFTPELLQKIESKGVKLVYLTLHVGLGTFRPVSVENVDEH 222

Query: 239 IMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFI 297
            MHSE   +    A  LNSVK+ GGRIV+VGTTS+R LET   + DG +   SG+TNIFI
Sbjct: 223 EMHSEFYTLSQDAADTLNSVKAAGGRIVAVGTTSIRTLETIGNKYDGQLQADSGWTNIFI 282

Query: 298 TPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
            PGY+F  VD   +NFHLPKSTL+MLVSAF G E     Y+HA+   YRF+S+GD
Sbjct: 283 KPGYQFTVVDAFSTNFHLPKSTLVMLVSAFAGREFVLDAYKHAVQERYRFFSFGD 337


>gi|325697145|gb|EGD39032.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus sanguinis SK160]
          Length = 342

 Score =  283 bits (724), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 160/353 (45%), Positives = 212/353 (60%), Gaps = 17/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +FDFDLP   IA  P+  RD++RL+VV        V SD     +   L   DA+V
Sbjct: 1   MNTADFDFDLPEELIAQTPLEKRDASRLLVVDKETG---VFSDQHFDQIIDQLQPGDALV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NNT+V+ A+L G++          +   L      + W V A+P+K ++ G  + F   
Sbjct: 58  MNNTRVLPARLYGIK----PETGGHVELLLLKNTQGDDWEVLAKPAKRLRVGAQISF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL ATV+D+ + G  ++ F+  GI LE   SL G +PLPPYI  K     R    Y
Sbjct: 111 -GDGRLTATVVDELDHGGRIVRFAYEGIFLEVLESL-GEMPLPPYIHEKLADRER----Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL ++ + G+K+ ++TLHVG GTF PV V+  DDH M
Sbjct: 165 QTVYAKENGSAAAPTAGLHFTEELLEQIAAKGVKLVYLTLHVGLGTFRPVSVDSLDDHEM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           HSE   +    AQ L  VK+ GGR+++VGTTS+R LET  ++  G I   SG+TNIFI P
Sbjct: 225 HSEFYSLSEEAAQTLRQVKANGGRVIAVGTTSIRTLETIGSKFQGQIQADSGWTNIFIKP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           GY ++ VD   +NFHLPKSTL+MLVSAF G   T + Y+HAI+  YRF+S+GD
Sbjct: 285 GYDWKVVDAFSTNFHLPKSTLVMLVSAFAGRSLTLEAYEHAIAERYRFFSFGD 337


>gi|328957017|ref|YP_004374403.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Carnobacterium sp. 17-4]
 gi|328673341|gb|AEB29387.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Carnobacterium sp. 17-4]
          Length = 345

 Score =  283 bits (723), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 157/353 (44%), Positives = 213/353 (60%), Gaps = 17/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           +  K+FDFDLP   IA  P+  R S++L++++        + D   +D+   LN  DA+V
Sbjct: 4   LTTKDFDFDLPEELIAQTPLENRSSSKLLILNKETGE---VDDKHFTDILEELNEGDALV 60

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+V+ A+L+GV+          +   L      + W    +P+K    G ++ F   
Sbjct: 61  MNDTRVLPARLHGVK----PETGAHLEILLLKNTEKDQWETLVKPAKKATVGTVISF--- 113

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL ATV ++ N G  ++ FS  GI LE   SL G +PLPPYI  +     R    Y
Sbjct: 114 -GDGRLTATVTEELNHGGRIIDFSYDGIFLEVLESL-GEMPLPPYIKERLEDSER----Y 167

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL ++ S G+K+ F+TLHVG GTF PV V+  +DH M
Sbjct: 168 QTVYAKENGSAAAPTAGLHFTEELLEKIKSKGVKLIFLTLHVGLGTFRPVSVDSIEDHEM 227

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           HSE   +   +A  L +V++ GGRIV+VGTTS+R LET  T+ +G I   SG+T+IFI+P
Sbjct: 228 HSEFYRLTEESATELTAVRNNGGRIVAVGTTSIRTLETIGTKFNGEIKADSGWTDIFISP 287

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           GY F+ VD   +NFHLPKSTL+MLVSAF G E     YQHA+   YRF+S+GD
Sbjct: 288 GYTFKVVDAFSTNFHLPKSTLVMLVSAFAGREHVLAAYQHAVDEKYRFFSFGD 340


>gi|327458690|gb|EGF05038.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus sanguinis SK1057]
          Length = 342

 Score =  283 bits (723), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 160/353 (45%), Positives = 211/353 (59%), Gaps = 17/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +FDFDLP   IA  P+  RD++RL+VV          SD     +   L   DA+V
Sbjct: 1   MNTADFDFDLPEELIAQTPLEKRDASRLLVVDKETGA---FSDQHFDQIIDQLQPGDALV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NNT+V+ A+L G++          +   L      + W V A+P+K ++ G  + F   
Sbjct: 58  MNNTRVLPARLYGIK----PETGGHVELLLLKNTQGDDWEVLAKPAKRLRVGAQISF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL ATVI++   G  ++ FS  GI LE   SL G +PLPPYI  K      D   Y
Sbjct: 111 -GDGRLTATVIEELEHGGRIVRFSYEGIFLEVLESL-GEMPLPPYIHEKLA----DRERY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL ++ + G+K+ ++TLHVG GTF PV V+  DDH M
Sbjct: 165 QTVYAKENGSAAAPTAGLHFTEELLEQIAAKGVKLVYLTLHVGLGTFRPVSVDSLDDHEM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           HSE   +    AQ L  VK++GGR+++VGTTS+R LET  ++  G I   SG+TNIFI P
Sbjct: 225 HSEFYSLSEEAAQTLRQVKAKGGRVIAVGTTSIRTLETIGSKFQGQIQADSGWTNIFIKP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           GY ++ VD   +NFHLPKSTL+MLVSAF G   T + Y+HAI+  YRF+S+GD
Sbjct: 285 GYDWKVVDAFSTNFHLPKSTLVMLVSAFAGRSLTLEAYEHAIAERYRFFSFGD 337


>gi|322412116|gb|EFY03024.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus dysgalactiae subsp. dysgalactiae ATCC
           27957]
          Length = 342

 Score =  283 bits (723), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 160/354 (45%), Positives = 214/354 (60%), Gaps = 19/354 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVV-HPNLSCPLVISDHLVSDLPAFLNSNDAI 59
           M   +FDFDLP   IA  P+  RDS++L+++ H   +      DH++  L    N  DA+
Sbjct: 1   MNTNDFDFDLPEELIAQTPLEKRDSSKLLIIDHEQKTMIDSHFDHIIDQL----NPGDAL 56

Query: 60  VFNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFS 119
           V NNT+V+ A+L G +          +   L      + W V A+P+K +K G  + F  
Sbjct: 57  VMNNTRVLPARLYGEKL----DTHGHVELLLLKNTHGDQWEVLAKPAKRLKVGSQVSF-- 110

Query: 120 QDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVD 179
             G  RL AT++++   G  ++ F+  GI LE   SL G +PLPPYI  K     R    
Sbjct: 111 --GDGRLTATIVEELEHGGRIVEFNYEGIFLEVLESL-GEMPLPPYIHEKLDDAER---- 163

Query: 180 YQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHI 239
           YQT YAK  GS AAPTAGLHFT++LLS++ + G+ + ++TLHVG GTF PV VE+ DDH 
Sbjct: 164 YQTVYAKENGSAAAPTAGLHFTTDLLSKIEAKGVHLVYLTLHVGLGTFRPVSVENLDDHD 223

Query: 240 MHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFIT 298
           MHSE   +    AQ L  VK  GGRIV+VGTTS+R LET  ++  G I   SG+TNIFI 
Sbjct: 224 MHSEFYSLSEEAAQTLRDVKQAGGRIVAVGTTSIRTLETIGSKFQGDIQADSGWTNIFIK 283

Query: 299 PGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           PGY+F+ VD   +NFHLPKSTL+MLVSAF G +     Y+HA+   YRF+S+GD
Sbjct: 284 PGYQFKVVDAFSTNFHLPKSTLVMLVSAFAGRDFVLDAYKHAVDEKYRFFSFGD 337


>gi|167748863|ref|ZP_02420990.1| hypothetical protein ANACAC_03637 [Anaerostipes caccae DSM 14662]
 gi|167651833|gb|EDR95962.1| hypothetical protein ANACAC_03637 [Anaerostipes caccae DSM 14662]
          Length = 357

 Score =  283 bits (723), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 157/361 (43%), Positives = 204/361 (56%), Gaps = 26/361 (7%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +F FDLP   IA  P+  R S+RL+V+         I      ++  +L   D +V
Sbjct: 17  MKTSDFTFDLPEELIAQDPLTDRSSSRLLVLDKETGE---IRHEGFRNIAGYLKRGDCLV 73

Query: 61  FNNTKVITAQLNGVRFCHINRREKE-----ISCTLHMRVSPNSWSVYARPSKVIKKGDIL 115
            N+TKVI A+L G         EKE     I   L  R   N+W    +P +  K G  +
Sbjct: 74  LNDTKVIPARLIG---------EKEGTGAKIEVLLLKRKQDNTWETLVKPGRKAKPGTRI 124

Query: 116 HFFSQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDAR 175
            F    GQ +L   V D  + G  L+ F   GI  E  +  +G +PLPPYI  +     +
Sbjct: 125 SF----GQGKLVGEVTDIVDEGNRLVKFEFDGI-FEEVLDELGQMPLPPYITHQ----LK 175

Query: 176 DYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDT 235
           D   YQT YAK +GS AAPTAGLHFT  LL  +   GI++ +VTLHVG GTF PVKVED 
Sbjct: 176 DKNRYQTVYAKHEGSAAAPTAGLHFTKELLKEIEEKGIRLAYVTLHVGLGTFRPVKVEDV 235

Query: 236 DDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNI 295
            +H MHSE   +D   A+ +N  +  GGRI+SVGTTS R LE+A  E+G I P SG+T I
Sbjct: 236 TEHHMHSEFYVVDEEAAEKINKTRKEGGRIISVGTTSTRTLESAADENGFIEPKSGWTEI 295

Query: 296 FITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSL 355
           FI PGY+F+ +D L++NFHLP+STLLMLVSA  G E   K Y  A+   YRF+S+GD   
Sbjct: 296 FIYPGYKFKVIDGLITNFHLPESTLLMLVSALAGKEHILKAYDEAVKERYRFFSFGDAMF 355

Query: 356 L 356
           +
Sbjct: 356 I 356


>gi|317470297|ref|ZP_07929690.1| tRNA ribosyltransferase-isomerase [Anaerostipes sp. 3_2_56FAA]
 gi|316902205|gb|EFV24126.1| tRNA ribosyltransferase-isomerase [Anaerostipes sp. 3_2_56FAA]
          Length = 341

 Score =  282 bits (722), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 157/357 (43%), Positives = 203/357 (56%), Gaps = 26/357 (7%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +F FDLP   IA  P+  R S+RL+V+         I      ++  +L   D +V
Sbjct: 1   MKTSDFTFDLPEELIAQDPLTDRSSSRLLVLDKETGE---IRHEGFRNIAGYLKRGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKE-----ISCTLHMRVSPNSWSVYARPSKVIKKGDIL 115
            N+TKVI A+L G         EKE     I   L  R   N+W    +P +  K G  +
Sbjct: 58  LNDTKVIPARLIG---------EKEGTGAKIEVLLLKRKQDNTWETLVKPGRKAKPGTRI 108

Query: 116 HFFSQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDAR 175
            F    GQ +L   V D  + G  L+ F   GI  E  +  +G +PLPPYI  +     +
Sbjct: 109 SF----GQGKLVGEVTDIVDEGNRLVKFEFDGI-FEEVLDELGQMPLPPYITHQ----LK 159

Query: 176 DYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDT 235
           D   YQT YAK +GS AAPTAGLHFT  LL  +   GI++ +VTLHVG GTF PVKVED 
Sbjct: 160 DKNRYQTVYAKHEGSAAAPTAGLHFTKELLKEIEEKGIRLAYVTLHVGLGTFRPVKVEDV 219

Query: 236 DDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNI 295
            +H MHSE   +D   A+ +N  +  GGRI+SVGTTS R LE+A  E+G I P SG+T I
Sbjct: 220 TEHHMHSEFYVVDEEAAEKINKTRKEGGRIISVGTTSTRTLESAADENGFIEPKSGWTEI 279

Query: 296 FITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           FI PGY+F+ +D L++NFHLP+STLLMLVSA  G E   K Y  A+   YRF+S+GD
Sbjct: 280 FIYPGYKFKVIDGLITNFHLPESTLLMLVSALAGKEHILKAYDEAVKERYRFFSFGD 336


>gi|312863897|ref|ZP_07724135.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus vestibularis F0396]
 gi|311101433|gb|EFQ59638.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus vestibularis F0396]
          Length = 347

 Score =  282 bits (722), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 162/355 (45%), Positives = 220/355 (61%), Gaps = 21/355 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVIS--DHLVSDLPAFLNSNDA 58
           M   +FDF+LP   IA  P+  RD+++L+V+ P ++  +  +  DH++  L    N  DA
Sbjct: 1   MNTNDFDFELPEELIAQTPLEQRDASKLLVIDP-VTKEMTDTHFDHIIDQL----NPGDA 55

Query: 59  IVFNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFF 118
           +V NNT+V+ A+L G +    N     +   L      + W V A+P+K +K G  + F 
Sbjct: 56  LVMNNTRVLPARLYGEK----NDTHGHVEFLLLKNTQGDQWEVLAKPAKRLKVGAKVSF- 110

Query: 119 SQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYV 178
              G  RL ATV ++ + G  ++ FS +GI LE   SL G +PLPPYI  K  ++ RD  
Sbjct: 111 ---GDGRLTATVTEELDHGGRIVEFSYNGIFLEVLESL-GEMPLPPYIHEK--LEDRDR- 163

Query: 179 DYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDH 238
            YQT YAK  GS AAPTAGLHFT  LL  + + G+K+ ++TLHVG GTF PV V++ D+H
Sbjct: 164 -YQTVYAKENGSAAAPTAGLHFTPELLQNIEAKGVKLVYLTLHVGLGTFRPVSVDNVDEH 222

Query: 239 IMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFI 297
            MHSE   +    A  LNSVK+ GGRIV+VGTTS+R LET   + +G +   SG+TNIFI
Sbjct: 223 EMHSEFYTLSQEAADTLNSVKATGGRIVAVGTTSIRTLETIGNKYNGRLQAESGWTNIFI 282

Query: 298 TPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
            PGY+F  VD   +NFHLPKSTL+MLVSAF G E     Y+HA+   YRF+S+GD
Sbjct: 283 KPGYQFTVVDAFSTNFHLPKSTLVMLVSAFAGREFVLDAYKHAVQERYRFFSFGD 337


>gi|320546395|ref|ZP_08040710.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus equinus ATCC 9812]
 gi|320448780|gb|EFW89508.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus equinus ATCC 9812]
          Length = 342

 Score =  282 bits (722), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 163/355 (45%), Positives = 220/355 (61%), Gaps = 21/355 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVIS--DHLVSDLPAFLNSNDA 58
           M   +FDF+LP   IA  P+  RDS++L+V+  N +  +V +  DH++ +L    N  DA
Sbjct: 1   MNTNDFDFNLPEELIAQTPLEKRDSSKLLVIDRN-THEMVDAHFDHILDEL----NPGDA 55

Query: 59  IVFNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFF 118
           +V NNT+V+ A+L G +          +   L      + W V A+P+K ++ G  + F 
Sbjct: 56  LVMNNTRVLPARLYGEK----PETHGHVELLLLKNTEGDKWEVLAKPAKRLRVGTKVSF- 110

Query: 119 SQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYV 178
              G  RL ATV+++ + G  ++ F   GI LE   SL G +PLPPYI  K  +D  D  
Sbjct: 111 ---GDGRLTATVVEELDNGGRIVEFDYGGIFLEVLESL-GEMPLPPYIHEK--LDDPDR- 163

Query: 179 DYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDH 238
            YQT YAK  GS AAPTAGLHFT  LL ++ + G+K+ +VTLHVG GTF PV V++ ++H
Sbjct: 164 -YQTVYAKENGSAAAPTAGLHFTKELLEKIEAKGVKLVYVTLHVGLGTFRPVSVDNVEEH 222

Query: 239 IMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFI 297
            MHSE   +    AQ L  VK+ GGRIV+VGTTS+R LET  ++ +G I   SG+TNIFI
Sbjct: 223 EMHSEFYRLSEEAAQTLRDVKATGGRIVAVGTTSIRTLETIGSKFNGEIKADSGWTNIFI 282

Query: 298 TPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
            PGY F+ VD   +NFHLPKSTL+MLVSAF G E   + YQHAI   YRF+S+GD
Sbjct: 283 KPGYEFKVVDAFSTNFHLPKSTLVMLVSAFAGREFVLEAYQHAIDERYRFFSFGD 337


>gi|182418567|ref|ZP_02949847.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           butyricum 5521]
 gi|237667777|ref|ZP_04527761.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           butyricum E4 str. BoNT E BL5262]
 gi|182377570|gb|EDT75121.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           butyricum 5521]
 gi|237656125|gb|EEP53681.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           butyricum E4 str. BoNT E BL5262]
          Length = 341

 Score =  282 bits (721), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 151/356 (42%), Positives = 209/356 (58%), Gaps = 16/356 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M VK+FDF LP   IA  P+  RD++RLMV+         I   +  D+  +LN+ D +V
Sbjct: 1   MNVKDFDFYLPEELIAQHPLEKRDTSRLMVLDKKTGE---IEHKVFHDIVDYLNAGDTLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NNT+V+ A+L G +         +I   L  RV  + W   A+P K  + G    F   
Sbjct: 58  LNNTRVMPARLIGEK----EETGGKIEFLLLKRVEKDRWECLAKPGKSARVGRKFTF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G+ +L+A V++    G  ++ F   GI  E  +  +G +PLPPYI  +      D   Y
Sbjct: 111 -GEGKLKAEVVEVKENGNRIVEFHYEGI-FEEVLDSLGEMPLPPYIHER----LEDRERY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT Y+K  GS AAPTAGLHFT+ LL ++   GI V ++TLHVG GTF PVKVE+ ++H M
Sbjct: 165 QTVYSKENGSAAAPTAGLHFTNQLLEQIKEKGINVVYLTLHVGLGTFRPVKVENLEEHEM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   +   +A  +N  K  GGR++SVGTTS R LET   E+G++   SG+TNIFI PG
Sbjct: 225 HSEFYMLSKESADIINETKRNGGRVISVGTTSTRTLETIGDENGLVKEQSGWTNIFIYPG 284

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           Y+F+ VD L++NFHLP+STL+MLVS   G E     Y+ A+   YRF+S+GD   +
Sbjct: 285 YKFKVVDNLITNFHLPESTLIMLVSTLAGKEHVMNAYKTAVEEKYRFFSFGDAMFI 340


>gi|125973476|ref|YP_001037386.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           thermocellum ATCC 27405]
 gi|256005374|ref|ZP_05430339.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase [Clostridium
           thermocellum DSM 2360]
 gi|281417678|ref|ZP_06248698.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase [Clostridium
           thermocellum JW20]
 gi|166216717|sp|A3DE14|QUEA_CLOTH RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|125713701|gb|ABN52193.1| S-adenosylmethionine--tRNA ribosyltransferase-isomerase
           [Clostridium thermocellum ATCC 27405]
 gi|255990693|gb|EEU00810.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase [Clostridium
           thermocellum DSM 2360]
 gi|281409080|gb|EFB39338.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase [Clostridium
           thermocellum JW20]
 gi|316940286|gb|ADU74320.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase [Clostridium
           thermocellum DSM 1313]
          Length = 341

 Score =  282 bits (721), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 159/361 (44%), Positives = 212/361 (58%), Gaps = 26/361 (7%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V +F +DLP   IA  PV  RD +RLMV+         IS     D+  ++N  D +V
Sbjct: 1   MKVSDFYYDLPQELIAQEPVEKRDMSRLMVLDKETGK---ISHKRFKDIVEYINKGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKE-----ISCTLHMRVSPNSWSVYARPSKVIKKGDIL 115
            N+T+VI A+L G         EKE     I   L  R++ + W V  +P K  K G   
Sbjct: 58  LNDTRVIPARLLG---------EKEGTGGKIEFVLLKRINGDVWEVILKPGKKAKPGARF 108

Query: 116 HFFSQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDAR 175
            F    G   L+A VI+    G  L+ F   GI  E  +  +G +PLPPYI +K  +D  
Sbjct: 109 VF----GNGELKAEVIEIVEEGNRLVRFEYDGI-FEEILDRIGIVPLPPYITKK--LD-- 159

Query: 176 DYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDT 235
           D   YQT Y++ +GS AAPTAGLHFT  LL  L   G+K+ +VTLHVG GTF PVKVE+ 
Sbjct: 160 DAERYQTVYSRYKGSAAAPTAGLHFTLELLEELAGRGVKIAYVTLHVGLGTFRPVKVENL 219

Query: 236 DDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNI 295
           ++H MHSE   I       +NS K  GG+I++VGTTS R+LET   E+GI+ P SG+T+I
Sbjct: 220 EEHKMHSEFYRIKEEDCDKINSTKQNGGKIIAVGTTSCRVLETVGDENGIVRPQSGWTDI 279

Query: 296 FITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSL 355
           FI PGY+F+ VD L++NFHLP+STL+MLVSA  G E+  + Y  A+   YRF+S+GD   
Sbjct: 280 FIYPGYKFKVVDSLITNFHLPESTLIMLVSALAGREKILEAYNIAVKERYRFFSFGDAMF 339

Query: 356 L 356
           +
Sbjct: 340 I 340


>gi|125717594|ref|YP_001034727.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus sanguinis SK36]
 gi|166218750|sp|A3CLX2|QUEA_STRSV RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|125497511|gb|ABN44177.1| S-adenosylmethio nine:tRNA-ribosyltransferase-isomerase (queuine
           synthetase), putative [Streptococcus sanguinis SK36]
          Length = 342

 Score =  282 bits (721), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 160/353 (45%), Positives = 210/353 (59%), Gaps = 17/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +FDFDLP   IA  P+  RD++RL+VV          SD     +   L   DA+V
Sbjct: 1   MNTADFDFDLPEELIAQTPLEKRDASRLLVVDKETGA---FSDQHFDQIIDQLQPGDALV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NNT+V+ A+L G++          +   L      + W V A+P+K ++ G  + F   
Sbjct: 58  MNNTRVLPARLYGIK----PETGGHVELLLLKNTQGDDWEVLAKPAKRLRVGAQISF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL ATVI++   G  ++ FS  GI LE   SL G +PLPPYI  K      D   Y
Sbjct: 111 -GDGRLTATVIEELEHGGRIVRFSYEGIFLEVLESL-GEMPLPPYIHEKLA----DRERY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL ++ + G+K+ ++TLHVG GTF PV V+  DDH M
Sbjct: 165 QTVYAKENGSAAAPTAGLHFTEELLEQIAAKGVKLVYLTLHVGLGTFRPVSVDSLDDHEM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           HSE   +    AQ L  VK+ GGR+++VGTTS+R LET  ++  G I   SG+TNIFI P
Sbjct: 225 HSEFYSLSEEAAQTLRQVKANGGRVIAVGTTSIRTLETIGSKFQGQIQADSGWTNIFIKP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           GY ++ VD   +NFHLPKSTL+MLVSAF G   T + Y+HAI+  YRF+S+GD
Sbjct: 285 GYNWKVVDAFSTNFHLPKSTLVMLVSAFAGRSLTLEAYEHAIAERYRFFSFGD 337


>gi|313637715|gb|EFS03084.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Listeria
           seeligeri FSL S4-171]
          Length = 342

 Score =  282 bits (721), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 153/353 (43%), Positives = 216/353 (61%), Gaps = 17/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V++FDFDLP   IA  P+  R S+RLMV+         I D   +D+ ++L+  DA+V
Sbjct: 1   MKVEDFDFDLPEELIAQTPLLDRTSSRLMVLDKATGE---IKDQHFTDILSYLHEGDALV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+V+ A+L+G +    +     I   L  +   N+W    +P+K I++G  + F   
Sbjct: 58  LNDTRVLPARLHGTK----DETGAHIEVLLLKQKEGNAWETLVKPAKRIRQGATITF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G   L+AT +++   G  +L FS  GI  E  +  +G +PLPPYI  +     R    Y
Sbjct: 111 -GDGALKATCLEELEHGGRILEFSYEGIFYE-VLEQLGEMPLPPYIKEQLADQDR----Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT +LL+++ + G+++ FVTLHVG GTF PV VEDT +H M
Sbjct: 165 QTVYAKENGSAAAPTAGLHFTEDLLAKIKAKGVEIIFVTLHVGLGTFRPVDVEDTANHKM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLET-ATTEDGIINPWSGFTNIFITP 299
           HSE   +    A+ +N VK  GG++V+VGTTS+R LET A+  +G +   SG+T IFI+P
Sbjct: 225 HSEFYRLTEEAAERINKVKETGGKVVAVGTTSIRTLETIASRHEGELVAESGWTEIFISP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           GY F+AVD L++NFHLPKSTL+MLV       +    Y HA+   YRF+S+GD
Sbjct: 285 GYTFQAVDALITNFHLPKSTLIMLVXXLSDRNKILTAYNHAVEQQYRFFSFGD 337


>gi|325690109|gb|EGD32113.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus sanguinis SK115]
          Length = 343

 Score =  282 bits (721), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 159/353 (45%), Positives = 210/353 (59%), Gaps = 17/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +FDFDLP   IA  P+  RD++RL+VV          SD     +   L   DA+V
Sbjct: 2   MNTADFDFDLPEELIAQTPLEKRDASRLLVVDKETGA---FSDQHFDQIIDQLQPGDALV 58

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NNT+V+ A+L G++          +   L      + W V A+P+K ++ G  + F   
Sbjct: 59  MNNTRVLPARLYGIK----PETGGHVELLLLKNTQGDDWEVLAKPAKRLRVGAQISF--- 111

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL ATV+++ + G  ++ F   GI LE   SL G +PLPPYI  K      D   Y
Sbjct: 112 -GDGRLTATVVEELDHGGRIVRFGYEGIFLEVLESL-GEMPLPPYIHEKLA----DRERY 165

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL ++ + G+K+ ++TLHVG GTF PV V+  DDH M
Sbjct: 166 QTVYAKENGSAAAPTAGLHFTEELLEQIAAKGVKLVYLTLHVGLGTFRPVSVDSLDDHEM 225

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           HSE   +    AQ L  VK+ GGR+++VGTTS+R LET  ++  G I   SG+TNIFI P
Sbjct: 226 HSEFYSLSEEAAQTLRQVKANGGRVIAVGTTSIRTLETIGSKFQGQIQADSGWTNIFIKP 285

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           GY ++ VD   +NFHLPKSTL+MLVSAF G   T K Y+HAI+  YRF+S+GD
Sbjct: 286 GYDWKVVDAFSTNFHLPKSTLVMLVSAFAGRSLTLKAYEHAIAERYRFFSFGD 338


>gi|116627427|ref|YP_820046.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus thermophilus LMD-9]
 gi|122267975|sp|Q03LS2|QUEA_STRTD RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|116100704|gb|ABJ65850.1| S-adenosylmethionine:tRNA-ribosyltransferase-isomerase (queuine
           synthetase) [Streptococcus thermophilus LMD-9]
 gi|312277945|gb|ADQ62602.1| S-adenosylmethionine:tRNA-ribosyltransferase-isomerase (Queuine
           synthetase) [Streptococcus thermophilus ND03]
          Length = 347

 Score =  281 bits (720), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 162/354 (45%), Positives = 215/354 (60%), Gaps = 19/354 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHP-NLSCPLVISDHLVSDLPAFLNSNDAI 59
           M   +FDF+LP   IA  P+  RD+++L+V+ P          DH++  L    N  DA+
Sbjct: 1   MNTNDFDFELPEELIAQTPLEQRDASKLLVIDPVTREMTDTHFDHIIDQL----NPGDAL 56

Query: 60  VFNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFS 119
           V NNT+V+ A+L G +          +   L      + W V A+P+K +K G  + F  
Sbjct: 57  VMNNTRVLPARLYGEK----TDTHGHVEFLLLKNTQGDQWEVLAKPAKRLKVGAKVSF-- 110

Query: 120 QDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVD 179
             G  RL ATV  + + G  ++ FS  GI LE   SL G +PLPPYI  K  ++ RD   
Sbjct: 111 --GDGRLTATVTKELDHGGRIVEFSYDGIFLEVLESL-GEMPLPPYIHEK--LEDRDR-- 163

Query: 180 YQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHI 239
           YQT YAK  GS AAPTAGLHFT  LL ++ + G+K+ ++TLHVG GTF PV V++ D+H 
Sbjct: 164 YQTVYAKENGSAAAPTAGLHFTPELLQKIEAKGVKLVYLTLHVGLGTFRPVSVDNVDEHE 223

Query: 240 MHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFIT 298
           MHSE   +    A  LNSVK+ GGRIV+VGTTS+R LET   + DG +   SG+TNIFI 
Sbjct: 224 MHSEFYTLSQEAADTLNSVKAAGGRIVAVGTTSIRTLETIGNKYDGQLQADSGWTNIFIK 283

Query: 299 PGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           PGY+F  VD   +NFHLPKSTL+MLVSAF G E   + Y+HA+   YRF+S+GD
Sbjct: 284 PGYQFTVVDAFSTNFHLPKSTLVMLVSAFAGREFVLEAYKHAVQERYRFFSFGD 337


>gi|24379107|ref|NP_721062.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus mutans UA159]
 gi|46577053|sp|Q8DV72|QUEA_STRMU RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|24377009|gb|AAN58368.1|AE014907_5 putative S-adenosylmethionine--tRNA ribosyltransferase-isomerase
           [Streptococcus mutans UA159]
          Length = 342

 Score =  281 bits (720), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 160/354 (45%), Positives = 221/354 (62%), Gaps = 19/354 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVV-HPNLSCPLVISDHLVSDLPAFLNSNDAI 59
           M   +FDF+LP + IA  P+  RDS++L+VV H   +      DH++ +L    NS DA+
Sbjct: 1   MNTSDFDFNLPEALIAQTPLKKRDSSKLLVVDHQKKTMKDTHFDHIIDEL----NSGDAL 56

Query: 60  VFNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFS 119
           V N+T+V+ A+L+G +          +   L   +  + W V A+P+K +K G  + F  
Sbjct: 57  VMNDTRVLPARLHGEKTV----THGHVELLLLKNIQGDQWEVLAKPAKRLKVGSHISF-- 110

Query: 120 QDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVD 179
             G  RL+A + ++ + G  ++ FS  GI LE   SL G +PLPPYI  K  ++ RD   
Sbjct: 111 --GDGRLKAIIKEELDHGGRIVEFSYEGIFLEVLESL-GEMPLPPYIHEK--LEDRDR-- 163

Query: 180 YQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHI 239
           YQT YAK  GS AAPTAGLHFT  LLS++ + G+K+ ++TLHVG GTF PV V++ ++H 
Sbjct: 164 YQTVYAKENGSAAAPTAGLHFTEELLSKIEAKGVKLVYLTLHVGLGTFRPVSVDNVEEHQ 223

Query: 240 MHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFIT 298
           MHSE   +    AQ L  VK+ GGRIV+VGTTS+R LET   +  G I   SG+TNIFI 
Sbjct: 224 MHSEFYSLSPEAAQTLKDVKANGGRIVAVGTTSIRTLETIGNKFAGQIEADSGWTNIFIK 283

Query: 299 PGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           PGY+F+ VD   +NFHLPKSTL+MLVSAF G +     Y+HA+   YRF+S+GD
Sbjct: 284 PGYQFKIVDAFSTNFHLPKSTLVMLVSAFAGRDFILDAYKHAVDKHYRFFSFGD 337


>gi|94994643|ref|YP_602741.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pyogenes MGAS10750]
 gi|166218748|sp|Q1J5Y6|QUEA_STRPF RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|94548151|gb|ABF38197.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pyogenes MGAS10750]
          Length = 342

 Score =  281 bits (720), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 158/354 (44%), Positives = 217/354 (61%), Gaps = 19/354 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVV-HPNLSCPLVISDHLVSDLPAFLNSNDAI 59
           M   +FDF+LP   IA  P+  RDS++L+++ H   +      DH++  L    N  DA+
Sbjct: 1   MNTNDFDFELPEELIAQTPLEKRDSSKLLIIDHRQKTMVDSHFDHIIDQL----NPGDAL 56

Query: 60  VFNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFS 119
           V NNT+V+ A+L G +          +   L      + W V A+P+K +K G  ++F  
Sbjct: 57  VMNNTRVLPARLYGEK----PDTHGHVELLLLKNTQGDQWEVLAKPAKRLKVGSQVNF-- 110

Query: 120 QDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVD 179
             G  RL+AT+ID+   G  ++ FS  GI LE   SL G +PLPPYI  K     +D   
Sbjct: 111 --GDGRLKATIIDELEHGGRIVEFSYDGIFLEVLESL-GEMPLPPYIHEK----LKDAER 163

Query: 180 YQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHI 239
           YQT YAK  GS AAPTAGLHFT++LL ++ + G+ + ++TLHVG GTF PV V++ D+H 
Sbjct: 164 YQTVYAKENGSAAAPTAGLHFTTDLLKKIEAKGVHLVYLTLHVGLGTFRPVSVDNLDEHD 223

Query: 240 MHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFIT 298
           MHSE   +    AQ L  VK  GGR+V+VGTTS+R LET  ++  G I   SG+TNIFI 
Sbjct: 224 MHSEFYSLSEEAAQTLRDVKQAGGRVVAVGTTSIRTLETIGSKFQGDIQADSGWTNIFIK 283

Query: 299 PGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           PGY+F+ VD   +NFHLPKSTL+MLVSAF G +   + Y+HA+   YRF+S+GD
Sbjct: 284 PGYQFKVVDAFSTNFHLPKSTLVMLVSAFAGRDFVLEAYRHAVDEKYRFFSFGD 337


>gi|260887834|ref|ZP_05899097.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Selenomonas
           sputigena ATCC 35185]
 gi|330838599|ref|YP_004413179.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase [Selenomonas
           sputigena ATCC 35185]
 gi|260862440|gb|EEX76940.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Selenomonas
           sputigena ATCC 35185]
 gi|329746363|gb|AEB99719.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase [Selenomonas
           sputigena ATCC 35185]
          Length = 343

 Score =  281 bits (720), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 153/362 (42%), Positives = 215/362 (59%), Gaps = 23/362 (6%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M++K+FD++LP  RIA +P+ PR+++RLMV+ P       I      DL  FL   DA++
Sbjct: 1   MLLKDFDYELPEERIAQKPIEPRNASRLMVLDP---VAKTIEHRHFYDLGEFLAPGDALI 57

Query: 61  FNNTKVITAQLNGVRFCHINRRE---KEISCTLHMRVSPNSWSVYARPSKVIKKGDILHF 117
            N+T+V+ A+L G       RRE     I   L  R+  +SW    RP K  + G ++ F
Sbjct: 58  LNDTRVLPARLYG-------RREPTGAHIEVFLLRRLDKDSWETLVRPGKKAQVGQVIRF 110

Query: 118 FSQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDY 177
             +     L A V+   + G  ++ F   G+  E  +  +G  PLPPYI  +      D 
Sbjct: 111 SDE-----LCAEVMAHTDFGGRIVKFRYEGV-FEEILDRLGETPLPPYIHER----LEDK 160

Query: 178 VDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDD 237
             YQT Y + +GS AAPTAGLHFT   L+ L + G+ + FVTLHVG GTF PV VE  ++
Sbjct: 161 ERYQTVYCREEGSAAAPTAGLHFTREQLAELKAQGVHIGFVTLHVGLGTFRPVNVEKIEE 220

Query: 238 HIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFI 297
           H MHSE   +   TA+ +   K+ GGR+++VGTTS+R LE+A    G+I+  SG+T+IFI
Sbjct: 221 HKMHSEYYQLPEETAELIRRTKAAGGRVIAVGTTSIRTLESAAEAQGVISAKSGWTDIFI 280

Query: 298 TPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
            PGYRF+ VD L++NFHLPKSTLLML+SAF G E     Y+ A+   YRF+S+GD   L 
Sbjct: 281 YPGYRFKIVDALVTNFHLPKSTLLMLISAFAGREFVLHAYEEAVREKYRFFSFGDAMFLR 340

Query: 358 QK 359
           ++
Sbjct: 341 KR 342


>gi|294501379|ref|YP_003565079.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           megaterium QM B1551]
 gi|295706726|ref|YP_003599801.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           megaterium DSM 319]
 gi|294351316|gb|ADE71645.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           megaterium QM B1551]
 gi|294804385|gb|ADF41451.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           megaterium DSM 319]
          Length = 342

 Score =  281 bits (720), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 155/358 (43%), Positives = 214/358 (59%), Gaps = 17/358 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  FDF LP   IA  P+  RD++RLMV++        +  H+  DL  ++   D +V
Sbjct: 1   MKVDLFDFHLPEELIAQTPLEQRDASRLMVLNKETGS---VKHHMFHDLLDYVQEGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+V+ A+L G +          I   L  +   ++W    +P+K +K+G ++ F   
Sbjct: 58  LNDTRVLPARLFGTK----EDTGANIEVLLLKQTQGDTWETLVKPAKRVKEGTVISF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL A   +  + G  LL F+  GI  E  +  +G +PLPPYI  K  +D  D   Y
Sbjct: 111 -GDGRLTAVCKETSDQGGRLLEFNYEGIFYEV-LEQLGEMPLPPYI--KERLD--DQERY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT +A+ QGS AAPTAGLHFT  +L +L   G+ + F+TLHVG GTF PV V+D ++H M
Sbjct: 165 QTVFAREQGSAAAPTAGLHFTEEMLEQLKEKGVHIAFLTLHVGLGTFRPVSVDDLEEHDM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           HSE   +   TA  LNSV+ +GGRI+SVGTTS R LET  TE +G     SG+TNIFI P
Sbjct: 225 HSEFYQVSEGTAALLNSVREKGGRIISVGTTSTRTLETIATEHNGKFVASSGWTNIFIFP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           GY F+A+D +++NFHLPKSTL+MLVSA  G E     Y+ A++  YRF+S+GD  L+ 
Sbjct: 285 GYEFKAIDGMITNFHLPKSTLIMLVSALAGRENVISAYEQAVAEKYRFFSFGDAMLIL 342


>gi|327473324|gb|EGF18744.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus sanguinis SK408]
          Length = 342

 Score =  281 bits (719), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 158/354 (44%), Positives = 212/354 (59%), Gaps = 17/354 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +FDFDLP   IA  P+  RD++RL+VV          SD     +   L   DA+V
Sbjct: 1   MNTADFDFDLPEELIAQTPLEKRDASRLLVVDKETGA---FSDQHFDQIIDQLQPGDALV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NNT+V+ A+L G++          +   L   +  + W V A+P+K ++ G  + F   
Sbjct: 58  MNNTRVLPARLYGIK----PETGGHVELLLLKNIQGDDWEVLAKPAKRLRVGAQISF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL ATV+++ + G  ++ F   GI LE   SL G +PLPPYI  K      D   Y
Sbjct: 111 -GDGRLTATVVEELDHGGRIVRFGYEGIFLEVLESL-GEMPLPPYIHEKLA----DRERY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL ++ + G+K+ ++TLHVG GTF PV V+  DDH M
Sbjct: 165 QTVYAKENGSAAAPTAGLHFTEELLEQISAKGVKLVYLTLHVGLGTFRPVSVDSLDDHEM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           HSE   +    AQ L  VK++GGR+++VGTTS+R LET  ++  G I   SG+TNIFI P
Sbjct: 225 HSEFYSLSEEAAQILRQVKAKGGRVIAVGTTSIRTLETIGSKFQGQIQADSGWTNIFIKP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDT 353
           GY ++ VD   +NFHLPKSTL+MLVSAF G   T + Y+HAI+  YRF+S+GD 
Sbjct: 285 GYDWKVVDAFSTNFHLPKSTLVMLVSAFAGRSLTLEAYEHAIAERYRFFSFGDA 338


>gi|55822510|ref|YP_140951.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus thermophilus CNRZ1066]
 gi|81559694|sp|Q5M0W1|QUEA_STRT1 RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|55738495|gb|AAV62136.1| S-adenosylmethionine-tRNA ribosyltransferase-isomerase
           [Streptococcus thermophilus CNRZ1066]
          Length = 347

 Score =  281 bits (719), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 162/354 (45%), Positives = 216/354 (61%), Gaps = 19/354 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHP-NLSCPLVISDHLVSDLPAFLNSNDAI 59
           M   +FDF+LP   IA  P+  RD+++L+V+ P          DH++  L    N  DA+
Sbjct: 1   MNTNDFDFELPEELIAQTPLKQRDASKLLVIDPVTREMTDTHFDHIIDQL----NPRDAL 56

Query: 60  VFNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFS 119
           V NNT+V+ A+L G +          +   L      + W V A+P+K +K G  + F  
Sbjct: 57  VMNNTRVLPARLYGEK----TDTHGHVEFLLLKNTQGDQWEVLAKPAKRLKVGAKVSF-- 110

Query: 120 QDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVD 179
             G  RL ATV ++ + G  ++ FS  GI LE   SL G +PLPPYI  K  ++ RD   
Sbjct: 111 --GYGRLTATVTEELDHGGRIVEFSYDGIFLEVLESL-GEMPLPPYIHEK--LEDRDR-- 163

Query: 180 YQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHI 239
           YQT YAK  GS AAPTAGLHFT  LL ++ + G+K+ ++TLHVG GTF PV V++ D+H 
Sbjct: 164 YQTVYAKENGSAAAPTAGLHFTPELLQKIEAKGVKLVYLTLHVGLGTFRPVSVDNIDEHE 223

Query: 240 MHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFIT 298
           MHSE   +    A  LNSVK+ GGRIV+VGTTS+R LET   + DG +   SG+TNIFI 
Sbjct: 224 MHSEFYTLSQEAADTLNSVKTAGGRIVAVGTTSIRTLETIGNKYDGQLQADSGWTNIFIK 283

Query: 299 PGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           PGY+F  VD   +NFHLPKSTL+MLVSAF G E   + Y+HA+   YRF+S+GD
Sbjct: 284 PGYQFTVVDAFSTNFHLPKSTLVMLVSAFAGREFVLEAYKHAVQERYRFFSFGD 337


>gi|291522418|emb|CBK80711.1| S-adenosylmethionine--tRNA ribosyltransferase-isomerase
           [Coprococcus catus GD/7]
          Length = 341

 Score =  281 bits (719), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 159/356 (44%), Positives = 204/356 (57%), Gaps = 16/356 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +F +DLP   IA  P+  R S+RLMV+         IS H+  D+  +LN  D +V
Sbjct: 1   MKTSDFYYDLPEELIAQDPLEDRSSSRLMVLDRESG---EISHHIFKDIIDYLNPEDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+TKVI A+L GV+          I   L  R   + W    RP K  K G  L F   
Sbjct: 58  INDTKVIPARLYGVK----EDTGAHIEILLLKRRENDVWETLVRPGKKAKPGTRLTF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL+A VID    G  L+ F   GI  E  +  +G +PLPPYI  K     +D   Y
Sbjct: 111 -GDGRLKAEVIDVVEEGNRLIHFEYEGI-FEEILDQLGEMPLPPYITHK----LQDKNRY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK +GS AAPTAGLHFT  LL+ + + GI++  VTLHVG GTF PVKVED   H M
Sbjct: 165 QTVYAKHEGSAAAPTAGLHFTPELLAAIEAKGIRIARVTLHVGLGTFRPVKVEDVTQHHM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   +    A  +N  K RGGR+++VGTTS R LE+   EDG ++   G+T IFI PG
Sbjct: 225 HSEYYQVTQEAADIINDTKKRGGRVIAVGTTSTRTLESVADEDGTMHAAGGWTEIFIYPG 284

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           Y+F+ +D L++NFHLP+STLLMLVSA  G E     Y+ A+   YRF+S+GD   +
Sbjct: 285 YKFKCIDALITNFHLPESTLLMLVSALAGKEHIMHAYETAVQERYRFFSFGDAMFI 340


>gi|50914461|ref|YP_060433.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pyogenes MGAS10394]
 gi|68053076|sp|Q5XBG3|QUEA_STRP6 RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|50903535|gb|AAT87250.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pyogenes MGAS10394]
          Length = 342

 Score =  281 bits (719), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 159/354 (44%), Positives = 216/354 (61%), Gaps = 19/354 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVV-HPNLSCPLVISDHLVSDLPAFLNSNDAI 59
           M   +FDF+LP   IA  P+  RDS++L+++ H   +      DH++  L    N  DA+
Sbjct: 1   MNTNDFDFELPEELIAQTPLEKRDSSKLLIIDHRQKTMVDSHFDHIIDQL----NPGDAL 56

Query: 60  VFNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFS 119
           V NNT+V+ A+L G +          +   L      + W V A+P+K +K G  ++F  
Sbjct: 57  VMNNTRVLPARLYGEK----PDTHGHVELLLLKNTQGDQWEVLAKPAKRLKVGSQVNF-- 110

Query: 120 QDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVD 179
             G  RL+AT+ID+   G  ++ FS  GI LE   SL G +PLPPYI  K      D   
Sbjct: 111 --GDGRLKATIIDELEHGGRIVEFSYDGIFLEVLESL-GEMPLPPYIHEK----LEDAER 163

Query: 180 YQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHI 239
           YQT YAK  GS AAPTAGLHFT++LL ++ + G+ + ++TLHVG GTF PV V++ D+H 
Sbjct: 164 YQTVYAKENGSAAAPTAGLHFTTDLLKKIEAKGVHLVYLTLHVGLGTFRPVSVDNLDEHD 223

Query: 240 MHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFIT 298
           MHSE   +    AQ L  VK  GGR+V+VGTTS+R LET  ++  G I   SG+TNIFI 
Sbjct: 224 MHSEFYSLSEEAAQTLRDVKQAGGRVVAVGTTSIRTLETIGSKFQGDIQADSGWTNIFIK 283

Query: 299 PGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           PGY+F+ VD   +NFHLPKSTL+MLVSAF G +   + Y+HAI   YRF+S+GD
Sbjct: 284 PGYQFKVVDAFSTNFHLPKSTLVMLVSAFAGRDFVLEAYRHAIDEKYRFFSFGD 337


>gi|85705247|ref|ZP_01036346.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Roseovarius
           sp. 217]
 gi|85670120|gb|EAQ24982.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Roseovarius
           sp. 217]
          Length = 362

 Score =  281 bits (719), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 160/358 (44%), Positives = 221/358 (61%), Gaps = 13/358 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FDFDLP + IA RP  PR +ARL+V          I+D  V+DL  +L   D +V
Sbjct: 1   MKLSDFDFDLPEALIATRPARPRRAARLLVAEGA-----AITDAGVADLGRWLRPGDRLV 55

Query: 61  FNNTKVITAQLNGVRFCHINRRE--KEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFF 118
            N+T+VI A+L+G+R     + +   +I  TL    +  +W    +P K +  G+ + F 
Sbjct: 56  LNDTRVIPARLSGLRHRSGAQGDTAAKIEVTLLEPGAEGTWGALIKPLKKVSVGEEIVF- 114

Query: 119 SQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYV 178
                 RL A V++    G+  L F++   + +  ++  G +PLPPYIA +RP D +D V
Sbjct: 115 ----SERLSA-VLEAKEEGQGRLRFNLRAEDFDAALAEAGAMPLPPYIAARRPADDQDKV 169

Query: 179 DYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDH 238
           DYQT +A+  G+VAAPTA LHF   LL+ L ++G+    VTLHVGAGTF+PVKVED   H
Sbjct: 170 DYQTVWARAPGAVAAPTASLHFDEALLAELAAMGVGFTHVTLHVGAGTFLPVKVEDVTSH 229

Query: 239 IMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFIT 298
            MH+E G +    A  + + ++ GGRI+ VGTT+LRL+ETA    G I  WSG T+IFI 
Sbjct: 230 KMHAEWGEVSEEAAAEIAATRAAGGRIIPVGTTALRLIETAARATGEIAAWSGDTDIFIY 289

Query: 299 PGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           PG+ FR  D LM+NFHLPKSTL+MLVSA  G     ++Y HA++  YRF+SYGD SLL
Sbjct: 290 PGFEFRVTDALMTNFHLPKSTLMMLVSALMGQGVIDRIYAHAVARGYRFFSYGDASLL 347


>gi|325694040|gb|EGD35958.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus sanguinis SK150]
          Length = 342

 Score =  281 bits (719), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 159/353 (45%), Positives = 210/353 (59%), Gaps = 17/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +FDFDLP   IA  P+  RD++RL+VV        V SD     +   L   DA+V
Sbjct: 1   MNTADFDFDLPEELIAQTPLEKRDASRLLVVDKETG---VFSDQHFDQIIDQLQPGDALV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NNT+V+ A+L G++          +   L      + W V A+P+K ++ G  + F   
Sbjct: 58  MNNTRVLPARLYGIK----PETGGHVELLLLKNTQGDDWEVLAKPAKRLRVGSQISF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL ATV+++ + G  ++ F   GI LE   SL G +PLPPYI  K     R    Y
Sbjct: 111 -GDGRLTATVVEELDHGGRIVRFGYEGIFLEVLESL-GEMPLPPYIHEKLADRER----Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL ++   G+K+ ++TLHVG GTF PV V+  DDH M
Sbjct: 165 QTVYAKENGSAAAPTAGLHFTEELLEQIADKGVKLVYLTLHVGLGTFRPVSVDSLDDHEM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           HSE   +    AQ L  VK+ GGR+++VGTTS+R LET  ++  G I   SG+TNIFI P
Sbjct: 225 HSEFYSLSEEAAQTLRQVKANGGRVIAVGTTSIRTLETIGSKFQGQIQADSGWTNIFIKP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           GY ++ VD   +NFHLPKSTL+MLVSAF G   T + Y+HAI+  YRF+S+GD
Sbjct: 285 GYDWKVVDAFSTNFHLPKSTLVMLVSAFAGRSLTLEAYEHAIAERYRFFSFGD 337


>gi|239624077|ref|ZP_04667108.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47_FAA]
 gi|239522108|gb|EEQ61974.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47FAA]
          Length = 358

 Score =  281 bits (718), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 151/356 (42%), Positives = 214/356 (60%), Gaps = 16/356 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M VK+F FDLP   IA  P+  R S+RL+V+  +      +   +  D+  +L   D +V
Sbjct: 10  MDVKDFYFDLPEELIAQDPLKDRSSSRLLVLDKDTG---EVQHRVFRDIVEYLRPGDCLV 66

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+TKVI A+L GV+         +I   L  R   + W    RP K  + G ++ F   
Sbjct: 67  INDTKVIPARLFGVK----KDTGAKIEVLLLKRRENDIWETLVRPGKKCRPGTVIEF--- 119

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G+  L  TV++  + G  L+ FS  GI  E  +  +G +PLPPYI      + +D   Y
Sbjct: 120 -GEGLLSGTVVETVDDGNRLIRFSYKGI-FEEILDQLGQMPLPPYITH----ELKDKNRY 173

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK +GS AAPTAGLHFT+ LL ++  +G+++  VTLHVG GTF PVKVE+  DH M
Sbjct: 174 QTVYAKHEGSAAAPTAGLHFTNELLKQIEDMGVRIAHVTLHVGLGTFRPVKVENVLDHHM 233

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   ++   A+ +N  K+ GGR++ VGTTS R +E+A+T+DGI+   +G+T IFI PG
Sbjct: 234 HSEFYVVEESEAKKVNDTKAAGGRVICVGTTSCRTVESASTDDGILQAKTGWTEIFIYPG 293

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           YRF+ +D L++NFHLP+STL+MLVSA  G E     Y+ A+   YRF+S+GD   +
Sbjct: 294 YRFKVLDALITNFHLPESTLVMLVSALAGREHILDAYKEAVRERYRFFSFGDAMFI 349


>gi|323127653|gb|ADX24950.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus dysgalactiae subsp. equisimilis ATCC
           12394]
          Length = 342

 Score =  281 bits (718), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 159/354 (44%), Positives = 214/354 (60%), Gaps = 19/354 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVV-HPNLSCPLVISDHLVSDLPAFLNSNDAI 59
           M   +FDFDLP   IA  P+  RDS++L+++ H   +      DH++  L    N  DA+
Sbjct: 1   MNTNDFDFDLPEELIAQTPLEKRDSSKLLIIDHEQKTMIDSHFDHIIDQL----NPGDAL 56

Query: 60  VFNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFS 119
           V NNT+V+ A+L G +          +   L      + W V A+P+K +K G  + F  
Sbjct: 57  VMNNTRVLPARLYGEK----PDTHGHVELLLLKNTHGDQWEVLAKPAKRLKVGSQVSF-- 110

Query: 120 QDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVD 179
             G  RL AT++++   G  ++ F+  GI LE   SL G +PLPPYI  K     R    
Sbjct: 111 --GDGRLTATIVEELEHGGRIVEFNYEGIFLEVLESL-GEMPLPPYIHEKLDDAER---- 163

Query: 180 YQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHI 239
           YQT YAK  GS AAPTAGLHFT+NLLS++ + G+ + ++TLHVG GTF PV V++ DDH 
Sbjct: 164 YQTVYAKENGSAAAPTAGLHFTTNLLSKIEAKGVHLVYLTLHVGLGTFRPVSVDNLDDHD 223

Query: 240 MHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFIT 298
           MHSE   +    AQ L  VK  GGR+V+VGTTS+R LET  ++  G I   SG+TNIFI 
Sbjct: 224 MHSEFYSLSEEAAQTLRDVKKAGGRVVAVGTTSIRTLETIGSKFQGDIQADSGWTNIFIK 283

Query: 299 PGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           PGY+F+ VD   +NFHLPKSTL+MLVSAF G +     Y+HA+   YRF+S+GD
Sbjct: 284 PGYQFKVVDAFSTNFHLPKSTLVMLVSAFAGRDFVLDAYKHAVDEKYRFFSFGD 337


>gi|328945507|gb|EGG39658.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus sanguinis SK1087]
          Length = 342

 Score =  281 bits (718), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 158/353 (44%), Positives = 211/353 (59%), Gaps = 17/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +FDFDLP   IA  P+  RD++RL+VV          SD     +   L   DA+V
Sbjct: 1   MNTADFDFDLPEELIAQTPLEKRDASRLLVVDKETGA---FSDQHFDQIIDQLQPGDALV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NNT+V+ A+L G++          +   L      + W V A+P+K ++ G  + F   
Sbjct: 58  MNNTRVLPARLYGIK----PETGGHVELLLLKNTQGDDWEVLAKPAKRLRVGAQISF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL ATV+++ + G  ++ F+  GI LE   SL G +PLPPYI  K      D   Y
Sbjct: 111 -GDGRLTATVVEELDHGGRIVRFAYEGIFLEVLESL-GEMPLPPYIHEKLA----DRERY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL ++ + G+K+ ++TLHVG GTF PV V+  DDH M
Sbjct: 165 QTVYAKENGSAAAPTAGLHFTEELLEQIAAKGVKLVYLTLHVGLGTFRPVSVDSLDDHEM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           HSE   +    AQ L  VK+ GGR+++VGTTS+R LET  ++  G I   SG+TNIFI P
Sbjct: 225 HSEFYSLSEEAAQTLRQVKANGGRVIAVGTTSIRTLETIGSKFQGQIQADSGWTNIFIKP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           GY ++ VD   +NFHLPKSTL+MLVSAF G   T + Y+HAI+  YRF+S+GD
Sbjct: 285 GYDWKVVDAFSTNFHLPKSTLVMLVSAFAGRSLTLEAYEHAIAERYRFFSFGD 337


>gi|188589166|ref|YP_001920353.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           botulinum E3 str. Alaska E43]
 gi|251778245|ref|ZP_04821165.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           botulinum E1 str. 'BoNT E Beluga']
 gi|238689663|sp|B2V339|QUEA_CLOBA RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|188499447|gb|ACD52583.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           botulinum E3 str. Alaska E43]
 gi|243082560|gb|EES48450.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           botulinum E1 str. 'BoNT E Beluga']
          Length = 341

 Score =  281 bits (718), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 157/361 (43%), Positives = 205/361 (56%), Gaps = 26/361 (7%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M VK+FDF LP   IA  P+  RD++RLMV+         IS     D+  +LN  D +V
Sbjct: 1   MNVKDFDFYLPEELIAQHPLEKRDTSRLMVLDKETGE---ISHKNFYDIIDYLNEGDTLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKE-----ISCTLHMRVSPNSWSVYARPSKVIKKGDIL 115
            NNT+V+ A+L G         EKE     I   L  RV  + W   A+P K  + G   
Sbjct: 58  LNNTRVMPARLIG---------EKEGTGGKIEFLLLKRVDKDRWECLAKPGKSARVGRRF 108

Query: 116 HFFSQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDAR 175
            F    G  +L+A V++    G  ++ F   GI  E  +  +G +PLPPYI  +      
Sbjct: 109 TF----GDGKLKAEVVEVKENGNRIVEFYYEGI-FEEVLDSLGEMPLPPYIHER----LE 159

Query: 176 DYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDT 235
           D   YQT Y+K  GS AAPTAGLHFT  LL ++   GI + +VTLHVG GTF PVKVE  
Sbjct: 160 DRERYQTVYSKENGSAAAPTAGLHFTEELLHKIKEKGINIAYVTLHVGLGTFRPVKVETI 219

Query: 236 DDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNI 295
           +DH MHSE   +    A+ +N  K RG R++SVGTTS R LET   EDG +   SG+TNI
Sbjct: 220 EDHEMHSEYYHLSKEDAEVINETKKRGNRVISVGTTSTRTLETIADEDGNVKETSGWTNI 279

Query: 296 FITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSL 355
           FI PGY+F+ VD L++NFHLP+STL+MLVS   G E     Y+ A+   YRF+S+GD   
Sbjct: 280 FIYPGYKFKVVDRLITNFHLPESTLIMLVSTLAGKEHVMNAYEEAVKERYRFFSFGDAMF 339

Query: 356 L 356
           +
Sbjct: 340 I 340


>gi|20807638|ref|NP_622809.1| S-adenosylmethionine:tRNA-ribosyltransferase-isomerase (queuine
           synthetase) [Thermoanaerobacter tengcongensis MB4]
 gi|22096013|sp|Q8RAN0|QUEA_THETN RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|20516181|gb|AAM24413.1| S-adenosylmethionine:tRNA-ribosyltransferase-isomerase (queuine
           synthetase) [Thermoanaerobacter tengcongensis MB4]
          Length = 341

 Score =  281 bits (718), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 152/356 (42%), Positives = 208/356 (58%), Gaps = 16/356 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   EF FDLP   IA  P+  R S+RLM++         I   +  ++  +L   D +V
Sbjct: 1   MKRSEFYFDLPEELIAQEPLEDRASSRLMILDRRTGE---IKHDIFKNITKYLKEGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+TKVI A+L G R         ++   L  R S N W V  +P K  K G  + F   
Sbjct: 58  LNDTKVIPARLIGQR----EDSGGKVELLLLRRTSMNEWEVLVKPGKRAKVGKRVVF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G   L A +ID    G  +  F   G+  E  +  +G +P+PPYI +K     +D   Y
Sbjct: 111 -GNGELVAEIIDTTEAGGRIARFYYDGV-FEEVLDRLGEMPVPPYIKKK----LKDKNRY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK +GS AAPTAGLHFT  LL  + ++G+K  F+TLHVG GTF PVK E  ++H M
Sbjct: 165 QTVYAKYEGSAAAPTAGLHFTEELLDEIRNMGVKTVFITLHVGLGTFRPVKEEIIENHKM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           H E   +    A+A+N  +  GGRI++VGTTS R LET   E G I+P SG+T+IFI PG
Sbjct: 225 HEEFYIVTEEAAKAINEARKNGGRIIAVGTTSTRTLETVADESGYIHPKSGWTDIFIYPG 284

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           Y+F+A+D +++NFHLP+STL+M+VSAF G E   + Y+ AI + YRF+S+GD  L+
Sbjct: 285 YKFKAIDGMITNFHLPESTLIMMVSAFAGKENIMRAYKVAIENKYRFFSFGDAMLI 340


>gi|288555345|ref|YP_003427280.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           pseudofirmus OF4]
 gi|288546505|gb|ADC50388.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           pseudofirmus OF4]
          Length = 341

 Score =  281 bits (718), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 153/352 (43%), Positives = 215/352 (61%), Gaps = 16/352 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V++FDF LP   IA  P+  R ++RL+V+  +      I D + S +  +L S D +V
Sbjct: 1   MDVRDFDFYLPDELIAQTPLLDRTASRLLVLDKDNGA---IKDDVFSSITDYLKSGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+V+ A+L GV+         +I   L  ++  + W   A+P+K +KKG  + F   
Sbjct: 58  LNDTRVLPARLYGVK----EDTGAKIELLLLKQLEGDKWETLAKPAKRVKKGTTITF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G+  L AT I++ + G  ++  +  GI L   +  +G +PLPPYI  K  +D  D   Y
Sbjct: 111 -GEGLLTATCIEETDQGGRVVELAYEGI-LHEVLDQLGEMPLPPYI--KEQLD--DQERY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT +AK +GS AAPTAGLHFT +LL  L   G+ + F+TLHVG GTF PV VED + H M
Sbjct: 165 QTVFAKNRGSAAAPTAGLHFTEDLLQTLQDKGVHLAFITLHVGLGTFRPVSVEDVESHEM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           H+E   +   TA+ LN VK  GG++V+VGTTS R LET   E+G     SG+T+IFI PG
Sbjct: 225 HAEYYQMSEGTARLLNEVKENGGKVVAVGTTSARTLETIMNENGTYCEASGWTSIFIYPG 284

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           Y+F+ +D L++NFHLPKSTL+MLVSA  G E   + Y HA+   YRF+S+GD
Sbjct: 285 YKFKGIDGLLTNFHLPKSTLVMLVSALAGREHILQAYNHAVKERYRFFSFGD 336


>gi|15613790|ref|NP_242093.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           halodurans C-125]
 gi|20139775|sp|Q9KDI6|QUEA_BACHD RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|10173843|dbj|BAB04946.1| S-adenosylmethionine tRNA ribosyltransferase [Bacillus halodurans
           C-125]
          Length = 347

 Score =  281 bits (718), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 152/360 (42%), Positives = 215/360 (59%), Gaps = 16/360 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V++FDF LP   IA  P+  R ++RL+V+  +      + D    DL  F+ + D +V
Sbjct: 1   MNVRDFDFHLPEKLIAQTPLKDRTASRLLVLDKHTGA---VEDKKFPDLLQFIEAGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+V+ A+L GV+         ++   L  ++  + W    +P+K +K G I+ F   
Sbjct: 58  LNDTRVLPARLFGVK----EETGAQVEVLLLKQMEGDRWETLVKPAKRLKVGTIIRF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G   L AT + +   G  +L FS  GI     +  +G +PLPPYI  K  +D +D   Y
Sbjct: 111 -GNGELTATCVQELEHGGRVLEFSYEGI-FHEVLDQLGEMPLPPYI--KEQLDDKDR--Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT +AK +GS AAPTAGLHFT  LL +L   G+ + F+TLHVG GTF PV VE+ ++H M
Sbjct: 165 QTVFAKNRGSAAAPTAGLHFTEELLDQLKQKGVHLAFITLHVGLGTFRPVSVEEIEEHEM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           H+E   + A TA+ LN VK +GGRI++VGTTS R LET   E       SG+T+IFI PG
Sbjct: 225 HAEFYQMSAGTARLLNEVKRQGGRIIAVGTTSARTLETIRQEHDEFVETSGWTSIFIYPG 284

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLFQKR 360
           Y F+ +D L++NFHLPKSTL+MLVSA  G E     Y HA+  +YRF+S+GD   ++ K+
Sbjct: 285 YEFKGIDGLITNFHLPKSTLVMLVSALAGRENLLNAYAHAVKQSYRFFSFGDAMFIYDKK 344


>gi|319790693|ref|YP_004152326.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Thermovibrio ammonificans HB-1]
 gi|317115195|gb|ADU97685.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Thermovibrio ammonificans HB-1]
          Length = 343

 Score =  281 bits (718), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 161/358 (44%), Positives = 208/358 (58%), Gaps = 18/358 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V +FD+ LP   IA  P  PRDSARLMV+H +      I   +  D+  +L   D +V
Sbjct: 1   MKVSDFDYHLPKELIAKFPAEPRDSARLMVLHRDTGE---IEHRIFRDIVDYLVPGDVLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+TKVI A+L G R     +    +   L  +V P+ W V A+P+K +K G  L F   
Sbjct: 58  LNDTKVIPARLLG-RLSTGAK----VELLLLRQVEPDLWEVMAKPAKKLKTGKELVF--- 109

Query: 121 DGQSRLEATVIDKWNTGEILLVFSI-SGIELERQISLVGTIPLPPYIARK-RPIDARDYV 178
             +  L  TV      G  L+ F +  G+     +  VG +PLPPYI R+ RP D + Y 
Sbjct: 110 --EGGLRGTVEGYAGEGRRLVRFRVPEGVSFMELLEQVGHVPLPPYIEREERPEDRKLY- 166

Query: 179 DYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDH 238
             QT +A   G+VAAPTAGLHFT  LL RL   GI +  VTLHVG GTF PVKVE+ + H
Sbjct: 167 --QTVFASRPGAVAAPTAGLHFTEELLERLRDKGIIIKTVTLHVGPGTFKPVKVEEVEKH 224

Query: 239 IMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFIT 298
            M  E+  +   TA  +N  K  G RIV+VGTT +R LE+A  EDG +    G TN+FI 
Sbjct: 225 QMDYEVYSVPQETALEVNRAKQEGRRIVAVGTTVVRTLESAAGEDGTVKAGEGSTNLFIY 284

Query: 299 PGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           PGYRF+ VD L++NFHLP+STL+MLVSAF G E+    Y+ A+   YRFYSYGD   +
Sbjct: 285 PGYRFKVVDALVTNFHLPRSTLIMLVSAFAGREKVLNAYREAVKEGYRFYSYGDAMFI 342


>gi|290580879|ref|YP_003485271.1| putative S-adenosylmethionine--tRNA ribosyltransferase-isomerase
           [Streptococcus mutans NN2025]
 gi|254997778|dbj|BAH88379.1| putative S-adenosylmethionine--tRNA ribosyltransferase-isomerase
           [Streptococcus mutans NN2025]
          Length = 342

 Score =  281 bits (718), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 159/354 (44%), Positives = 220/354 (62%), Gaps = 19/354 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVV-HPNLSCPLVISDHLVSDLPAFLNSNDAI 59
           M   +FDF+LP + IA  P+  RDS++L+VV H   +      DH++ +L    N  DA+
Sbjct: 1   MNTSDFDFNLPEALIAQTPLKKRDSSKLLVVDHQKKTMKDTHFDHIIDEL----NPGDAL 56

Query: 60  VFNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFS 119
           V N+T+V+ A+L+G +          +   L   +  + W V A+P+K +K G  + F  
Sbjct: 57  VMNDTRVLPARLHGEKTV----THGHVELLLLKNIQGDQWEVLAKPAKRLKIGSHISF-- 110

Query: 120 QDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVD 179
             G  RL+A + ++ N G  ++ FS  GI LE   SL G +PLPPYI  K  ++ RD   
Sbjct: 111 --GDGRLKAIIKEELNHGGRIVEFSYEGIFLEVLESL-GEMPLPPYIHEK--LEDRDR-- 163

Query: 180 YQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHI 239
           YQT YAK  GS AAPTAGLHFT  LLS++ + G+K+ ++TLHVG GTF PV V++ ++H 
Sbjct: 164 YQTVYAKENGSAAAPTAGLHFTEELLSKIEAKGVKLVYLTLHVGLGTFRPVSVDNVEEHQ 223

Query: 240 MHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFIT 298
           MHSE   +    AQ L  +K+ GGRIV+VGTTS+R LET   +  G I   SG+TNIFI 
Sbjct: 224 MHSEFYSLSPEAAQTLKDIKANGGRIVAVGTTSIRTLETIGNKFAGQIEADSGWTNIFIK 283

Query: 299 PGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           PGY+F+ VD   +NFHLPKSTL+MLVSAF G +     Y+HA+   YRF+S+GD
Sbjct: 284 PGYQFKIVDAFSTNFHLPKSTLVMLVSAFAGRDFILDAYKHAVDKHYRFFSFGD 337


>gi|19746363|ref|NP_607499.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pyogenes MGAS8232]
 gi|306827089|ref|ZP_07460386.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pyogenes ATCC 10782]
 gi|24212183|sp|Q8P0D9|QUEA_STRP8 RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|19748559|gb|AAL97998.1| putative S-adenosylmethionine-tRNA ribosyltransferase-isomerase
           [Streptococcus pyogenes MGAS8232]
 gi|304430723|gb|EFM33735.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pyogenes ATCC 10782]
          Length = 342

 Score =  280 bits (717), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 158/354 (44%), Positives = 216/354 (61%), Gaps = 19/354 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVV-HPNLSCPLVISDHLVSDLPAFLNSNDAI 59
           M   +FDF+LP   IA  P+  RDS++L+++ H   +      DH++  L    N  DA+
Sbjct: 1   MNTNDFDFELPEELIAQTPLEKRDSSKLLIIDHRQKTMVDSHFDHIIDQL----NPGDAL 56

Query: 60  VFNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFS 119
           V NNT+V+ A+L G +          +   L      + W V A+P+K +K G  ++F  
Sbjct: 57  VMNNTRVLPARLYGEK----PDTHGHVELLLLKNTQGDQWEVLAKPAKRLKVGSQVNF-- 110

Query: 120 QDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVD 179
             G  RL+AT+ID+   G  ++ FS  GI LE   SL G +PLPPYI  K      D   
Sbjct: 111 --GDGRLKATIIDELEHGGRIVEFSYDGIFLEVLESL-GEMPLPPYIHEK----LEDAER 163

Query: 180 YQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHI 239
           YQT YAK  GS AAPTAGLHFT++LL ++ + G+ + ++TLHVG GTF PV V++ D+H 
Sbjct: 164 YQTVYAKENGSAAAPTAGLHFTTDLLKKIEAKGVHLVYLTLHVGLGTFRPVSVDNLDEHD 223

Query: 240 MHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFIT 298
           MHSE   +    AQ L  VK  GGR+V+VGTTS+R LET  ++  G I   SG+TNIFI 
Sbjct: 224 MHSEFYSLSEEAAQTLRDVKQAGGRVVAVGTTSIRTLETIGSKFQGDIQADSGWTNIFIK 283

Query: 299 PGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           PGY+F+ VD   +NFHLPKSTL+MLVSAF G +   + Y+HA+   YRF+S+GD
Sbjct: 284 PGYQFKVVDAFSTNFHLPKSTLVMLVSAFAGRDFVLEAYRHAVDEKYRFFSFGD 337


>gi|296132706|ref|YP_003639953.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase [Thermincola
           sp. JR]
 gi|296031284|gb|ADG82052.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase [Thermincola
           potens JR]
          Length = 341

 Score =  280 bits (717), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 157/357 (43%), Positives = 212/357 (59%), Gaps = 16/357 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V +FDF+LP   IA  PV PRD +RL+VV+ +      I      +   ++   D +V
Sbjct: 1   MKVADFDFELPEELIAQEPVEPRDHSRLLVVNRDNGN---IEHKRFYNCIDYIEPGDVLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NNT+V+ A+L    F        +I   L  R+  + W V  +P K +K G ++ F   
Sbjct: 58  VNNTRVLPARL----FGEKKGSGAKIEFVLLKRIDRDKWEVLVKPGKRVKPGTVILF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G   LEA V+    +G  L+ F   GI  E  +   G +PLPPYI  K+ +D R+   Y
Sbjct: 111 -GGGLLEAFVLQTTESGGRLVEFRYEGI-FEELLDRFGQMPLPPYI--KKQLDDRER--Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL ++   G+ +  V LHVG GTF PVKV++ +DH M
Sbjct: 165 QTVYAKASGSAAAPTAGLHFTEELLKKMHEKGVVIAEVMLHVGLGTFRPVKVDNVEDHRM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           H+E   I+  TA  +N  + RG +I++VGTTS R LETA    G + P  G+T+IFI PG
Sbjct: 225 HAEYYEINEETANLINRQRDRGHKIIAVGTTSCRALETAADSSGNLKPGCGWTDIFIFPG 284

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           YRF+AVD L++NFHLPKSTL+MLVSAF G +   K YQ AI+  YRF+S+GD  ++ 
Sbjct: 285 YRFKAVDRLITNFHLPKSTLVMLVSAFAGKDLIMKAYQEAIAEKYRFFSFGDAMMIL 341


>gi|158320752|ref|YP_001513259.1| S-adenosylmethionine--tRNA-ribosyltransferase-isomerase
           [Alkaliphilus oremlandii OhILAs]
 gi|158140951|gb|ABW19263.1| S-adenosylmethionine--tRNA-ribosyltransferase-isomerase
           [Alkaliphilus oremlandii OhILAs]
          Length = 341

 Score =  280 bits (717), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 156/356 (43%), Positives = 205/356 (57%), Gaps = 16/356 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M  K+FD+DLP   IA  P+  RD +RLMV+         I+     D+  FLN  D +V
Sbjct: 1   METKDFDYDLPEELIAQVPLEHRDQSRLMVLDKETGD---IAHRHFYDIIDFLNEGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+V+ A+L G +     +    I   L  R+  ++W    +P K  K G    F   
Sbjct: 58  LNDTRVLPARLIGEKEGSGGK----IEFLLLKRIELDTWEALVKPGKKAKVGSRFIF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL   VI     G  ++ F   G+  E  +  +G +PLPPYI  K      D   Y
Sbjct: 111 -GDGRLCTEVIGIGEEGSRIIKFQYDGV-FEDILDQLGQMPLPPYITEK----LEDKERY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT Y+K QGS AAPTAGLHFTS LL +L   G+K  ++TLHVG GTF PVKVE  ++H M
Sbjct: 165 QTVYSKNQGSAAAPTAGLHFTSELLKKLEEKGVKTAYITLHVGLGTFRPVKVEKIEEHTM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   ID   A  +N  K+ G RI++VGTTS R LE+  T+DGII P SG+T+IFI PG
Sbjct: 225 HSEFYTIDDKNANIINEAKANGKRIIAVGTTSCRTLESVATKDGIIEPKSGWTDIFIYPG 284

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           Y F+ VD L++NFHLP+STL+MLVS   G E T   Y+ A+   YRF+S+GD   +
Sbjct: 285 YDFKIVDNLITNFHLPESTLIMLVSTLAGKEATLNAYKIAVKEGYRFFSFGDAMFI 340


>gi|238924342|ref|YP_002937858.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Eubacterium
           rectale ATCC 33656]
 gi|238876017|gb|ACR75724.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Eubacterium
           rectale ATCC 33656]
 gi|291529393|emb|CBK94979.1| S-adenosylmethionine--tRNA ribosyltransferase-isomerase
           [Eubacterium rectale M104/1]
          Length = 352

 Score =  280 bits (717), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 155/356 (43%), Positives = 207/356 (58%), Gaps = 16/356 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M VK+FD+DLP   IA  P+  R S+RLMV+         +S H+  ++  +L   D +V
Sbjct: 1   MDVKDFDYDLPEELIAQDPLEDRSSSRLMVLDKKTG---EVSHHVFKEIVKYLRPGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NNTKVI A+L GV+   + +    I   L  R   + W    +P K  K G  + F   
Sbjct: 58  LNNTKVIPARLFGVKEGTMAK----IEILLLKRRQNDVWETLVKPGKKAKPGTKIIF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G   L   VID  + G  L+ FS  GI  E  +  +G +PLPPYI  +     +D   Y
Sbjct: 111 -GDGLLTGEVIDVVDDGNRLIQFSYEGI-FEEILDKLGQMPLPPYITHQ----LKDKNRY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL ++   G+ +  VTLHVG GTF PVKV++  DH M
Sbjct: 165 QTVYAKYDGSAAAPTAGLHFTKELLQQVKDKGVDIAEVTLHVGLGTFRPVKVDNVLDHHM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   +    A  +N+ K  GGRI+SVGTTS R LE A+ E+G++   SG+T+IFI PG
Sbjct: 225 HSEFYMVSQEAADKINNAKKNGGRIISVGTTSTRTLEAASDENGMLKECSGWTDIFIYPG 284

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           Y F+ +D L++NFHLP+STL+MLVSA  G E     Y+ A+   YRF+S+GD   +
Sbjct: 285 YSFKVIDCLITNFHLPQSTLVMLVSALAGREHVLNAYKEAVEERYRFFSFGDAMFI 340


>gi|291525119|emb|CBK90706.1| S-adenosylmethionine--tRNA ribosyltransferase-isomerase
           [Eubacterium rectale DSM 17629]
          Length = 352

 Score =  280 bits (717), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 155/356 (43%), Positives = 207/356 (58%), Gaps = 16/356 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M VK+FD+DLP   IA  P+  R S+RLMV+         +S H+  ++  +L   D +V
Sbjct: 1   MDVKDFDYDLPEELIAQDPLEDRSSSRLMVLDKKTG---EVSHHVFKEIVKYLRPGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NNTKVI A+L GV+   + +    I   L  R   + W    +P K  K G  + F   
Sbjct: 58  LNNTKVIPARLFGVKEGTMAK----IEILLLKRRQNDVWETLVKPGKKAKPGTKIIF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G   L   VID  + G  L+ FS  GI  E  +  +G +PLPPYI  +     +D   Y
Sbjct: 111 -GDGLLTGEVIDVVDDGNRLIQFSYEGI-FEEILDKLGQMPLPPYITHQ----LKDKNRY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL ++   G+ +  VTLHVG GTF PVKV++  DH M
Sbjct: 165 QTVYAKYDGSAAAPTAGLHFTKELLQQVKDKGVDIAEVTLHVGLGTFRPVKVDNVLDHHM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   +    A  +N+ K  GGRI+SVGTTS R LE A+ E+G++   SG+T+IFI PG
Sbjct: 225 HSEFYMVSQEAADKINNAKKNGGRIISVGTTSTRTLEAASDENGMLKECSGWTDIFIYPG 284

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           Y F+ +D L++NFHLP+STL+MLVSA  G E     Y+ A+   YRF+S+GD   +
Sbjct: 285 YSFKVIDCLITNFHLPQSTLVMLVSALAGREHVLNAYKEAVEERYRFFSFGDAMFI 340


>gi|324990584|gb|EGC22520.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus sanguinis SK353]
          Length = 342

 Score =  280 bits (717), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 159/353 (45%), Positives = 209/353 (59%), Gaps = 17/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +FDFDLP   IA  P+  RD++RL+VV          SD     +   L   DA+V
Sbjct: 1   MNTADFDFDLPEELIAQTPLEKRDASRLLVVDKETGA---FSDQHFDQIIDQLQPGDALV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NNT+V+ A+L G++          +   L      + W V A+P+K ++ G  + F   
Sbjct: 58  MNNTRVLPARLYGIK----PETGGHVELLLLKNTQGDDWEVLAKPAKRLRVGSHISF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL ATV+++ + G  ++ F   GI LE   SL G +PLPPYI  K      D   Y
Sbjct: 111 -GDGRLTATVVEELDHGGRIVRFGYEGIFLEVLESL-GEMPLPPYIHEKLA----DRERY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL ++ + G+K+ ++TLHVG GTF PV V   DDH M
Sbjct: 165 QTVYAKENGSAAAPTAGLHFTEELLEQIAAKGVKLVYLTLHVGLGTFRPVSVNSLDDHEM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           HSE   +    AQ L  VK+ GGR+++VGTTS+R LET  ++  G I   SG+TNIFI P
Sbjct: 225 HSEFYSLSEEAAQTLRQVKANGGRVIAVGTTSIRTLETIGSKFQGQIQADSGWTNIFIKP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           GY ++ VD   +NFHLPKSTL+MLVSAF G   T K Y+HAI+  YRF+S+GD
Sbjct: 285 GYDWKIVDAFSTNFHLPKSTLVMLVSAFAGRSLTLKAYEHAIAERYRFFSFGD 337


>gi|291562523|emb|CBL41339.1| S-adenosylmethionine--tRNA ribosyltransferase-isomerase
           [butyrate-producing bacterium SS3/4]
          Length = 341

 Score =  280 bits (716), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 154/356 (43%), Positives = 208/356 (58%), Gaps = 16/356 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V +F+F+LPP  IA  P+  R ++RL+V+         I      D+  +L   D +V
Sbjct: 1   MNVTDFNFELPPELIAQDPLEDRAASRLLVLDKKTG---EIEHRHFRDILKYLKKGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+TKVI A+L G    H    +  I   L  R S N W    +P K +K G  + F   
Sbjct: 58  INDTKVIPARLMG----HKIGTDAGIEVLLLKRKSDNVWETLVKPGKKMKVGAEVSF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G   L+  VID  + G  L+ F   GI  E  +  +G +PLPPYI  +     +D   Y
Sbjct: 111 -GDGLLKGKVIDVVDEGNRLIQFEYDGI-FEEILDKLGQMPLPPYITHQ----LKDKNRY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK +GS AAPTAGLHFT  LL  +  +G+K+  VTLHVG GTF PVKV+  ++H M
Sbjct: 165 QTVYAKNEGSAAAPTAGLHFTKELLQEIEEMGVKIAHVTLHVGLGTFRPVKVDTIEEHHM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   ++   A+ +N  K+ GGR++ VGTTS R LE+AT +DGI+   SG+T IFI PG
Sbjct: 225 HSEFYMVEESEAKKINDTKANGGRVICVGTTSCRTLESATGDDGILKAGSGWTEIFIYPG 284

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           Y+F+ +D L++NFHLP+STL+MLVSA  G E     YQ AI   YRF+S+GD   +
Sbjct: 285 YKFKILDCLITNFHLPESTLVMLVSALAGREHILNAYQEAIKERYRFFSFGDAMFI 340


>gi|327461604|gb|EGF07935.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus sanguinis SK1]
 gi|327489463|gb|EGF21256.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus sanguinis SK1058]
          Length = 342

 Score =  280 bits (716), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 159/353 (45%), Positives = 209/353 (59%), Gaps = 17/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +FDFDLP   IA  P+  RD++RL+VV          SD     +   L   DA+V
Sbjct: 1   MNTADFDFDLPEELIAQTPLEKRDASRLLVVDKETGA---FSDQHFDQIIDQLQPGDALV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NNT+V+ A+L G++          +   L      + W V A+P+K ++ G  + F   
Sbjct: 58  MNNTRVLPARLYGIK----PETGGHVELLLLKNTQGDDWEVLAKPAKRLRVGAQISF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL ATVI++   G  ++ F+  GI LE   SL G +PLPPYI  K      D   Y
Sbjct: 111 -GDGRLTATVIEELEHGGRIVRFAYEGIFLEVLESL-GEMPLPPYIHEKLA----DRERY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL ++ + G+K+ ++TLHVG GTF PV V+  DDH M
Sbjct: 165 QTVYAKENGSAAAPTAGLHFTEELLEQIAAKGVKLVYLTLHVGLGTFRPVSVDSLDDHEM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           HSE   +    AQ L  VK  GGR+++VGTTS+R LET  ++  G I   SG+TNIFI P
Sbjct: 225 HSEFYSLSEEAAQTLRQVKGNGGRVIAVGTTSIRTLETIGSKFQGQIQADSGWTNIFIKP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           GY ++ VD   +NFHLPKSTL+MLVSAF G   T + Y+HAI+  YRF+S+GD
Sbjct: 285 GYDWKVVDAFSTNFHLPKSTLVMLVSAFAGRSLTLEAYEHAIAEHYRFFSFGD 337


>gi|167037429|ref|YP_001665007.1| S-adenosylmethionine--tRNA-ribosyltransferase-isomerase
           [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|256752587|ref|ZP_05493441.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Thermoanaerobacter ethanolicus CCSD1]
 gi|320115842|ref|YP_004186001.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Thermoanaerobacter brockii subsp. finnii Ako-1]
 gi|238687693|sp|B0K958|QUEA_THEP3 RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|166856263|gb|ABY94671.1| S-adenosylmethionine--tRNA-ribosyltransferase-isomerase
           [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|256748525|gb|EEU61575.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Thermoanaerobacter ethanolicus CCSD1]
 gi|319928933|gb|ADV79618.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Thermoanaerobacter brockii subsp. finnii Ako-1]
          Length = 341

 Score =  280 bits (716), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 150/359 (41%), Positives = 209/359 (58%), Gaps = 22/359 (6%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   EF F+LP   IA  P+  R S+RLM+++        I   +  ++  +L   D +V
Sbjct: 1   MKRSEFYFELPEELIAQEPLEDRASSRLMILNKKTGE---IEHDIFKNITKYLKPGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREK---EISCTLHMRVSPNSWSVYARPSKVIKKGDILHF 117
            NNTKVI A+L       I RRE    +I   L  R+S N W +  +P +  K G    F
Sbjct: 58  LNNTKVIPARL-------IGRREDSGGKIEFVLLKRISNNEWEILVKPGRRAKIGSKFVF 110

Query: 118 FSQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDY 177
               G   L A ++D  + G  ++ F   G+  E  +  +G +P+PPYI +K     R  
Sbjct: 111 ----GNGELIAEILDTTDVGGRIVRFYYEGV-FEEVLDKLGEMPVPPYIKKKLKNKDR-- 163

Query: 178 VDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDD 237
             YQT YAK +GS AAPTAGLHFT  LL ++  +G+K  F+TLHVG GTF PVK E  ++
Sbjct: 164 --YQTVYAKYEGSAAAPTAGLHFTEELLEKIRQMGVKTVFITLHVGLGTFRPVKEEVIEN 221

Query: 238 HIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFI 297
           H MH E   +    A+ +N  +  GGRI++VGTTS R LET   EDG I   SG+T+IFI
Sbjct: 222 HKMHEEFYIVTKEAAEEINETRKSGGRIIAVGTTSTRTLETVADEDGYIKEKSGWTDIFI 281

Query: 298 TPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
            PGY+F+A+D +++NFHLP+STL+M+VSAF G E   + Y+ A+   YRF+S+GD  L+
Sbjct: 282 YPGYKFKAIDGMITNFHLPESTLIMMVSAFAGKENIMRAYKIAVEKKYRFFSFGDAMLI 340


>gi|187778350|ref|ZP_02994823.1| hypothetical protein CLOSPO_01942 [Clostridium sporogenes ATCC
           15579]
 gi|187771975|gb|EDU35777.1| hypothetical protein CLOSPO_01942 [Clostridium sporogenes ATCC
           15579]
          Length = 341

 Score =  280 bits (716), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 153/364 (42%), Positives = 212/364 (58%), Gaps = 32/364 (8%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M VK+FDF LP   IA  P+  RD ARL+V+         I D +  D+  +L  ND +V
Sbjct: 1   MKVKDFDFYLPEELIAQHPMEKRDEARLLVLDKKTG---EIEDKIFKDILDYLTPNDCLV 57

Query: 61  FNNTKVITAQLNG--------VRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKG 112
            NNT+V+ A+L G        + F  + R+EK++            W    +P K  + G
Sbjct: 58  LNNTRVLPARLIGSKEETGGKMEFLLLKRKEKDV------------WETLVKPGKRAQIG 105

Query: 113 DILHFFSQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPI 172
               F    G   L+A VI     G  ++ F   GI  E  +  +G +PLPPYI  K  +
Sbjct: 106 ARFIF----GNGELKAEVIGMGEEGSRIVKFYYEGI-FEEILDQLGQMPLPPYIKEK--L 158

Query: 173 DARDYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKV 232
           D ++   YQT Y+K +GS AAPTAGLHFT  LL ++   G+K+ F+TLHVG GTF PVKV
Sbjct: 159 DDKEM--YQTVYSKEEGSAAAPTAGLHFTEELLEKIKGKGVKLAFLTLHVGLGTFRPVKV 216

Query: 233 EDTDDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGF 292
           ED  +HIMHSE   +D  TA+ +N+ + +GGR+++VGTTS R LET    +G +   SG+
Sbjct: 217 EDIQEHIMHSEYYKMDKKTAKIINTTREKGGRVIAVGTTSCRTLETIGDIEGKVKEQSGW 276

Query: 293 TNIFITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           T+IFI PGY+++ VD L++NFHLP+STLLMLVSA  G +     Y  A+   YRF+S+GD
Sbjct: 277 TDIFIYPGYKYKVVDALITNFHLPQSTLLMLVSALAGRDNIMNAYNMAVEKEYRFFSFGD 336

Query: 353 TSLL 356
              +
Sbjct: 337 AMFI 340


>gi|171778635|ref|ZP_02919731.1| hypothetical protein STRINF_00583 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
 gi|171282592|gb|EDT48016.1| hypothetical protein STRINF_00583 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
          Length = 342

 Score =  280 bits (715), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 161/354 (45%), Positives = 214/354 (60%), Gaps = 19/354 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVV-HPNLSCPLVISDHLVSDLPAFLNSNDAI 59
           M   +FDF+LP   IA  P+  RDS++L+V+ H          DH++ +L    NS DA+
Sbjct: 1   MHTDDFDFNLPEELIAQTPLEKRDSSKLLVIDHKTHEMVDAHFDHILDEL----NSGDAL 56

Query: 60  VFNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFS 119
           V NNT+V+ A+L G +          +   L      + W V A+P+K +  G  + F  
Sbjct: 57  VMNNTRVLPARLYGEK----PDTHGHVELLLLKNTEGDQWEVLAKPAKRLHVGVKVSF-- 110

Query: 120 QDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVD 179
             G  RL ATV+++ + G  ++ F   GI LE   SL G +PLPPYI  K     R    
Sbjct: 111 --GDGRLTATVVEELDNGGRIVEFDYDGIFLEVLESL-GEMPLPPYIHEKLDDPNR---- 163

Query: 180 YQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHI 239
           YQT YAK  GS AAPTAGLHFT  LL ++ + G+K+ +VTLHVG GTF PV V++ ++H 
Sbjct: 164 YQTVYAKENGSAAAPTAGLHFTKELLEKIEAKGVKLVYVTLHVGLGTFRPVSVDNVEEHE 223

Query: 240 MHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFIT 298
           MHSE   +    AQ L  VK+ GGR+V+VGTTS+R LET  ++ +G I   SG+TNIFI 
Sbjct: 224 MHSEFYRLSEEAAQTLRDVKATGGRVVAVGTTSIRTLETIGSKFNGEIKADSGWTNIFIK 283

Query: 299 PGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           PGY F+ VD   +NFHLPKSTL+MLVSAF G E   + YQHAI   YRF+S+GD
Sbjct: 284 PGYDFKVVDAFSTNFHLPKSTLVMLVSAFAGREFVLEAYQHAIDERYRFFSFGD 337


>gi|167040096|ref|YP_001663081.1| S-adenosylmethionine--tRNA-ribosyltransferase-isomerase
           [Thermoanaerobacter sp. X514]
 gi|300914179|ref|ZP_07131495.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Thermoanaerobacter sp. X561]
 gi|307724585|ref|YP_003904336.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Thermoanaerobacter sp. X513]
 gi|238687548|sp|B0K0M0|QUEA_THEPX RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|166854336|gb|ABY92745.1| S-adenosylmethionine--tRNA-ribosyltransferase-isomerase
           [Thermoanaerobacter sp. X514]
 gi|300889114|gb|EFK84260.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Thermoanaerobacter sp. X561]
 gi|307581646|gb|ADN55045.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Thermoanaerobacter sp. X513]
          Length = 341

 Score =  279 bits (714), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 150/359 (41%), Positives = 208/359 (57%), Gaps = 22/359 (6%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   EF F+LP   IA  P+  R S+RLM+++        I   +  ++  +L   D +V
Sbjct: 1   MKRSEFYFELPEELIAQEPLEDRASSRLMILNKKTGE---IEHDIFKNITKYLKPGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREK---EISCTLHMRVSPNSWSVYARPSKVIKKGDILHF 117
            NNTKVI A+L       I RRE    +I   L  R+S N W +  +P +  K G    F
Sbjct: 58  LNNTKVIPARL-------IGRREDSGGKIEFVLLKRISNNEWEILVKPGRRAKIGSKFVF 110

Query: 118 FSQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDY 177
               G   L A ++D    G  ++ F   G+  E  +  +G +P+PPYI +K     R  
Sbjct: 111 ----GNGELIAEILDTTEVGGRIVRFYYEGV-FEEVLDKLGEMPVPPYIKKKLKNKDR-- 163

Query: 178 VDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDD 237
             YQT YAK +GS AAPTAGLHFT  LL ++  +G+K  F+TLHVG GTF PVK E  ++
Sbjct: 164 --YQTVYAKYEGSAAAPTAGLHFTEELLEKIRQMGVKTVFITLHVGLGTFRPVKEEVIEN 221

Query: 238 HIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFI 297
           H MH E   +    A+ +N  +  GGRI++VGTTS R LET   EDG I   SG+T+IFI
Sbjct: 222 HKMHEEFYIVTKEAAEEINETRKSGGRIIAVGTTSTRTLETVADEDGYIKEKSGWTDIFI 281

Query: 298 TPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
            PGY+F+A+D +++NFHLP+STL+M+VSAF G E   + Y+ A+   YRF+S+GD  L+
Sbjct: 282 YPGYKFKAIDGMITNFHLPESTLIMMVSAFAGKENIMRAYKIAVEKKYRFFSFGDAMLI 340


>gi|71903796|ref|YP_280599.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pyogenes MGAS6180]
 gi|94988817|ref|YP_596918.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pyogenes MGAS9429]
 gi|94992703|ref|YP_600802.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pyogenes MGAS2096]
 gi|139473569|ref|YP_001128285.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pyogenes str. Manfredo]
 gi|91207330|sp|Q48SR6|QUEA_STRPM RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|166218745|sp|Q1JB00|QUEA_STRPB RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|166218746|sp|Q1JL45|QUEA_STRPC RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|166218749|sp|A2RDX5|QUEA_STRPG RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|71802891|gb|AAX72244.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pyogenes MGAS6180]
 gi|94542325|gb|ABF32374.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pyogenes MGAS9429]
 gi|94546211|gb|ABF36258.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pyogenes MGAS2096]
 gi|134271816|emb|CAM30050.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pyogenes str. Manfredo]
          Length = 342

 Score =  279 bits (714), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 158/354 (44%), Positives = 215/354 (60%), Gaps = 19/354 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVV-HPNLSCPLVISDHLVSDLPAFLNSNDAI 59
           M   +FDF+LP   IA  P+  RDS++L+++ H   +      DH++  L    N  DA+
Sbjct: 1   MNTNDFDFELPEELIAQTPLEKRDSSKLLIIDHRQKTMVDSHFDHIIDQL----NPGDAL 56

Query: 60  VFNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFS 119
           V NNT+V+ A+L G +          +   L      + W V A+P+K +K G  ++F  
Sbjct: 57  VMNNTRVLPARLYGEK----PDTHGHVELLLLKNTQGDQWEVLAKPAKRLKVGSQVNF-- 110

Query: 120 QDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVD 179
             G  RL+AT+ID+   G  ++ FS  GI LE   SL G +PLPPYI  K      D   
Sbjct: 111 --GDGRLKATIIDELEHGGRIVEFSYDGIFLEVLESL-GEMPLPPYIHEK----LEDAER 163

Query: 180 YQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHI 239
           YQT YAK  GS AAPTAGLHFT++LL ++ + G+ + ++TLHVG GTF PV V++ D+H 
Sbjct: 164 YQTVYAKENGSAAAPTAGLHFTTDLLKKIEAKGVHLVYLTLHVGLGTFRPVSVDNLDEHD 223

Query: 240 MHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFIT 298
           MHSE   +    AQ L  VK  GGR+V+VGTTS+R LET   +  G I   SG+TNIFI 
Sbjct: 224 MHSEFYSLSEEAAQTLRDVKQAGGRVVAVGTTSIRTLETIGGKFQGDIQADSGWTNIFIK 283

Query: 299 PGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           PGY+F+ VD   +NFHLPKSTL+MLVSAF G +   + Y+HA+   YRF+S+GD
Sbjct: 284 PGYQFKVVDAFSTNFHLPKSTLVMLVSAFAGRDFVLEAYRHAVDEKYRFFSFGD 337


>gi|209559631|ref|YP_002286103.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pyogenes NZ131]
 gi|238058400|sp|B5XM46|QUEA_STRPZ RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|209540832|gb|ACI61408.1| S-adenosylmethionine:tRNA ribosyltransferase- isomerase
           [Streptococcus pyogenes NZ131]
          Length = 342

 Score =  279 bits (714), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 157/354 (44%), Positives = 215/354 (60%), Gaps = 19/354 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVV-HPNLSCPLVISDHLVSDLPAFLNSNDAI 59
           M   +FDF+LP   IA  P+  RDS++L+++ H   +      DH++  L    N  DA+
Sbjct: 1   MNTNDFDFELPEELIAQTPLEKRDSSKLLIIDHRQKTMVDSHFDHIIDQL----NPGDAL 56

Query: 60  VFNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFS 119
           V NNT+V+ A+L G +          +   L      + W V A+P+K +K G  ++F  
Sbjct: 57  VMNNTRVLPARLYGEK----TDTHGHVELLLLKNTQGDQWEVLAKPAKRLKVGSQVNF-- 110

Query: 120 QDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVD 179
             G   L+AT+ID+   G  ++ FS  GI LE   SL G +PLPPYI  K      D   
Sbjct: 111 --GDGHLKATIIDELEHGGRIVEFSYDGIFLEVLESL-GEMPLPPYIHEK----LEDAER 163

Query: 180 YQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHI 239
           YQT YAK  GS AAPTAGLHFT++LL ++ + G+ + ++TLHVG GTF PV V++ D+H 
Sbjct: 164 YQTVYAKENGSAAAPTAGLHFTTDLLKKIEAKGVHLVYLTLHVGLGTFRPVSVDNLDEHD 223

Query: 240 MHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFIT 298
           MHSE   +    AQ L  VK  GGR+V+VGTTS+R LET  ++  G I   SG+TNIFI 
Sbjct: 224 MHSEFYSLSEEAAQTLRDVKQAGGRVVAVGTTSIRTLETIGSKFQGDIQADSGWTNIFIK 283

Query: 299 PGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           PGY+F+ VD   +NFHLPKSTL+MLVSAF G +   + Y+HA+   YRF+S+GD
Sbjct: 284 PGYQFKVVDAFSTNFHLPKSTLVMLVSAFAGRDFVLEAYRHAVDEKYRFFSFGD 337


>gi|307266566|ref|ZP_07548098.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Thermoanaerobacter wiegelii Rt8.B1]
 gi|306918420|gb|EFN48662.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Thermoanaerobacter wiegelii Rt8.B1]
          Length = 341

 Score =  279 bits (714), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 148/359 (41%), Positives = 212/359 (59%), Gaps = 22/359 (6%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   EF F+LP   IA  P+  R S+RLMV++        +   +  ++  +L + D +V
Sbjct: 1   MKRSEFYFELPEELIAQEPLEDRSSSRLMVLNRKTGE---VQHDIFKNITKYLKAGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREK---EISCTLHMRVSPNSWSVYARPSKVIKKGDILHF 117
            N+TKVI A+L       I RR+    +I   L  R+S N W    +P +  K G  + F
Sbjct: 58  LNDTKVIPARL-------IGRRQDSGGKIEFVLLKRLSVNEWETLVKPGRRAKVGTRVVF 110

Query: 118 FSQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDY 177
               G   L A ++D    G  ++ F   G+  E  +  +G +P+PPYI +K     +D 
Sbjct: 111 ----GNGELVAEILDNTEVGGRVVRFYYEGV-FEEVLDKLGEMPVPPYIKKK----LKDK 161

Query: 178 VDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDD 237
             YQT YAK +GS AAPTAGLHFT  LL ++  +G+K  F+TLHVG GTF PVK E  ++
Sbjct: 162 ERYQTVYAKYEGSAAAPTAGLHFTEELLEKIRQMGVKTVFITLHVGLGTFRPVKEEIIEN 221

Query: 238 HIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFI 297
           H MH E   +    A+ +N+ + +GGR+++VGTTS R LET   E+G I   SG+T+IFI
Sbjct: 222 HKMHEEFYIVTKEAAEEINATREKGGRVIAVGTTSTRTLETVADENGYIREKSGWTDIFI 281

Query: 298 TPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
            PGY+F+A+D +++NFHLP+STL+M+VSAF G E   + YQ AI   YRF+S+GD  L+
Sbjct: 282 YPGYKFKAIDGMITNFHLPESTLIMMVSAFAGKENIMRAYQVAIEERYRFFSFGDAMLI 340


>gi|152976836|ref|YP_001376353.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           cereus subsp. cytotoxis NVH 391-98]
 gi|189038510|sp|A7GTA0|QUEA_BACCN RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|152025588|gb|ABS23358.1| S-adenosylmethionine--tRNA-ribosyltransferase-isomerase [Bacillus
           cytotoxicus NVH 391-98]
          Length = 350

 Score =  279 bits (714), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 158/357 (44%), Positives = 213/357 (59%), Gaps = 17/357 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M +  FDF LP   IA  P+  R+++RLMV+         I     SD+ A+L+  D +V
Sbjct: 1   MDINLFDFHLPEELIAQTPLEKRETSRLMVLDRETGD---IEHKHFSDILAYLHEGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N TKV+ A+L+GV+          I   L  +   ++W    +P+K +K+G ++ F   
Sbjct: 58  LNETKVMPARLHGVK----EDTGAHIEVLLLKQEEGDTWETLVKPAKRVKEGTVISF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G+ +L+AT +   + G   L FS  GI  E  +  +G +PLPPYI  K  ++ RD   Y
Sbjct: 111 -GEGKLKATCVGTADQGGRQLEFSYDGIFYE-ILDELGEMPLPPYI--KETLEDRDR--Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL +L   G+K+ F+TLHVG GTF PV  +  +DH M
Sbjct: 165 QTVYAKEIGSAAAPTAGLHFTEELLEKLQQKGVKLAFITLHVGLGTFRPVSTDKIEDHHM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           H+E   +   TA  LN VK  GGRI++VGTTS R LET  TE DG +   SG+T+IF+ P
Sbjct: 225 HAEYYHMSQETADLLNDVKVNGGRIITVGTTSTRTLETIATEHDGKLCGASGWTDIFMYP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           GY F+A+D L++NFHLPKSTL+MLVSAF G E     Y  A+   YRF+S+GD   L
Sbjct: 285 GYEFKAIDGLITNFHLPKSTLIMLVSAFAGRENVLHAYNEAVKEKYRFFSFGDAMFL 341


>gi|228478265|ref|ZP_04062873.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus salivarius SK126]
 gi|228249944|gb|EEK09214.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus salivarius SK126]
          Length = 347

 Score =  279 bits (714), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 160/355 (45%), Positives = 219/355 (61%), Gaps = 21/355 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVIS--DHLVSDLPAFLNSNDA 58
           M   +FDF+LP   IA  P+  RD+++L+V+ P ++  +  +  DH++  L    N  DA
Sbjct: 1   MNTNDFDFELPEELIAQTPLEQRDASKLLVIDP-VTKEMTDTHFDHIIDQL----NPGDA 55

Query: 59  IVFNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFF 118
           +V NNT+V+ A+L G +          +   L      + W V A+P+K +K G  + F 
Sbjct: 56  LVMNNTRVLPARLYGEK----PDTHGHVEFLLLKNTQGDQWEVLAKPAKRLKVGAKVSF- 110

Query: 119 SQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYV 178
              G  RL ATV ++ + G  ++ F+  GI LE   SL G +PLPPYI  K  ++ RD  
Sbjct: 111 ---GDGRLTATVTEELDHGGRIVEFNYDGIFLEVLESL-GEMPLPPYIHEK--LEDRDR- 163

Query: 179 DYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDH 238
            YQT YAK  GS AAPTAGLHFT  LL ++ + G+K+ ++TLHVG GTF PV V++ D+H
Sbjct: 164 -YQTVYAKENGSAAAPTAGLHFTPELLQKIEAKGVKLVYLTLHVGLGTFRPVSVDNVDEH 222

Query: 239 IMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFI 297
            MHSE   +    A  LNSVK+ GGRI++VGTTS+R LET   + DG +   SG+TNIFI
Sbjct: 223 EMHSEFYTLSQDAADTLNSVKAAGGRIIAVGTTSIRTLETIGNKYDGQLQADSGWTNIFI 282

Query: 298 TPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
            PGY+F  VD   +NFHLPKSTL+MLVSAF G E     Y+HA+   YRF+S+GD
Sbjct: 283 KPGYQFTVVDAFSTNFHLPKSTLVMLVSAFAGREFVLDAYKHAVQERYRFFSFGD 337


>gi|224476737|ref|YP_002634343.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus carnosus subsp. carnosus TM300]
 gi|222421344|emb|CAL28158.1| putative S-adenosylmethionine tRNA ribosyltransferase
           [Staphylococcus carnosus subsp. carnosus TM300]
          Length = 341

 Score =  279 bits (714), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 150/356 (42%), Positives = 213/356 (59%), Gaps = 16/356 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M ++EFD+DLP   IA  P+  RD++RL+V+H        +      D+  ++NS D +V
Sbjct: 1   MNIEEFDYDLPEELIAQTPLKDRDTSRLLVLHKENGE---LEHRHFKDIIEYINSGDTLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+TKV+ A+L GV+       + ++   +  ++  + W V  +P+K IK G  L F   
Sbjct: 58  LNDTKVMPARLFGVK----QETKAKVEMLMLTQIEGDDWEVLLKPAKRIKVGQKLSF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G+ ++EA  I++ + G  ++  S  GI L+ ++  +G +PLPPYI  +      D   Y
Sbjct: 111 -GEGKIEAECIEELDQGGRIMRLSYEGI-LQERLDELGEMPLPPYIKER----LEDQDRY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL  L + G+ + F+TLHVG GTF PV V++ DDH M
Sbjct: 165 QTVYAKATGSAAAPTAGLHFTDELLDELKAKGVNLAFITLHVGLGTFRPVSVDNIDDHEM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   +   TA  LN  K  G RI+SVGTTS R LET   +       SG+T+IFI PG
Sbjct: 225 HSEYYQMTQETADLLNQTKQNGKRIISVGTTSTRTLETIRRDYDTFTAASGWTDIFIYPG 284

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           + F+A+D L++NFHLPKSTL+MLVSAF   +     Y+ A+   YRF+S+GD  L+
Sbjct: 285 FEFKAIDGLITNFHLPKSTLVMLVSAFSSRQYILNAYRTAVEMKYRFFSFGDAMLI 340


>gi|89895210|ref|YP_518697.1| hypothetical protein DSY2464 [Desulfitobacterium hafniense Y51]
 gi|219669641|ref|YP_002460076.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Desulfitobacterium hafniense DCB-2]
 gi|122482413|sp|Q24UN9|QUEA_DESHY RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|254764274|sp|B8FQV3|QUEA_DESHD RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|89334658|dbj|BAE84253.1| hypothetical protein [Desulfitobacterium hafniense Y51]
 gi|219539901|gb|ACL21640.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Desulfitobacterium hafniense DCB-2]
          Length = 341

 Score =  279 bits (713), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 151/357 (42%), Positives = 212/357 (59%), Gaps = 16/357 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M +++FDF+LP  RIA  PV PRDS+RLMV++        I   +  +LP  L + D +V
Sbjct: 1   MKLEDFDFELPEDRIAQHPVEPRDSSRLMVMN---RWTGEIEHRVFRELPELLQAGDVLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NNT+VI A+L G +       + +I C L  R   + W    +P K +K G  + F   
Sbjct: 58  VNNTRVIPARLIGEK----EGTQAKIECLLLTRRDKDVWETLIKPGKRLKAGQTVVF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G   L   +++    G  L+ F+  GI  E  +  +G +PLPPYI  +     +D   Y
Sbjct: 111 -GDGLLRGELLEILPDGNRLVRFNYQGI-FEEVLDQLGNMPLPPYITEQ----LQDKERY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL RL   G+++  + LHVG GTF PVKVE+ ++H M
Sbjct: 165 QTIYAKESGSAAAPTAGLHFTPELLERLQDKGVEIVEILLHVGLGTFRPVKVENVEEHTM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   +    A+ +N  KS+G R+++VGTT+ R LE+   E+G I    G+T+I+I PG
Sbjct: 225 HSEYYRVTPDAAERINRAKSQGRRVIAVGTTASRTLESVAGENGRIEGKEGWTDIYIYPG 284

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           Y F+ +D L++NFH PKSTL+MLVSA  G ++  K YQ AI+  YRFYS+GD  ++ 
Sbjct: 285 YTFKILDGLITNFHFPKSTLVMLVSALAGRDQILKAYQIAIAEGYRFYSFGDAMMIL 341


>gi|118444595|ref|YP_877907.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           novyi NT]
 gi|118135051|gb|ABK62095.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           novyi NT]
          Length = 344

 Score =  279 bits (713), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 154/354 (43%), Positives = 204/354 (57%), Gaps = 16/354 (4%)

Query: 3   VKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIVFN 62
           VK+FDF LP   IA  P+  RD +RLMVV         I   +  D+  +LN  D +V N
Sbjct: 6   VKDFDFYLPQELIAQHPMEKRDESRLMVVDRKSGQ---IEHKIFRDILGYLNEGDCLVLN 62

Query: 63  NTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQDG 122
           NT+V+ A+L G +         +I   L  R+  ++W    +P K  K G    F    G
Sbjct: 63  NTRVLPARLIGEK----ENTGGKIEFLLLRRIEGDTWETLVKPGKKAKIGARFVF----G 114

Query: 123 QSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDYQT 182
              L+A V      G  ++ F   GI  E  +  +G +PLPPYI  +      D   YQT
Sbjct: 115 SGELKAEVKSMGEDGSRIIEFEYEGI-FEEVLDKLGQMPLPPYITER----LEDKERYQT 169

Query: 183 TYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIMHS 242
            Y+K +GS AAPTAGLHFT  LL  +   GIK+ FVTLHVG GTF PVKVE+ ++H MHS
Sbjct: 170 VYSKEKGSAAAPTAGLHFTEELLKEIKEKGIKIAFVTLHVGLGTFRPVKVENIEEHHMHS 229

Query: 243 EIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPGYR 302
           E   +   TA  +N+ K  GG+I++VGTTS R LET   EDG +   SG+T+IF+ PGY+
Sbjct: 230 EYYTMSKETADIINNTKENGGKIIAVGTTSCRTLETIGDEDGKVRETSGWTDIFMYPGYK 289

Query: 303 FRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           F+ VD L++NFHLP+STLLMLVSAF   E     Y+ A+ + YRF+S+GD   L
Sbjct: 290 FKVVDRLITNFHLPQSTLLMLVSAFSSRENIMNAYKEAVKNKYRFFSFGDAMFL 343


>gi|83590531|ref|YP_430540.1| S-adenosylmethionine [Moorella thermoacetica ATCC 39073]
 gi|123524237|sp|Q2RHU2|QUEA_MOOTA RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|83573445|gb|ABC19997.1| S-adenosylmethionine--tRNA ribosyltransferase-isomerase [Moorella
           thermoacetica ATCC 39073]
          Length = 342

 Score =  279 bits (713), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 156/357 (43%), Positives = 217/357 (60%), Gaps = 15/357 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M ++EFD++LPP +IA +PV PRD++RL+V+H        +      DLP +L+  D +V
Sbjct: 1   MRIEEFDYELPPGQIAQQPVEPRDASRLLVLHREGGF---LEHRHFYDLPRYLHPGDVLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N TKVI A+L G R         +I   L  R   ++W    RP + +  G  L F   
Sbjct: 58  VNETKVIPARLWGYRAG----TGAKIEVLLLTRQEGDTWETLVRPGRRVPVGAELIF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G+  L+A V      G  ++ FS      E  +  +G +PLPPYI +++P D   Y   
Sbjct: 111 -GRGELQARVKGVTPAGGRIMEFSYQEGPWEALLERLGEMPLPPYI-KEKPADPGRY--- 165

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YA+ +GS AAPTAGLHFT  LL  L   GI++  + LHVG GTF PVKVE+  +H+M
Sbjct: 166 QTVYAREEGSAAAPTAGLHFTPRLLKELREQGIEIASILLHVGLGTFRPVKVENIQEHVM 225

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           H+E   +    A  +N+ ++RG R+V+VGTT +R LET  T DG+I+  SG+T+IFI PG
Sbjct: 226 HAEYYAVTPAAAATINAARARGHRVVAVGTTVVRTLETVATADGVIHAGSGWTDIFIYPG 285

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           YRF+A+D L++NFHLP+STLLMLVSAF G E+    Y+ A+   YRFYS+GD  L+ 
Sbjct: 286 YRFKAIDSLITNFHLPRSTLLMLVSAFAGREKILDAYRVAVREGYRFYSFGDAMLIL 342


>gi|15675321|ref|NP_269495.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pyogenes M1 GAS]
 gi|71910953|ref|YP_282503.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pyogenes MGAS5005]
 gi|21263910|sp|Q99Z49|QUEA_STRP1 RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|13622501|gb|AAK34216.1| putative S-adenosylmethionine-tRNA ribosyltransferase-isomerase
           [Streptococcus pyogenes M1 GAS]
 gi|71853735|gb|AAZ51758.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pyogenes MGAS5005]
          Length = 342

 Score =  278 bits (712), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 158/354 (44%), Positives = 214/354 (60%), Gaps = 19/354 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVV-HPNLSCPLVISDHLVSDLPAFLNSNDAI 59
           M    FDF+LP   IA  P+  RDS++L+++ H   +      DH++  L    N  DA+
Sbjct: 1   MNTNNFDFELPEELIAQTPLEKRDSSKLLIIDHRQKTMVDSHFDHIIDQL----NPGDAL 56

Query: 60  VFNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFS 119
           V NNT+V+ A+L G +          +   L      + W V A+P+K +K G  ++F  
Sbjct: 57  VMNNTRVLPARLYGEK----PDTHGHVELLLLKNTQGDQWEVLAKPAKRLKVGSQVNF-- 110

Query: 120 QDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVD 179
             G  RL+AT+ID+   G  ++ FS  GI LE   SL G +PLPPYI  K      D   
Sbjct: 111 --GDGRLKATIIDELEHGGRIVEFSYDGIFLEVLESL-GEMPLPPYIHEK----LEDAER 163

Query: 180 YQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHI 239
           YQT YAK  GS AAPTAGLHFT++LL ++ + G+ + ++TLHVG GTF PV V++ D+H 
Sbjct: 164 YQTVYAKENGSAAAPTAGLHFTTDLLKKIEAKGVHLVYLTLHVGLGTFRPVSVDNLDEHD 223

Query: 240 MHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFIT 298
           MHSE   +    AQ L  VK  GGR+V+VGTTS+R LET   +  G I   SG+TNIFI 
Sbjct: 224 MHSEFYSLSEEAAQTLRDVKQAGGRVVAVGTTSIRTLETIGGKFQGDIQADSGWTNIFIK 283

Query: 299 PGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           PGY+F+ VD   +NFHLPKSTL+MLVSAF G +   + Y+HA+   YRF+S+GD
Sbjct: 284 PGYQFKVVDAFSTNFHLPKSTLVMLVSAFAGRDFVLEAYRHAVDEKYRFFSFGD 337


>gi|259046888|ref|ZP_05737289.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Granulicatella adiacens ATCC 49175]
 gi|259036511|gb|EEW37766.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Granulicatella adiacens ATCC 49175]
          Length = 345

 Score =  278 bits (712), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 157/350 (44%), Positives = 207/350 (59%), Gaps = 17/350 (4%)

Query: 4   KEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIVFNN 63
           K+FDFDLP   IA  P+  R S+RL++V         I D   SDL   L + D +V NN
Sbjct: 6   KDFDFDLPEELIAQTPLKDRTSSRLLMVD---KTKHTIEDRHFSDLLEELEAGDTLVVNN 62

Query: 64  TKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQDGQ 123
           T+V+ A+L G +          I   L      + W    +P+K +K G ++ F    G 
Sbjct: 63  TRVLPARLYGTK----EETGAHIEVLLLTNTEGDKWETLVKPAKRMKVGSVVSF----GD 114

Query: 124 SRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDYQTT 183
            RL+ATVI++   G  ++ FS  G+ LE   SL G +PLPPYI  +      D   YQT 
Sbjct: 115 GRLKATVIEELEQGGRIIEFSYEGVFLEVLESL-GEMPLPPYIKER----LEDKERYQTV 169

Query: 184 YAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIMHSE 243
           YAK  GS AAPTAGLHFT  L+ ++   G+ +  VTLHVG GTF PV V+  +DH MHSE
Sbjct: 170 YAKENGSAAAPTAGLHFTEELMQQIRDKGVNIVPVTLHVGLGTFRPVSVDSLEDHKMHSE 229

Query: 244 IGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLET-ATTEDGIINPWSGFTNIFITPGYR 302
              +   TA  + + K  G R+++VGTTS+R LET A   DG + P SG+T+IFI+PGY 
Sbjct: 230 YYNVSKETADMIEATKKAGKRVIAVGTTSIRTLETVARDNDGHVVPASGWTDIFISPGYE 289

Query: 303 FRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           F  VD  ++NFHLPKSTL+MLVSA+ G E T + YQHAI   YRF+S+GD
Sbjct: 290 FGVVDAFVTNFHLPKSTLVMLVSAYLGREFTLEAYQHAIEERYRFFSFGD 339


>gi|168187975|ref|ZP_02622610.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           botulinum C str. Eklund]
 gi|169294189|gb|EDS76322.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           botulinum C str. Eklund]
          Length = 341

 Score =  278 bits (712), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 155/356 (43%), Positives = 204/356 (57%), Gaps = 16/356 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M VK+FDF LP   IA  P+  RD +RLMVV         I   +  D+  +LN  D +V
Sbjct: 1   MKVKDFDFYLPQELIAQHPMEKRDESRLMVVDRKSGQ---IEHKIFKDILGYLNKGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NNT+V+ A+L G +         +I   L  R+  ++W    +P K  K G    F   
Sbjct: 58  LNNTRVLPARLIGEK----ENTGGKIEFLLLKRIEGDTWETLVKPGKKAKIGARFVF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G   L+A V      G  ++ F   GI  E  +  +G +PLPPYI  +      D   Y
Sbjct: 111 -GSGELKAEVRAMGEDGSRIIEFEYEGI-FEEVLDKLGQMPLPPYITER----LEDRERY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT Y+K +GS AAPTAGLHFT  LL  +   GIK+ FVTLHVG GTF PVKVED + H M
Sbjct: 165 QTVYSKEKGSAAAPTAGLHFTEELLKEIKEKGIKIVFVTLHVGLGTFRPVKVEDIEKHHM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   +   TA+ +N+ K  GG+I++VGTTS R LET   E G +   SG+T+IF+ PG
Sbjct: 225 HSEYYTMSKETAEIINNTKENGGKIIAVGTTSCRTLETIGDECGKVRETSGWTDIFMYPG 284

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           Y+F+ VD L++NFHLP+STLLMLVSAF   E     Y+ A+ + YRF+S+GD   L
Sbjct: 285 YKFKVVDRLITNFHLPQSTLLMLVSAFSTRENIMNAYKEAVENKYRFFSFGDAMFL 340


>gi|253681405|ref|ZP_04862202.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           botulinum D str. 1873]
 gi|253561117|gb|EES90569.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           botulinum D str. 1873]
          Length = 341

 Score =  278 bits (712), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 153/356 (42%), Positives = 202/356 (56%), Gaps = 16/356 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M VK+FDF LP   IA  P+  RD +RLMVV         I   +  D+  + N  D +V
Sbjct: 1   MKVKDFDFYLPEELIAQHPMEKRDESRLMVVDRKSGH---IEHKIFKDILGYFNEGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NNT+V+ A+L G +         +I   L  R+  + W    +P K  K G    F   
Sbjct: 58  LNNTRVLPARLIGEK----ENTGGKIEFLLLKRIEGDKWETLVKPGKKAKIGARFVF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G   L+A V      G  ++ F   GI  E  +  +G +PLPPYI  K     R    Y
Sbjct: 111 -GSGELKAEVKGMGEDGSRIIEFEYEGI-FEEVLDKLGQMPLPPYITEKLDDKER----Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT Y+K +GS AAPTAGLHFT  LL  + + G+K+ FVTLHVG GTF PVKVED ++H M
Sbjct: 165 QTVYSKEKGSAAAPTAGLHFTKELLKEIENKGVKIAFVTLHVGLGTFRPVKVEDIEEHHM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   +   TA  +N  K  GG++++VGTTS R LET   E+G +   SG+T+IF+ PG
Sbjct: 225 HSEYYTMSKETADIINKTKENGGKVIAVGTTSCRTLETIGDENGKVKETSGWTDIFMYPG 284

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           Y+F+ VD L++NFHLP+STLLMLVSAF   E     Y+ A+   YRF+S+GD   L
Sbjct: 285 YKFKIVDRLITNFHLPQSTLLMLVSAFSSRENIMNAYKEAVDEKYRFFSFGDAMFL 340


>gi|94990719|ref|YP_598819.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pyogenes MGAS10270]
 gi|166218747|sp|Q1JG69|QUEA_STRPD RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|94544227|gb|ABF34275.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pyogenes MGAS10270]
          Length = 342

 Score =  278 bits (711), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 157/354 (44%), Positives = 215/354 (60%), Gaps = 19/354 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVV-HPNLSCPLVISDHLVSDLPAFLNSNDAI 59
           M   +FDF+LP   IA  P+  RDS++L+++ H   +      DH++  L    N  DA+
Sbjct: 1   MNTNDFDFELPEELIAQTPLEKRDSSKLLIIDHRQKTMVDSHFDHIIDQL----NPGDAL 56

Query: 60  VFNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFS 119
           V NNT+V+ A+L G +          +   L      + W V A+P+K +K G  ++F  
Sbjct: 57  VMNNTRVLPARLYGEK----PDTHGHVELLLLKNTQGDQWEVLAKPAKRLKVGSQVNF-- 110

Query: 120 QDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVD 179
             G   L+AT+ID+   G  ++ FS  GI LE   SL G +PLPPYI  K      D   
Sbjct: 111 --GNGHLKATIIDELEHGGRIVEFSYDGIFLEVLESL-GEMPLPPYIHEK----LEDAER 163

Query: 180 YQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHI 239
           YQT YAK  GS AAPTAGLHFT++LL ++ + G+ + ++TLHVG GTF PV V++ D+H 
Sbjct: 164 YQTVYAKENGSAAAPTAGLHFTTDLLKKIEAKGVHLVYLTLHVGLGTFRPVSVDNLDEHD 223

Query: 240 MHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFIT 298
           MHSE   +    AQ L  VK  GGR+V+VGTTS+R LET  ++  G I   SG+TNIFI 
Sbjct: 224 MHSEFYSLSEEAAQTLRDVKQAGGRVVAVGTTSIRTLETIGSKFQGDIQADSGWTNIFIK 283

Query: 299 PGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           PGY+F+ VD   +NFHLPKSTL+MLVSAF G +   + Y+HA+   YRF+S+GD
Sbjct: 284 PGYQFKVVDAFSTNFHLPKSTLVMLVSAFAGRDFVLEAYRHAVDEKYRFFSFGD 337


>gi|324995358|gb|EGC27270.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus sanguinis SK678]
          Length = 342

 Score =  278 bits (711), Expect = 9e-73,   Method: Compositional matrix adjust.
 Identities = 158/353 (44%), Positives = 209/353 (59%), Gaps = 17/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +FDFDLP   IA  P+  RD++RL+VV          SD     +   L   DA+V
Sbjct: 1   MNTADFDFDLPEELIAQTPLEKRDASRLLVVDKETGA---FSDQHFDQIIDQLQPGDALV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NNT+V+ A+L G++          +   L      + W V A+P+K ++ G  + F   
Sbjct: 58  MNNTRVLPARLYGIK----PETGGHVELLLLKNTKGDDWEVLAKPAKRLRVGAQISF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL ATV+++ + G  ++ F   GI LE   SL G +PLPPYI  K      D   Y
Sbjct: 111 -GDGRLTATVVEELDHGGRIVRFGYEGIFLEVLESL-GEMPLPPYIHEKLA----DRERY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL ++ + G+K+ ++TLHVG GTF PV V+  DDH M
Sbjct: 165 QTVYAKENGSAAAPTAGLHFTEELLEQIAAKGVKLVYLTLHVGLGTFRPVSVDSLDDHEM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           HSE   +    AQ L  VK  GGR+++VGTTS+R LET  ++  G I   SG+TNIFI P
Sbjct: 225 HSEFYSLSEEAAQTLRQVKVNGGRVIAVGTTSIRTLETIGSKFQGQIQADSGWTNIFIRP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           GY ++ VD   +NFHLPKSTL+MLVSAF G   T + Y+HAI+  YRF+S+GD
Sbjct: 285 GYNWKIVDAFSTNFHLPKSTLVMLVSAFAGRSLTLEAYEHAIAERYRFFSFGD 337


>gi|310643556|ref|YP_003948314.1| s-adenosylmethionine:tRNA ribosyltransferase-isomerase, (queuosine
           biosynthesis protein) [Paenibacillus polymyxa SC2]
 gi|309248506|gb|ADO58073.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase, (Queuosine
           biosynthesis protein) [Paenibacillus polymyxa SC2]
          Length = 342

 Score =  278 bits (711), Expect = 9e-73,   Method: Compositional matrix adjust.
 Identities = 149/359 (41%), Positives = 217/359 (60%), Gaps = 19/359 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V ++DF+LP + IA  P+  R ++RL+ ++ N      +  H  SD+  +L   D +V
Sbjct: 1   MNVNDYDFELPETLIAQTPLLERTASRLLTLNKNNGE---VGHHTFSDIVQYLQPGDTLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+VI A+L G++     + E      L  ++  + W    +P K +KKG ++ F  +
Sbjct: 58  LNDTRVIPARLFGIKQDTGAKAE----VLLLKQLEGDRWEALVKPGKKLKKGAVIVFGDE 113

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
                L+A + ++ + G  +L FS  GI  +  +  +G +PLPPYI  K  +D R+   Y
Sbjct: 114 -----LKAVIEEEGDMGGRVLSFSYDGI-FQEILDRLGQMPLPPYI--KEQLDDRER--Y 163

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YA+ +GS AAPTAGLHFT  LL R+   G+ V F+TLHVG GTF P+ V+  ++H+M
Sbjct: 164 QTVYARHEGSAAAPTAGLHFTEELLDRIKEKGVTVAFITLHVGLGTFRPMSVDTIEEHVM 223

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE--DGIINPWSGFTNIFIT 298
           H E   +   TA  LN+ K+RGGR+V+VGTTS R LET  +   DG++   SG+T IFI 
Sbjct: 224 HEEYYSLSQETADVLNATKARGGRVVAVGTTSCRTLETVGSNFVDGVLQASSGWTQIFIY 283

Query: 299 PGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           PGY FR VD +++NFHLPKSTL+MLVSA  G +     YQ AI   YRF+S+GD   ++
Sbjct: 284 PGYEFRVVDAMITNFHLPKSTLVMLVSALAGRKNIMHAYQEAIDQKYRFFSFGDAMFIY 342


>gi|306833044|ref|ZP_07466176.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus bovis ATCC 700338]
 gi|304424943|gb|EFM28077.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus bovis ATCC 700338]
          Length = 342

 Score =  278 bits (711), Expect = 9e-73,   Method: Compositional matrix adjust.
 Identities = 160/354 (45%), Positives = 218/354 (61%), Gaps = 19/354 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVV-HPNLSCPLVISDHLVSDLPAFLNSNDAI 59
           M   +FDF+LP   IA  P+  RDS++L+V+ H          DH++ +L    N  DA+
Sbjct: 1   MNTNDFDFNLPEELIAQTPLEKRDSSKLLVIDHKTHEMVDAHFDHILDEL----NPGDAL 56

Query: 60  VFNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFS 119
           V NNT+V+ A+L G +          +   L      + W V A+P+K ++ G  + F  
Sbjct: 57  VMNNTRVLPARLYGEK----PDTHGHVELLLLKNTQGDQWEVLAKPAKRLRVGVKVSF-- 110

Query: 120 QDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVD 179
             G  RL ATV+++ + G  ++ F+  GI LE   SL G +PLPPYI  K  +D  D   
Sbjct: 111 --GDGRLTATVVEELDHGGRVVEFAYDGIFLEVLESL-GEMPLPPYIHEK--LDDPDR-- 163

Query: 180 YQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHI 239
           YQT YAK  GS AAPTAGLHFT +LL+++ + G+K+ ++TLHVG GTF PV V++ ++H 
Sbjct: 164 YQTVYAKENGSAAAPTAGLHFTQDLLAKIEAKGVKLVYLTLHVGLGTFRPVSVDNIEEHE 223

Query: 240 MHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFIT 298
           MHSE   +    AQ L  VK+ GGR+V+VGTTS+R LET  ++ +G I   SG+TNIFI 
Sbjct: 224 MHSEFYTLSEEAAQTLRDVKAAGGRVVAVGTTSIRTLETIGSKFNGDIKADSGWTNIFIK 283

Query: 299 PGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           PGY F+ VD   +NFHLPKSTL+MLVSAF G E     YQHAI   YRF+S+GD
Sbjct: 284 PGYEFKVVDAFSTNFHLPKSTLVMLVSAFAGREFVLDAYQHAIDEHYRFFSFGD 337


>gi|21910602|ref|NP_664870.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pyogenes MGAS315]
 gi|25091088|sp|Q8K6Z3|QUEA_STRP3 RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|21904803|gb|AAM79673.1| putative S-adenosylmethionine-tRNA ribosyltransferase-isomerase
           [Streptococcus pyogenes MGAS315]
          Length = 342

 Score =  278 bits (711), Expect = 9e-73,   Method: Compositional matrix adjust.
 Identities = 157/354 (44%), Positives = 215/354 (60%), Gaps = 19/354 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVV-HPNLSCPLVISDHLVSDLPAFLNSNDAI 59
           M   +FDF+LP   IA  P+  RDS++L+++ H   +      DH++  L    N  DA+
Sbjct: 1   MNTNDFDFELPEELIAQTPLEKRDSSKLLIIDHRQKTMVDSHFDHIIDQL----NPGDAL 56

Query: 60  VFNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFS 119
           V NNT+V+ A+L G +          +   L      + W V A+P+K +K G  ++F  
Sbjct: 57  VMNNTRVLPARLYGEK----PDTHGHVELLLLKNTQGDQWEVLAKPAKRLKVGSQVNF-- 110

Query: 120 QDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVD 179
             G   L+AT+ID+   G  ++ FS  GI LE   SL G +PLPPYI  K      D   
Sbjct: 111 --GDGHLKATIIDELEHGGRIVEFSYDGIFLEVLESL-GEMPLPPYIHEK----LEDAER 163

Query: 180 YQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHI 239
           YQT YAK  GS AAPTAGLHFT++LL ++ + G+ + ++TLHVG GTF PV V++ D+H 
Sbjct: 164 YQTVYAKENGSAAAPTAGLHFTTDLLKKIEAKGVHLVYLTLHVGLGTFRPVSVDNLDEHD 223

Query: 240 MHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFIT 298
           MHSE   +    AQ L  VK  GGR+V+VGTTS+R LET  ++  G I   SG+TNIFI 
Sbjct: 224 MHSEFYSLSEEAAQTLRDVKQAGGRVVAVGTTSIRTLETIGSKFQGDIQADSGWTNIFIK 283

Query: 299 PGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           PGY+F+ VD   +NFHLPKSTL+MLVSAF G +   + Y+HA+   YRF+S+GD
Sbjct: 284 PGYQFKVVDAFSTNFHLPKSTLVMLVSAFAGRDFVLEAYRHAVDEKYRFFSFGD 337


>gi|327468945|gb|EGF14417.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus sanguinis SK330]
          Length = 342

 Score =  278 bits (711), Expect = 9e-73,   Method: Compositional matrix adjust.
 Identities = 159/353 (45%), Positives = 209/353 (59%), Gaps = 17/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +FDFDLP   IA  P+  RD++RL+VV        V SD     +   L   DA+V
Sbjct: 1   MNTADFDFDLPEELIAQTPLEKRDASRLLVVDKETG---VFSDQHFDQIIDQLQPGDALV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NNT+V+ A+L G++          +   L      + W V A+P+K ++ G  + F   
Sbjct: 58  MNNTRVLPARLYGIK----PETGGHVELLLLKNTQGDDWEVLAKPAKRLRVGAQISF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL ATVI++   G  ++ F   GI LE   SL G +PLPPYI  K     R    Y
Sbjct: 111 -GDGRLTATVIEELEHGGRIVRFGYEGIFLEVLESL-GEMPLPPYIHEKLADRER----Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL ++ + G+K+ ++TLHVG GTF PV V+  DDH M
Sbjct: 165 QTVYAKENGSAAAPTAGLHFTEELLEQIAAKGVKLVYLTLHVGLGTFRPVSVDSLDDHEM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           HSE   +    AQ L  VK+ GG +++VGTTS+R LET  ++  G I   SG+TNIFI P
Sbjct: 225 HSEFYSLSEEAAQTLRQVKANGGHVIAVGTTSIRTLETIGSKFQGQIEADSGWTNIFIKP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           GY ++ VD   +NFHLPKSTL+MLVSAF G   T + Y+HAI+  YRF+S+GD
Sbjct: 285 GYDWKIVDAFSTNFHLPKSTLVMLVSAFAGRSLTLEAYEHAIAERYRFFSFGD 337


>gi|324993331|gb|EGC25251.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus sanguinis SK405]
          Length = 342

 Score =  278 bits (711), Expect = 9e-73,   Method: Compositional matrix adjust.
 Identities = 157/354 (44%), Positives = 208/354 (58%), Gaps = 17/354 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +FDFDLP   IA  P+  RD++RL+VV          SD     +   L   DA+V
Sbjct: 1   MNTADFDFDLPEELIAQAPLEKRDASRLLVVDKETGA---FSDQHFDQIIDQLQPGDALV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NNT+V+ A+L G++          +   L   +  + W V A+P+K ++ G  + F   
Sbjct: 58  MNNTRVLPARLYGIK----PETGGHVELLLLKNIQDDDWEVLAKPAKRLRVGAQISF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL ATV+D+   G  ++ F   GI LE   SL G +PLPPYI  K     R    Y
Sbjct: 111 -GDGRLTATVVDELEHGGRIVRFGYEGIFLEVLESL-GEMPLPPYIHEKLADRER----Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL ++ + G+ + ++TLHVG GTF PV V+  DDH M
Sbjct: 165 QTVYAKENGSAAAPTAGLHFTEELLEQIAAKGVNLVYLTLHVGLGTFRPVSVDSLDDHEM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           HSE   +    A  L  VK+ GGR+++VGTTS+R LET  ++  G I   SG+TNIFI P
Sbjct: 225 HSEFYSLSEEAAHTLRQVKANGGRVIAVGTTSIRTLETIGSKFQGQIQADSGWTNIFIKP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDT 353
           GY ++ VD   +NFHLPKSTL+MLVSAF G   T + Y+HAI+  YRF+S+GD 
Sbjct: 285 GYDWKVVDAFSTNFHLPKSTLVMLVSAFAGRSLTLEAYEHAIAERYRFFSFGDA 338


>gi|319947352|ref|ZP_08021585.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus australis ATCC 700641]
 gi|319746594|gb|EFV98854.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus australis ATCC 700641]
          Length = 342

 Score =  278 bits (711), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 157/354 (44%), Positives = 211/354 (59%), Gaps = 17/354 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +FDF LP   IA  P+  RD+++L++++        + D     +   L   DA+V
Sbjct: 1   MNTNDFDFHLPEELIAQTPLEKRDASKLLILNRQTGQ---MEDQHFDAIINELEPGDALV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NNT+V+ A+L+GV+          +   L   +  + W V A+P+K +K+G ++ F   
Sbjct: 58  MNNTRVLPARLHGVK----PDTGGHVELLLLKNIEGDQWEVLAKPAKRLKEGGVVSF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL+AT+I K   G  ++ FS  GI LE   SL G +PLPPYI  K      D   Y
Sbjct: 111 -GDGRLQATLIKKLEHGGCIVEFSYQGIFLEVLESL-GEMPLPPYIHEK----LEDQERY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL ++   G+ + ++TLHVG GTF PV V++ D H M
Sbjct: 165 QTVYAKENGSAAAPTAGLHFTPELLQKIEDKGVHLVYLTLHVGLGTFRPVSVDNLDQHEM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           HSE   +    AQ L  VK+ G RIV+VGTTS+R LET   + +G +   SG+TNIFI P
Sbjct: 225 HSEFYQLSEEAAQTLRQVKASGHRIVAVGTTSIRTLETIGNKFNGELQADSGWTNIFIKP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDT 353
           GY+++ VD   +NFHLPKSTL+MLVSAF G E T   YQHAI   YRF+S+GD 
Sbjct: 285 GYQWQVVDAFSTNFHLPKSTLVMLVSAFAGRELTLNAYQHAIDQGYRFFSFGDA 338


>gi|308070377|ref|YP_003871982.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase (Queuosine
           biosynthesis protein queA) [Paenibacillus polymyxa E681]
 gi|305859656|gb|ADM71444.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase (Queuosine
           biosynthesis protein queA) [Paenibacillus polymyxa E681]
          Length = 342

 Score =  278 bits (710), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 149/359 (41%), Positives = 217/359 (60%), Gaps = 19/359 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V ++DF+LP + IA  P+  R ++RL+ ++ N      +  H  SD+  +L   D +V
Sbjct: 1   MNVNDYDFELPETLIAQTPLLDRSASRLLTLNKNNGE---VGHHTFSDIVQYLQPGDTLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+VI A+L G++     + E      L  ++  + W    +P K +KKG ++ F  +
Sbjct: 58  LNDTRVIPARLFGIKEDTGAKAE----VLLLKQLQGDRWKALVKPGKKLKKGAVIVFGDE 113

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
                L+A + ++ + G  +L FS  GI  +  ++ +G +PLPPYI  K  +D R+   Y
Sbjct: 114 -----LKAVIEEEGDMGGRVLSFSYDGI-FQEILNRLGQMPLPPYI--KEQLDDRER--Y 163

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YA+ +GS AAPTAGLHFT  LL ++   G+ V F+TLHVG GTF P+ V+  ++H+M
Sbjct: 164 QTVYARHEGSAAAPTAGLHFTEELLDQIKKKGVTVAFITLHVGLGTFRPMSVDTIEEHVM 223

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE--DGIINPWSGFTNIFIT 298
           H E   +   TA  LN  K+RGGR+V+VGTTS R LET   +  DG++   SG+T IFI 
Sbjct: 224 HEEYYSLSQETADVLNETKARGGRVVAVGTTSCRTLETVGNKFLDGVLEASSGWTQIFIY 283

Query: 299 PGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           PGY FR VD +++NFHLPKSTL+MLVSA  G E     YQ AI   YRF+S+GD   ++
Sbjct: 284 PGYEFRVVDAMITNFHLPKSTLVMLVSALAGRENIMHAYQEAIDRQYRFFSFGDAMFIY 342


>gi|149202089|ref|ZP_01879062.1| Queuosine biosynthesis protein [Roseovarius sp. TM1035]
 gi|149144187|gb|EDM32218.1| Queuosine biosynthesis protein [Roseovarius sp. TM1035]
          Length = 362

 Score =  278 bits (710), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 163/358 (45%), Positives = 226/358 (63%), Gaps = 13/358 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FDFDLP + IA RP  PR +ARL+V          I+D  V+DL  +L   D +V
Sbjct: 1   MKLSDFDFDLPEALIATRPARPRRAARLLVAEGE-----GITDAGVADLGRWLRPGDRLV 55

Query: 61  FNNTKVITAQLNGVRFCHINRRE--KEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFF 118
            N+T+VI A+L+G+R     + +   +I  TL    +  SW    +P K + +G+ + F 
Sbjct: 56  LNDTRVIPARLSGLRHRSGAQGDTAAKIEVTLLEPGADGSWGALIKPLKKVSEGEEIVF- 114

Query: 119 SQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYV 178
                 RL A ++ K   G+  L F++ G + +  ++  G +PLPPYIA +RP D +D V
Sbjct: 115 ----SERLSAVLLAK-EEGQGRLRFNLVGDDFDAALAEAGAMPLPPYIAARRPADEQDKV 169

Query: 179 DYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDH 238
           DYQT +A+  G+VAAPTA LHF   LL+ L ++G+    VTLHVGAGTF+PVKVED   H
Sbjct: 170 DYQTVWARAPGAVAAPTASLHFDEALLAELAALGVGFSHVTLHVGAGTFLPVKVEDVTTH 229

Query: 239 IMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFIT 298
            MH+E G + A  A  + + ++ GGRI+ VGTT+LRL+ETA    G I  WSG T+IFI 
Sbjct: 230 RMHAEWGEVSAKAAAEMAATRAAGGRIIPVGTTALRLIETAARATGEIAAWSGDTDIFIY 289

Query: 299 PGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           PG+ FR  D LM+NFHLPKSTL+MLVSA  G +  +++Y HA++  YRF+SYGD SLL
Sbjct: 290 PGFEFRVADALMTNFHLPKSTLMMLVSALMGQDTIRRIYAHAVAARYRFFSYGDASLL 347


>gi|283795917|ref|ZP_06345070.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           sp. M62/1]
 gi|291076554|gb|EFE13918.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           sp. M62/1]
          Length = 341

 Score =  278 bits (710), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 152/356 (42%), Positives = 210/356 (58%), Gaps = 16/356 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M VK+F FDLP   IA  P+  R S+RL+V+  +      +      D+  +LN  D +V
Sbjct: 1   MDVKDFYFDLPQELIAQDPLEDRASSRLLVLDRSTG---EVEHRKFRDILEYLNPGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+TKVI A+L G +       + +I   L  R   + W    +P K  K G ++ F   
Sbjct: 58  INDTKVIPARLIGSK----EGTDAKIEVLLLKRKENDIWETLVKPGKKAKPGTVIRF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G   L+ TV+D    G  L+ FS  GI  E  +  +G +PLPPYI  +     +D   Y
Sbjct: 111 -GDGILKGTVVDVVEEGNRLIQFSYEGI-FEEILDQLGQMPLPPYITHQ----LKDKNRY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK +GS AAPTAGLHFT  LL  +   G+K+  VTLHVG GTF PVKVE+  DH M
Sbjct: 165 QTVYAKHEGSAAAPTAGLHFTKELLQEIEDRGVKIAHVTLHVGLGTFRPVKVENVLDHHM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   ++   A+ +NS K  GGR++ VGTTS R +E+A+ E+G++   SG+T+IFI PG
Sbjct: 225 HSEFYVVEKSEAEKINSTKREGGRVICVGTTSCRTIESASDENGVLKAGSGWTDIFIYPG 284

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           Y+F+ +D L++NFHLP+STL+MLVSA  G E     Y+ A+   YRF+S+GD   +
Sbjct: 285 YQFKILDCLITNFHLPESTLVMLVSALAGREHVLAAYEEAVKERYRFFSFGDAMFI 340


>gi|295090985|emb|CBK77092.1| S-adenosylmethionine--tRNA ribosyltransferase-isomerase
           [Clostridium cf. saccharolyticum K10]
          Length = 341

 Score =  278 bits (710), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 152/356 (42%), Positives = 210/356 (58%), Gaps = 16/356 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M VK+F FDLP   IA  P+  R S+RL+V+  +      +      D+  +LN  D +V
Sbjct: 1   MDVKDFYFDLPQELIAQDPLEDRASSRLLVLDRSTG---EVEHRKFRDILEYLNPGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+TKVI A+L G +       + +I   L  R   + W    +P K  K G ++ F   
Sbjct: 58  INDTKVIPARLIGSK----EGTDAKIEVLLLKRKENDIWETLVKPGKKAKPGTVIRF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G   L+ TV+D    G  L+ FS  GI  E  +  +G +PLPPYI  +     +D   Y
Sbjct: 111 -GDGILKGTVVDVVEEGNRLIQFSYEGI-FEEILDQLGQMPLPPYITHQ----LKDKNRY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK +GS AAPTAGLHFT  LL  +   G+K+  VTLHVG GTF PVKVE+  DH M
Sbjct: 165 QTVYAKHEGSAAAPTAGLHFTKELLQEIEDRGVKIAHVTLHVGLGTFRPVKVENVLDHHM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   ++   A+ +NS K  GGR++ VGTTS R +E+A+ E+G++   SG+T+IFI PG
Sbjct: 225 HSEFYVVEESEAEKINSTKREGGRVICVGTTSCRTIESASDENGVLKAGSGWTDIFIYPG 284

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           Y+F+ +D L++NFHLP+STL+MLVSA  G E     Y+ A+   YRF+S+GD   +
Sbjct: 285 YQFKILDCLITNFHLPESTLVMLVSALAGREHVLAAYEEAVKERYRFFSFGDAMFI 340


>gi|150016410|ref|YP_001308664.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           beijerinckii NCIMB 8052]
 gi|189038514|sp|A6LTM8|QUEA_CLOB8 RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|149902875|gb|ABR33708.1| S-adenosylmethionine--tRNA-ribosyltransferase-isomerase
           [Clostridium beijerinckii NCIMB 8052]
          Length = 341

 Score =  278 bits (710), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 150/356 (42%), Positives = 204/356 (57%), Gaps = 16/356 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M VK+FDF LP   IA  P+  RDS+RLMV+         I      D+  +LN  D +V
Sbjct: 1   MNVKDFDFYLPEELIAQHPLEQRDSSRLMVLDKKTGE---IKHKKFHDIIEYLNEGDTLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NNT+V+ A+L G +     +    I   L  R+  + W   A+P K  K G    F   
Sbjct: 58  LNNTRVMPARLIGEKEGTGGK----IEFLLLKRIEKDRWECLAKPGKSAKVGRKFTF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G+ +L+A V++    G  ++ F   GI  E  +  +G +PLPPYI  +      D   Y
Sbjct: 111 -GEGKLKAEVVEVEENGNRIVEFFYDGI-FEEVLDSLGEMPLPPYIHER----LEDRERY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT Y+K  GS AAPTAGLHFT  LL  + + GI + ++TLHVG GTF PVKVE  ++H M
Sbjct: 165 QTVYSKENGSAAAPTAGLHFTKELLQEIKNKGINIVYLTLHVGLGTFRPVKVESLEEHEM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   +   +A  +N  K RG  ++SVGTTS R LET   E+G +   SG+TNIFI PG
Sbjct: 225 HSEFYMLSKESADIINETKKRGNAVISVGTTSTRTLETIGDENGFVKEQSGWTNIFIYPG 284

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           Y+F+ VD L++NFHLP+STL+MLVS   G E     Y+ A++  YRF+S+GD   +
Sbjct: 285 YKFKVVDKLITNFHLPESTLIMLVSTLAGRENVMNAYEEAVNEKYRFFSFGDAMFI 340


>gi|325688305|gb|EGD30324.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus sanguinis SK72]
          Length = 342

 Score =  278 bits (710), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 157/354 (44%), Positives = 210/354 (59%), Gaps = 17/354 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +FDFDLP   IA  P+  RD++RL+VV          SD     +   L   DA+V
Sbjct: 1   MNTADFDFDLPEELIAQTPLEKRDASRLLVVDKETGA---FSDQHFDQIIDQLQPGDALV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NNT+V+ A+L G++          +   L      + W V A+P+K ++ G  + F   
Sbjct: 58  MNNTRVLPARLYGIK----PETGGHVELLLLKNTKGDDWEVLAKPAKRLRVGAQISF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL ATV+++ + G  ++ F   GI LE   SL G +PLPPYI  K      D   Y
Sbjct: 111 -GDGRLTATVVEELDHGGRIVRFGYEGIFLEVLESL-GEMPLPPYIHEKLA----DRERY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL ++ + G+K+ ++TLHVG GTF PV V+  +DH M
Sbjct: 165 QTVYAKENGSAAAPTAGLHFTEELLEQIAAKGVKLVYLTLHVGLGTFRPVSVDSLEDHEM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           HSE   +    AQ L  VK+ GGR+++VGTTS+R LET  ++  G I   SG+TNIFI P
Sbjct: 225 HSEFYSLSEEAAQILRQVKANGGRVIAVGTTSIRTLETIGSKFQGQIQADSGWTNIFIKP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDT 353
           GY ++ VD   +NFHLPKSTL+MLVSAF G   T + Y+HAI+  YRF+S+GD 
Sbjct: 285 GYNWKIVDAFSTNFHLPKSTLVMLVSAFAGRSLTLEAYEHAIAERYRFFSFGDA 338


>gi|302385235|ref|YP_003821057.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase [Clostridium
           saccharolyticum WM1]
 gi|302195863|gb|ADL03434.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase [Clostridium
           saccharolyticum WM1]
          Length = 349

 Score =  278 bits (710), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 152/356 (42%), Positives = 210/356 (58%), Gaps = 16/356 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V++F+F+LP   IA  P+  R ++RL+V+  +      I      D+ ++L   D +V
Sbjct: 1   MNVRDFNFNLPQELIAQDPLEDRSASRLLVLDKHTG---EIQHRHFRDILSYLRKGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+TKVI A+L GV+       E +I   L  R   + W    +P K  K G ++ F   
Sbjct: 58  INDTKVIPARLFGVK----EGTEAKIEILLLKRRENDIWETLVKPGKKAKMGTVISF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G+  L+ TVID    G  L+ FS  GI  E  +  +G +PLPPYI  +     +D   Y
Sbjct: 111 -GEGLLKGTVIDVVEEGNRLIQFSYEGI-FEEILDRLGQMPLPPYITHQ----LKDKNRY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK +GS AAPTAGLHFT  LL  +  +G+ +  VTLHVG GTF PVKV++ + H M
Sbjct: 165 QTVYAKHEGSAAAPTAGLHFTKELLKEIEDMGVSIAHVTLHVGLGTFRPVKVDEIEAHHM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   ++   A+ +N  K  GGRIV VGTTS R +E+A+  DG++   SG+T IFI PG
Sbjct: 225 HSEFYMVEEEEARKVNDAKKNGGRIVCVGTTSCRTVESASGSDGMLRAGSGWTEIFIYPG 284

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           YRF+ +D L++NFHLP+STL+MLVSA  G +     Y+ AI   YRF+S+GD   L
Sbjct: 285 YRFKLLDCLITNFHLPESTLVMLVSALAGRDHVLHAYEEAIKERYRFFSFGDAMFL 340


>gi|329116810|ref|ZP_08245527.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus parauberis NCFD 2020]
 gi|326907215|gb|EGE54129.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus parauberis NCFD 2020]
          Length = 342

 Score =  278 bits (710), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 158/354 (44%), Positives = 216/354 (61%), Gaps = 19/354 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVV-HPNLSCPLVISDHLVSDLPAFLNSNDAI 59
           M   +FDFDLP   IA  P+  RDS++L+++ H   +      DH++ +L    N  DA+
Sbjct: 1   MNTNDFDFDLPEELIAQTPLEKRDSSKLLIIDHKKETMVDSHFDHIIKEL----NPGDAL 56

Query: 60  VFNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFS 119
           V NNT+V+ A+L G +       +  +   L    S + W V A+P+K ++ G  + F  
Sbjct: 57  VMNNTRVLPARLYGEK----PDTKGHVELLLLKNTSGDQWEVLAKPAKRLRVGSQVSF-- 110

Query: 120 QDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVD 179
             G  RL ATVI++   G  ++ FS  GI LE   SL G +PLPPYI  K     R    
Sbjct: 111 --GDGRLSATVIEELEHGGRIVEFSYDGIFLEVLESL-GEMPLPPYIHEKLEDSER---- 163

Query: 180 YQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHI 239
           YQT YAK  GS AAPTAGLHFT  LL ++ + G+K+ ++TLHVG GTF PV V++ D+H 
Sbjct: 164 YQTVYAKENGSAAAPTAGLHFTQELLEKIEAKGVKLVYLTLHVGLGTFRPVSVDNVDEHD 223

Query: 240 MHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFIT 298
           MHSE   +    A  L  VK+ GGR+++VGTTS+R LET  ++  G I   SG+TNIFI 
Sbjct: 224 MHSEFYSLSEEAATTLRQVKADGGRVIAVGTTSIRTLETIGSKFKGEIVADSGWTNIFIK 283

Query: 299 PGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           PGY+F  VD   +NFHLPKSTL+MLVSAF G +   + Y+HA++  YRF+S+GD
Sbjct: 284 PGYQFTIVDAFSTNFHLPKSTLVMLVSAFAGRDFVLEAYKHAVNEKYRFFSFGD 337


>gi|187933823|ref|YP_001885223.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           botulinum B str. Eklund 17B]
 gi|238691636|sp|B2TMZ3|QUEA_CLOBB RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|187721976|gb|ACD23197.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           botulinum B str. Eklund 17B]
          Length = 341

 Score =  278 bits (710), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 154/361 (42%), Positives = 207/361 (57%), Gaps = 26/361 (7%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M VK+FDF LP   IA  P+  RD++RLMV+         IS     D+  +LN  D +V
Sbjct: 1   MNVKDFDFYLPEELIAQHPLEKRDTSRLMVLDKETGE---ISHKNFYDIIDYLNEGDTLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKE-----ISCTLHMRVSPNSWSVYARPSKVIKKGDIL 115
            NNT+V+ A+L G         EKE     I   L  RV  + W   A+P K  + G   
Sbjct: 58  LNNTRVMPARLIG---------EKEGTGGKIEFLLLKRVEKDRWECLAKPGKSARVGRRF 108

Query: 116 HFFSQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDAR 175
            F    G  +L+A V++  + G  ++ F   GI  E  +  +G +PLPPYI  +      
Sbjct: 109 TF----GDGKLKAEVVEVKDNGNRIVEFYYEGI-FEEVLDSLGEMPLPPYIHER----LE 159

Query: 176 DYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDT 235
           D   YQT Y+K  GS AAPTAGLHFT  LL ++   GI + +VTLHVG GTF PVKV+  
Sbjct: 160 DRERYQTVYSKENGSAAAPTAGLHFTEELLHKIKDRGINIAYVTLHVGLGTFRPVKVDTI 219

Query: 236 DDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNI 295
           +DH MHSE   +    A+ +N+ K RG +++SVGTTS R LET   EDG +   +G+TNI
Sbjct: 220 EDHEMHSEYYHLSKEDAEVINATKKRGNKVISVGTTSTRTLETIADEDGNVKETNGWTNI 279

Query: 296 FITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSL 355
           FI PGY+F+ VD L++NFHLP+STL+MLVS   G E     Y+ A+   YRF+S+GD   
Sbjct: 280 FIYPGYKFKVVDRLITNFHLPESTLIMLVSTLAGKEHVMNAYEEAVKEKYRFFSFGDAMF 339

Query: 356 L 356
           +
Sbjct: 340 I 340


>gi|52081250|ref|YP_080041.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           licheniformis ATCC 14580]
 gi|52786630|ref|YP_092459.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           licheniformis ATCC 14580]
 gi|319644783|ref|ZP_07999016.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           sp. BT1B_CT2]
 gi|81609021|sp|Q65GP8|QUEA_BACLD RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|52004461|gb|AAU24403.1| S-adenosylmethionine tRNA ribosyltransferase [Bacillus
           licheniformis ATCC 14580]
 gi|52349132|gb|AAU41766.1| QueA [Bacillus licheniformis ATCC 14580]
 gi|317392592|gb|EFV73386.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           sp. BT1B_CT2]
          Length = 342

 Score =  277 bits (709), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 157/357 (43%), Positives = 211/357 (59%), Gaps = 17/357 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V+ FDFDLP   IA  P+  RD++RLMV+         I+      +  FLN+ D IV
Sbjct: 1   MKVELFDFDLPERLIAQVPLKERDASRLMVLDKKTG---EITHSTFKHVIDFLNAGDCIV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+V+ A+L GV+         ++   L  +   + W    +P+K +K+G +L F   
Sbjct: 58  LNDTRVLPARLYGVK----EETGAKVEVLLLKQEEGDVWETLVKPAKRVKRGTVLSF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL A   ++   G   + F   GI  E   SL G +PLPPYI  K  +D R+   Y
Sbjct: 111 -GDGRLTAVCTEELEHGGRKIEFRYEGIFYEVLESL-GEMPLPPYI--KEQLDDRER--Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT Y+K QGS AAPTAGLHFT  +L  L   G+ + F+TLHVG GTF PV  E+ ++H M
Sbjct: 165 QTVYSKKQGSAAAPTAGLHFTEEILDALREKGVHIAFITLHVGLGTFRPVSAENVEEHDM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           H+E   +   TA  LN V+  GGRI+SVGTTS R LET  +E DG     SG+T+IFI P
Sbjct: 225 HAEFYEMSEETAALLNRVRQEGGRIISVGTTSTRTLETIASEHDGRFREASGWTSIFIYP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           GY FRA+D +++NFHLPKS+L+MLVSA  G E     Y+ A+ H YRF+S+GD  L+
Sbjct: 285 GYTFRAIDGMITNFHLPKSSLIMLVSALAGREHVLSAYRTAVEHEYRFFSFGDAMLI 341


>gi|313890811|ref|ZP_07824436.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pseudoporcinus SPIN 20026]
 gi|313120912|gb|EFR44026.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pseudoporcinus SPIN 20026]
          Length = 342

 Score =  277 bits (709), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 160/354 (45%), Positives = 211/354 (59%), Gaps = 19/354 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVV-HPNLSCPLVISDHLVSDLPAFLNSNDAI 59
           M   +FDF+LP   IA  P+  RDS++L+++ H   +      DH++  L    N  DA+
Sbjct: 1   MNTNDFDFELPEELIAQTPLEQRDSSKLLIIDHKAKTMVDSHFDHIIDQL----NPGDAL 56

Query: 60  VFNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFS 119
           V NNT+V+ A+L+G +          +   L   +  + W V A+P+K +K G  + F  
Sbjct: 57  VMNNTRVLPARLHGEK----PDTHGHVELLLLKNIQGDDWEVLAKPAKRLKVGSSISF-- 110

Query: 120 QDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVD 179
             G  RL ATVI +   G  ++ FS  GI LE   SL G +PLPPYI  K     R    
Sbjct: 111 --GDGRLTATVIKELEHGGRIVSFSYQGIFLEVLESL-GEMPLPPYIHEKLDDSER---- 163

Query: 180 YQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHI 239
           YQT YAK  GS AAPTAGLHFT  LL ++   G+ + ++TLHVG GTF PV V++ D+H 
Sbjct: 164 YQTVYAKENGSAAAPTAGLHFTQALLQKIQEKGVHLVYLTLHVGLGTFRPVSVDNVDEHE 223

Query: 240 MHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFIT 298
           MHSE   +    A  L  VK  GGR+V+VGTTS+R LET   + +G I   SG+TNIFI 
Sbjct: 224 MHSEFYQLSEEAADTLRQVKKAGGRVVAVGTTSIRTLETIGNKFNGDIQADSGWTNIFIK 283

Query: 299 PGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           PGYRF  VD   +NFHLPKSTL+MLVSAF G E   + Y+HAI+  YRF+S+GD
Sbjct: 284 PGYRFTVVDAFSTNFHLPKSTLVMLVSAFAGREFVLEAYKHAINEHYRFFSFGD 337


>gi|170761651|ref|YP_001788389.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           botulinum A3 str. Loch Maree]
 gi|238688788|sp|B1L0B1|QUEA_CLOBM RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|169408640|gb|ACA57051.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           botulinum A3 str. Loch Maree]
          Length = 341

 Score =  277 bits (708), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 152/364 (41%), Positives = 210/364 (57%), Gaps = 32/364 (8%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M VK+FDF LP   IA  P+  RD ARL+V+         I   +  D+  +L  ND +V
Sbjct: 1   MKVKDFDFYLPEELIAQHPMEKRDEARLLVLDKETG---EIEHKIFKDILDYLTPNDCLV 57

Query: 61  FNNTKVITAQLNGVR--------FCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKG 112
            NNT+V+ A+L G +        F  + R+EK++            W    +P K  + G
Sbjct: 58  LNNTRVLPARLIGAKEETGGKMEFLLLKRKEKDV------------WETLVKPGKRAQIG 105

Query: 113 DILHFFSQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPI 172
               F    G   L+A VI     G  ++ F   GI  E  +  +G +PLPPYI  K  +
Sbjct: 106 ARFIF----GNGELKAEVIGMGEEGSRIVKFYYEGI-FEEILDQLGQMPLPPYIKEK--L 158

Query: 173 DARDYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKV 232
           D ++   YQT Y+K +GS AAPTAGLHFT  LL ++   G+K+ F+TLHVG GTF PVKV
Sbjct: 159 DDKEM--YQTVYSKEEGSAAAPTAGLHFTEELLKKIKEKGVKLAFLTLHVGLGTFRPVKV 216

Query: 233 EDTDDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGF 292
           ED  +H+MHSE   +D  TA+ +N  K +GGR+++VGTTS R LET    +G +   SG+
Sbjct: 217 EDIQEHVMHSEYYKMDKETAEIINDTKEKGGRVIAVGTTSCRTLETIGDIEGKVREQSGW 276

Query: 293 TNIFITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           T+IFI PGY+++ VD L++NFHLP+STLLMLVSA  G +     Y  A+   YRF+S+GD
Sbjct: 277 TDIFIYPGYKYKVVDALITNFHLPQSTLLMLVSALAGRDNIMNAYNVAVEKEYRFFSFGD 336

Query: 353 TSLL 356
              +
Sbjct: 337 AMFI 340


>gi|323352665|ref|ZP_08087635.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus sanguinis VMC66]
 gi|322121701|gb|EFX93447.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus sanguinis VMC66]
          Length = 342

 Score =  277 bits (708), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 157/353 (44%), Positives = 209/353 (59%), Gaps = 17/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +FDFDLP   IA  P+  RD++RL+VV          SD     +   L   DA+V
Sbjct: 1   MNTADFDFDLPEELIAQTPLEKRDASRLLVVDKETGA---FSDQHFDQIIDQLQPGDALV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NNT+V+ A+L G++          +   L      + W V A+P+K ++ G  + F   
Sbjct: 58  MNNTRVLPARLYGIK----PETGGHVELLLLKNTQGDDWEVLAKPAKRLRVGSQISF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL ATV+++ + G  ++ F   GI LE   SL G +PLPPYI  K     R    Y
Sbjct: 111 -GDGRLTATVVEELDHGGRIVRFGYEGIFLEVLESL-GEMPLPPYIHEKLADRER----Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL ++ + G+K+ ++TLHVG GTF PV V+  DDH M
Sbjct: 165 QTVYAKENGSAAAPTAGLHFTEELLEQIAAKGVKLVYLTLHVGLGTFRPVSVDSLDDHEM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           HSE   +    AQ L  VK+ G R+++VGTTS+R LET  ++  G I   SG+TNIFI P
Sbjct: 225 HSEFYSLSEEAAQTLRQVKANGDRVIAVGTTSIRTLETIGSKFQGQIQADSGWTNIFIKP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           GY ++ VD   +NFHLPKSTL+MLVSAF G   T + Y+HAI+  YRF+S+GD
Sbjct: 285 GYDWKIVDAFSTNFHLPKSTLVMLVSAFAGRSLTLEAYEHAIAERYRFFSFGD 337


>gi|312866079|ref|ZP_07726300.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus downei F0415]
 gi|311098483|gb|EFQ56706.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus downei F0415]
          Length = 342

 Score =  277 bits (708), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 158/354 (44%), Positives = 213/354 (60%), Gaps = 19/354 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVIS-DHLVSDLPAFLNSNDAI 59
           M  ++F+F LP   IA  P+  RDS++L+V+  N    L    DH++ +L    N  DA+
Sbjct: 1   MNTEDFNFHLPEDLIAQTPLEKRDSSKLLVIDHNKHTMLDSHFDHILEEL----NPGDAL 56

Query: 60  VFNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFS 119
           V NNT+V+ A+L+G +          +   L      + W V A+P+K +  G  + F  
Sbjct: 57  VMNNTRVLPARLHGEK----PETHGHVEFLLLKNTQGDQWEVLAKPAKRLHVGTEVSF-- 110

Query: 120 QDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVD 179
             G  RL ATV+++   G  ++ F   GI LE   SL G +PLPPYI  K      D   
Sbjct: 111 --GDGRLRATVLEELEHGGRIVQFHYEGIFLEVLESL-GEMPLPPYIHEK----LEDQEH 163

Query: 180 YQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHI 239
           YQT YAK  GS AAPTAGLHFT  LL ++ + G+K+ ++TLHVG GTF PV V++ +DH 
Sbjct: 164 YQTVYAKENGSAAAPTAGLHFTQELLEKIEAKGVKLVYLTLHVGLGTFRPVSVDNIEDHE 223

Query: 240 MHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFIT 298
           MHSE        AQ L  VK+ GGRIV+VGTTS+R LET   + +G I   SG+TNIFI 
Sbjct: 224 MHSEFYQFSEEAAQTLRQVKASGGRIVAVGTTSIRTLETIGNKFNGQIQADSGWTNIFIK 283

Query: 299 PGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           PGY+F+ VD   +NFHLPKSTL+MLVSAF G +   + Y+HA+   YRF+S+GD
Sbjct: 284 PGYQFKLVDAFSTNFHLPKSTLVMLVSAFAGRDFVLEAYKHAVEEHYRFFSFGD 337


>gi|326390116|ref|ZP_08211677.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Thermoanaerobacter ethanolicus JW 200]
 gi|325993764|gb|EGD52195.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Thermoanaerobacter ethanolicus JW 200]
          Length = 341

 Score =  277 bits (708), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 147/359 (40%), Positives = 212/359 (59%), Gaps = 22/359 (6%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   EF F+LP   IA  P+  R S+RLMV++        +   +  ++  +L + D +V
Sbjct: 1   MKRSEFYFELPEELIAQEPLEDRSSSRLMVLNRKTGE---VQHDIFKNITKYLKAGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREK---EISCTLHMRVSPNSWSVYARPSKVIKKGDILHF 117
            N+TKVI A+L       I RR+    +I   L  R+S N W    +P +  K G  + F
Sbjct: 58  LNDTKVIPARL-------IGRRQDSGGKIEFVLLKRLSVNEWETLVKPGRRAKVGTRVVF 110

Query: 118 FSQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDY 177
               G   L A ++D    G  ++ F   G+  E  +  +G +P+PPYI +K     +D 
Sbjct: 111 ----GNGELVAEILDNTEVGGRVVRFYYEGL-FEEVLDKLGEMPVPPYIKKK----LKDK 161

Query: 178 VDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDD 237
             YQT YAK +GS AAPTAGLHFT  LL ++  +G+K  F+TLHVG GTF PVK E  ++
Sbjct: 162 ERYQTVYAKYEGSAAAPTAGLHFTEELLEKIRQMGVKTVFITLHVGLGTFRPVKEEIIEN 221

Query: 238 HIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFI 297
           H MH E   +    A+ +N+ + +GGR+++VGTTS R LET   E+G I   SG+T+IFI
Sbjct: 222 HKMHEEFYIVTKEAAEEINATREKGGRVIAVGTTSTRTLETVADENGYIREKSGWTDIFI 281

Query: 298 TPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
            PGY+F+A+D +++NFHLP+STL+M+VSAF G E   + Y+ AI   YRF+S+GD  L+
Sbjct: 282 YPGYKFKAIDGMITNFHLPESTLIMMVSAFAGKENIMRAYKIAIEERYRFFSFGDAMLI 340


>gi|153940081|ref|YP_001392347.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           botulinum F str. Langeland]
 gi|166216716|sp|A7GHT7|QUEA_CLOBL RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|152935977|gb|ABS41475.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           botulinum F str. Langeland]
 gi|295320339|gb|ADG00717.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           botulinum F str. 230613]
          Length = 341

 Score =  277 bits (708), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 153/364 (42%), Positives = 209/364 (57%), Gaps = 32/364 (8%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M VK+FDF LP   IA  P+  RD ARL+V+         I   +  D+  +L  ND +V
Sbjct: 1   MKVKDFDFYLPEELIAQHPMEKRDEARLLVLDKETG---EIEHKIFKDILDYLTPNDCLV 57

Query: 61  FNNTKVITAQLNG--------VRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKG 112
            NNT+V+ A+L G        + F  + R+EK++            W    +P K  + G
Sbjct: 58  LNNTRVLPARLIGSKEETGGKMEFLLLKRKEKDV------------WETLVKPGKRAQIG 105

Query: 113 DILHFFSQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPI 172
               F    G   LEA VI     G  ++ F   GI  E  +  +G +PLPPYI  K  +
Sbjct: 106 ARFIF----GNGELEAEVIGMGEEGSRIVKFYYEGI-FEEILDQLGQMPLPPYIKEK--L 158

Query: 173 DARDYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKV 232
           D ++   YQT Y+K +GS AAPTAGLHFT  LL ++   G+K+ F+TLHVG GTF PVKV
Sbjct: 159 DDKEM--YQTVYSKEEGSAAAPTAGLHFTEELLKKIEEKGVKLAFLTLHVGLGTFRPVKV 216

Query: 233 EDTDDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGF 292
           ED  +H+MHSE   +D  TA+ +N  K  GGR+++VGTTS R LET    +G +   SG+
Sbjct: 217 EDIQEHVMHSEYYKMDKKTAEIINDTKENGGRVIAVGTTSCRTLETIGDIEGKVGEQSGW 276

Query: 293 TNIFITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           T+IFI PGY+++ VD L++NFHLP+STLLMLVSA  G +     Y  A+   YRF+S+GD
Sbjct: 277 TDIFIYPGYKYKVVDALITNFHLPQSTLLMLVSALAGRDNIMNAYNVAVEKEYRFFSFGD 336

Query: 353 TSLL 356
              +
Sbjct: 337 AMFI 340


>gi|163790793|ref|ZP_02185219.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Carnobacterium sp. AT7]
 gi|159873973|gb|EDP68051.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Carnobacterium sp. AT7]
          Length = 343

 Score =  276 bits (707), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 152/353 (43%), Positives = 213/353 (60%), Gaps = 17/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           +  K+FDFDLP   IA  P+  R S++L+++         + D   +D+   L+  DA+V
Sbjct: 2   LTTKDFDFDLPEELIAQTPLENRSSSKLLILDKETGK---VEDKHFTDILDELHEGDALV 58

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+V+ A+L+G++          I   L      + W    +P+K    G+++ F   
Sbjct: 59  MNDTRVLPARLHGIK----TETGAHIEILLLKNTENDRWETLVKPAKKATVGNVISF--- 111

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL ATV ++   G  ++ FS  GI LE   SL G +PLPPYI  +     R    Y
Sbjct: 112 -GDGRLTATVKEELTHGGRIIDFSYEGIFLEVLESL-GEMPLPPYIKERLEDSER----Y 165

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL ++ + G+++ F+TLHVG GTF PV V+  +DH M
Sbjct: 166 QTVYAKENGSAAAPTAGLHFTQELLEQIKAKGVQLVFLTLHVGLGTFRPVSVDSIEDHEM 225

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           HSE   +   +A AL +V+  GG+IV+VGTTS+R LET  T+ +G +   SG+T+IFI+P
Sbjct: 226 HSEFYRLTEESAAALTAVQKNGGKIVAVGTTSIRTLETIGTKFNGELKADSGWTDIFISP 285

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           GY+F+ VD   +NFHLPKSTL+MLVSAF G E     YQHA+   YRF+S+GD
Sbjct: 286 GYKFKVVDAFSTNFHLPKSTLVMLVSAFAGREHVLAAYQHAVDEKYRFFSFGD 338


>gi|296331683|ref|ZP_06874152.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           subtilis subsp. spizizenii ATCC 6633]
 gi|305675358|ref|YP_003867030.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           subtilis subsp. spizizenii str. W23]
 gi|296151278|gb|EFG92158.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           subtilis subsp. spizizenii ATCC 6633]
 gi|305413602|gb|ADM38721.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           subtilis subsp. spizizenii str. W23]
          Length = 342

 Score =  276 bits (707), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 153/358 (42%), Positives = 213/358 (59%), Gaps = 17/358 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  FDF+LP   IA  P+  RD++RLMV+  +      ++D     + +F    D +V
Sbjct: 1   MKVDLFDFELPERLIAQVPLEQRDASRLMVLDKHTG---ELTDSSFKHIISFFKEGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NNT+V+ A+L G +         ++   L  + + + W   A+P+K +KKG ++ F   
Sbjct: 58  LNNTRVLPARLFGTK----EDTGAKVELLLLKQEAGDRWETLAKPAKRVKKGTVVTF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL+A   ++   G   + F   GI  E   SL G +PLPPYI  K  +D R+   Y
Sbjct: 111 -GDGRLKAVCTEELEHGGRRMEFQYDGIFYEVLESL-GEMPLPPYI--KEQLDDRER--Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT Y+K  GS AAPTAGLHFT  +L +L   G+++ F+TLHVG GTF PV  +D ++H M
Sbjct: 165 QTVYSKEIGSAAAPTAGLHFTEEILQQLKDKGVQIEFITLHVGLGTFRPVSADDVEEHNM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           H+E   +   TA ALN V+  GGRI+SVGTTS R LET   E DG     SG+T+IFI P
Sbjct: 225 HAEFYQMSEETAAALNKVRENGGRIISVGTTSTRTLETIAGEHDGQFKASSGWTSIFIYP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           GY F+A+D +++NFHLPKS+L+MLVSA  G E   + Y HA+   YRF+S+GD  L+ 
Sbjct: 285 GYEFKAIDGMITNFHLPKSSLIMLVSALAGRENVLRAYNHAVEEEYRFFSFGDAMLIL 342


>gi|148381020|ref|YP_001255561.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           botulinum A str. ATCC 3502]
 gi|153931608|ref|YP_001385391.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           botulinum A str. ATCC 19397]
 gi|153935623|ref|YP_001388798.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           botulinum A str. Hall]
 gi|166216714|sp|A7FY18|QUEA_CLOB1 RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|166216715|sp|A5I6F0|QUEA_CLOBH RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|148290504|emb|CAL84632.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           botulinum A str. ATCC 3502]
 gi|152927652|gb|ABS33152.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           botulinum A str. ATCC 19397]
 gi|152931537|gb|ABS37036.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           botulinum A str. Hall]
          Length = 341

 Score =  276 bits (707), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 152/364 (41%), Positives = 209/364 (57%), Gaps = 32/364 (8%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M VK+FDF LP   IA  P+  RD ARL+V+         I   +  D+  +L  ND +V
Sbjct: 1   MKVKDFDFYLPEELIAQHPIEKRDEARLLVLDKETG---EIEHKIFKDILDYLTPNDCLV 57

Query: 61  FNNTKVITAQLNGVR--------FCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKG 112
            NNT+V+ A+L G +        F  + R+EK++            W    +P K  + G
Sbjct: 58  LNNTRVLPARLIGAKEETGGKMEFLLLKRKEKDV------------WETLVKPGKRAQIG 105

Query: 113 DILHFFSQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPI 172
               F    G   L+A VI     G  ++ F   GI  E  +  +G +PLPPYI  K  +
Sbjct: 106 ARFIF----GNGELKAEVIGMGEEGSRIVKFYYEGI-FEEILDQLGQMPLPPYIKEK--L 158

Query: 173 DARDYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKV 232
           D ++   YQT Y+K +GS AAPTAGLHFT  LL ++   G+K+ F+TLHVG GTF PVKV
Sbjct: 159 DDKEM--YQTVYSKEEGSAAAPTAGLHFTEELLKKIEEKGVKLAFLTLHVGLGTFRPVKV 216

Query: 233 EDTDDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGF 292
           ED  +H+MHSE   +D  TA+ +N  K  GGR+++VGTTS R LET    +G +   SG+
Sbjct: 217 EDIQEHVMHSEYYKMDKKTAEIINDTKENGGRVIAVGTTSCRTLETIGAIEGKVGEQSGW 276

Query: 293 TNIFITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           T+IFI PGY+++ VD L++NFHLP+STLLMLVSA  G +     Y  A+   YRF+S+GD
Sbjct: 277 TDIFIYPGYKYKVVDALITNFHLPQSTLLMLVSALAGRDNIMNAYNVAVEKEYRFFSFGD 336

Query: 353 TSLL 356
              +
Sbjct: 337 AMFI 340


>gi|170757777|ref|YP_001782704.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           botulinum B1 str. Okra]
 gi|229598025|sp|B1IMF2|QUEA_CLOBK RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|169122989|gb|ACA46825.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           botulinum B1 str. Okra]
          Length = 341

 Score =  276 bits (707), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 152/364 (41%), Positives = 209/364 (57%), Gaps = 32/364 (8%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M VK+FDF LP   IA  P+  RD ARL+V+         I   +  D+  +L  ND +V
Sbjct: 1   MKVKDFDFYLPEELIAQHPMEKRDEARLLVLDKETG---EIEHKIFKDILDYLTPNDCLV 57

Query: 61  FNNTKVITAQLNG--------VRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKG 112
            NNT+V+ A+L G        + F  + R+EK++            W    +P K  + G
Sbjct: 58  LNNTRVLPARLIGSKEETGGKMEFLLLKRKEKDV------------WETLVKPGKRAQIG 105

Query: 113 DILHFFSQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPI 172
               F    G   L+A VI     G  ++ F   GI  E  +  +G +PLPPYI  K  +
Sbjct: 106 ARFIF----GNGELKAEVIGMGEEGSRIVKFYYEGI-FEEILDQLGQMPLPPYIKEK--L 158

Query: 173 DARDYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKV 232
           D ++   YQT Y+K +GS AAPTAGLHFT  LL ++   G+K+ F+TLHVG GTF PVKV
Sbjct: 159 DDKEM--YQTVYSKEEGSAAAPTAGLHFTEELLKKIEEKGVKLAFLTLHVGLGTFRPVKV 216

Query: 233 EDTDDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGF 292
           ED  +H+MHSE   +D  TA+ +N  K  GGR+++VGTTS R LET    +G +   SG+
Sbjct: 217 EDIQEHVMHSEYYKMDKKTAEIINDTKENGGRVIAVGTTSCRTLETIADIEGKVGEQSGW 276

Query: 293 TNIFITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           T+IFI PGY+++ VD L++NFHLP+STLLMLVSA  G +     Y  A+   YRF+S+GD
Sbjct: 277 TDIFIYPGYKYKVVDALITNFHLPQSTLLMLVSALAGKDNIMNAYNVAVEKEYRFFSFGD 336

Query: 353 TSLL 356
              +
Sbjct: 337 AMFI 340


>gi|298369998|ref|ZP_06981314.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Neisseria
           sp. oral taxon 014 str. F0314]
 gi|298281458|gb|EFI22947.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Neisseria
           sp. oral taxon 014 str. F0314]
          Length = 343

 Score =  276 bits (707), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 155/356 (43%), Positives = 215/356 (60%), Gaps = 18/356 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FDFDLP + IA  P   R  +RL+   P++     + D   SDLP ++ + D +V
Sbjct: 1   MDISDFDFDLPQALIAQHPPKVRGGSRLLAALPDMP----LQDAAFSDLPDYIGAGDVLV 56

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FNNTKV+ A+L G +         +I   +   +  ++   + R SK  K G +L F   
Sbjct: 57  FNNTKVMKARLFGQK-----ESGGKIEALIERVLDGHTALAHIRSSKSPKAGTVLIF--- 108

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
             +  + A +I++   G++  +    G  +   +   G +PLPPYI  +R  D  D   Y
Sbjct: 109 --EGGIRAVMIER--AGDLFCLRFDCGQTVYELLEQNGRLPLPPYI--ERAADDDDDSRY 162

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK QG+VAAPTAGLHFT  LL RL + G++   VTLHVGAGTF PV+V +  DH M
Sbjct: 163 QTVYAKYQGAVAAPTAGLHFTDELLGRLKAKGVETAEVTLHVGAGTFQPVRVSNIADHKM 222

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   +   T  A+ + ++RGGR+ +VGTTS+R LE+A  E G +    G T+IFITPG
Sbjct: 223 HSEWFDVPPETVAAIEAAQARGGRVWAVGTTSMRALESAARETGRLKAGQGDTDIFITPG 282

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           YRF   D L++NFHLPKSTLLMLV+AF G+E  + +Y+HA+ H YRF+SYGD  LL
Sbjct: 283 YRFNVADRLITNFHLPKSTLLMLVAAFSGMEHIRAVYRHAVEHEYRFFSYGDAMLL 338


>gi|150390105|ref|YP_001320154.1| S-adenosylmethionine--tRNA-ribosyltransferase-isomerase
           [Alkaliphilus metalliredigens QYMF]
 gi|167016401|sp|A6TQM7|QUEA_ALKMQ RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|149949967|gb|ABR48495.1| S-adenosylmethionine--tRNA-ribosyltransferase-isomerase
           [Alkaliphilus metalliredigens QYMF]
          Length = 341

 Score =  276 bits (706), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 154/356 (43%), Positives = 210/356 (58%), Gaps = 16/356 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   EFDFDLP   IA  P+  RD +RLMV+  N     ++  H   D+  +LN  D +V
Sbjct: 1   MKTNEFDFDLPDRLIAQTPLEKRDHSRLMVLDKNKQE--IVHKHFY-DITDYLNPGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NNT+V+ A+L GV+         ++   L  R+  N+W V  +P K  K G    F   
Sbjct: 58  INNTRVLPARLFGVK----ENTGGKMEFLLLKRIDLNTWEVLVKPGKKAKIGSRFEF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G+  L+A V+   + G  ++ F   G+  E  +  +G +PLPPYI      +  D   Y
Sbjct: 111 -GEGILKAEVLSMADEGARIVRFEYEGV-FEELLDQLGKMPLPPYITE----ELADRERY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT Y+K +GS AAPTAGLHFT  LLS +   GI V  +TLHVG GTF PVKV+  ++H M
Sbjct: 165 QTVYSKHEGSSAAPTAGLHFTPELLSEIKKKGINVVSITLHVGLGTFRPVKVDSLENHEM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           H+E   I    AQ +N  K  G R+ +VGTTS R LE+A+TE G I    G+TNIFI PG
Sbjct: 225 HAEYYEITEEAAQVINDTKKAGNRVFAVGTTSCRTLESASTEKGKIEANKGWTNIFIFPG 284

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           Y+F+ +D L++NFHLP+STL+MLVSA  G E+T + Y+ A+   YRF+S+GD  L+
Sbjct: 285 YQFKILDGLITNFHLPESTLIMLVSALLGKEKTLQAYKVAVDEQYRFFSFGDAMLI 340


>gi|313895559|ref|ZP_07829115.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Selenomonas
           sp. oral taxon 137 str. F0430]
 gi|312975685|gb|EFR41144.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Selenomonas
           sp. oral taxon 137 str. F0430]
          Length = 346

 Score =  276 bits (706), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 154/360 (42%), Positives = 214/360 (59%), Gaps = 18/360 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FD+DLP  RIA  P+ PRD++RLMV+ P       I      +L   L   D ++
Sbjct: 1   MDISDFDYDLPEKRIAQTPLEPRDASRLMVLDP---AEQTIEHRHFYELDVLLQPGDVLI 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FN+T+VI A+L G R    ++   ++   L  ++  + W    +P K  + GD + F  +
Sbjct: 58  FNDTRVIPARLIGAR----DKTGAKVEVLLLRQIDRDRWEALVKPGKKARIGDRIRFGEE 113

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
                L   +I   + G  ++ F   GI  E  +  +G +PLPPYI RK+  DA  Y   
Sbjct: 114 -----LSCGIISHTDFGGRIVKFIYQGI-FEEILDRLGEMPLPPYI-RKKLSDADRY--- 163

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT Y++ +GS AAPTAGLHFT  LL RL   G+   FVTLHVG GTF PV+ +  ++H+M
Sbjct: 164 QTIYSRERGSAAAPTAGLHFTEELLVRLKEKGVIFGFVTLHVGLGTFRPVQEQTIENHVM 223

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           H E   I   TAQ +   K+ G RIV+VGTTS+R LE+A  E G I P SG+T+IFI PG
Sbjct: 224 HREYYAIPEETAQIIRRAKAEGRRIVAVGTTSIRTLESAAGETGEIRPTSGWTDIFIYPG 283

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLFQKR 360
           YRF+ VD +++NFHLPKSTL+ML+SAF G       Y+ A+   YRF+S+GD ++L Q R
Sbjct: 284 YRFKVVDAIITNFHLPKSTLIMLISAFAGRSFILNAYKQAVDEGYRFFSFGD-AMLIQGR 342


>gi|312623361|ref|YP_004024974.1| s-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Caldicellulosiruptor kronotskyensis 2002]
 gi|312203828|gb|ADQ47155.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Caldicellulosiruptor kronotskyensis 2002]
          Length = 346

 Score =  276 bits (706), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 153/358 (42%), Positives = 213/358 (59%), Gaps = 22/358 (6%)

Query: 5   EFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIVFNNT 64
           +F +DLP   IA +PV PRDS+RLMV+ P+      I   +  D+  +LN  D +V NN+
Sbjct: 8   DFHYDLPDELIAQKPVEPRDSSRLMVILPDGR----IEHRIFRDIVDYLNEGDCLVLNNS 63

Query: 65  KVITAQLNGVRFCHINRREKE---ISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQD 121
           KVI A+L       I +RE     I   L  R+  N+W V  RP K  +KG    F   +
Sbjct: 64  KVIPARL-------IGQREDTGSFIEFLLVKRLDINTWEVMTRPGKKARKGR--RFVFGN 114

Query: 122 GQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDYQ 181
           G+ + E   +++   G  ++ F   G+  E  +  +G IPLPPYI  K  +D  D   YQ
Sbjct: 115 GELKAEVLHVNR-EEGTRIVRFYYDGV-FEEVLERLGKIPLPPYI--KEELD--DLSRYQ 168

Query: 182 TTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIMH 241
           T Y+K+ GS AAPTAGLHFT  LLSR+   G+++ +VTLHVG GTF PVKVE+ ++H MH
Sbjct: 169 TVYSKVPGSAAAPTAGLHFTEELLSRISKKGVEILYVTLHVGLGTFKPVKVENVEEHKMH 228

Query: 242 SEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPGY 301
            E   I    A  +N  K  G RI++VGTTS R+LE+   E+G +    G+T+IFI PGY
Sbjct: 229 EEYYEISQDVADKINKAKELGKRIIAVGTTSCRVLESCCDENGKVKAKKGWTDIFIYPGY 288

Query: 302 RFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLFQK 359
            F+ +D L++NFHLP +TL+MLV AF G E     Y+ A+   YRF+S+GD  L+ ++
Sbjct: 289 EFKVLDGLVTNFHLPDTTLMMLVCAFGGYERIMNAYKIAVDMRYRFFSFGDAMLILRR 346


>gi|323702061|ref|ZP_08113729.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Desulfotomaculum nigrificans DSM 574]
 gi|323532943|gb|EGB22814.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Desulfotomaculum nigrificans DSM 574]
          Length = 341

 Score =  276 bits (706), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 150/356 (42%), Positives = 210/356 (58%), Gaps = 16/356 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + ++D+ LP   IA  P+  RD +RLMVVH +             D+  +L   D +V
Sbjct: 1   MRLSDYDYQLPEELIAQEPLVNRDQSRLMVVHKDNQN---FEHKHFKDIINYLQPGDVLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+TKVI A++ G R         +I   L  +++ N W    +P K  + GDIL F   
Sbjct: 58  LNDTKVIPARIFGTRIA----TGAKIEVLLLRQLTANRWETLVKPGKKARVGDILDF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            GQ +++  ++D  + G  ++ FS       + +  +GT+PLPPYI  K+P+   D   Y
Sbjct: 111 -GQGQMQGKILDHTDVGGRIIEFSFRE-PFVQVLERIGTMPLPPYI--KKPLA--DQQRY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YA+ +GS AAPTAGLHFT  LL+ + S G+    V LHVG GTF PV+VED   H M
Sbjct: 165 QTVYARQEGSAAAPTAGLHFTPELLAEIRSRGVITVNVLLHVGLGTFRPVQVEDITQHHM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           H E   +    A+ +N+ + RGGRI++VGTTS+R LET+  + G +   SG T+IFI PG
Sbjct: 225 HEEYYEVTPEAAEKINTARERGGRIIAVGTTSVRCLETSANQAGQVLAGSGLTDIFIYPG 284

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           YRF+ V+ L++NFHLPKSTLLMLVSA  G E+    YQ A+   YRF+S+GD  L+
Sbjct: 285 YRFKVVEGLITNFHLPKSTLLMLVSALAGREKILAAYQEAVRQRYRFFSFGDAMLI 340


>gi|304436494|ref|ZP_07396468.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Selenomonas
           sp. oral taxon 149 str. 67H29BP]
 gi|304370540|gb|EFM24191.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Selenomonas
           sp. oral taxon 149 str. 67H29BP]
          Length = 343

 Score =  276 bits (706), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 153/360 (42%), Positives = 217/360 (60%), Gaps = 18/360 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FD+ LP  +IA  P  PRDS+R+MV+ P       I       L  +L   D ++
Sbjct: 1   MNISDFDYFLPEEQIAQVPADPRDSSRMMVLSPKTQS---IEHRHFYQLDEYLTDGDVLI 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FN+T+VI A+L GVR     + E      L  ++  + W V  +P K ++ G ++ F  +
Sbjct: 58  FNDTRVIPARLIGVRQPTGGKAE----VFLLRQLERDRWEVLVKPGKKMRVGSVITFGHE 113

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
                L   V+   + G  ++ FS  GI  E  +  +GT+PLPPYI        +D   Y
Sbjct: 114 -----LSCEVLAYTDFGGRIVKFSYEGI-FEEILERLGTMPLPPYIHET----LQDPERY 163

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT Y++ +GS AAPTAGLHFT  L+ RL   G+++ FVTLHVG GTF PV+V++ +DH+M
Sbjct: 164 QTIYSREKGSAAAPTAGLHFTEALMDRLRKKGVRLGFVTLHVGLGTFRPVQVDEIEDHVM 223

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   I   TA  +   K  G R+++VGTTS+R LE+A  + G+I    G+TNIFI PG
Sbjct: 224 HSEFYSIPTETADLIRMAKQEGRRVIAVGTTSIRTLESAAVDHGMIEAKQGWTNIFIYPG 283

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLFQKR 360
           Y+F+ VD +++NFHLPKSTL+MLVSAF G E T K Y+ A+   YRF+S+GD ++L Q R
Sbjct: 284 YQFKIVDAVITNFHLPKSTLIMLVSAFAGREFTLKAYRTAVEENYRFFSFGD-AMLIQSR 342


>gi|288904875|ref|YP_003430097.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus gallolyticus UCN34]
 gi|306830927|ref|ZP_07464089.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus gallolyticus subsp. gallolyticus TX20005]
 gi|325977816|ref|YP_004287532.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus gallolyticus subsp. gallolyticus ATCC
           BAA-2069]
 gi|288731601|emb|CBI13156.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus gallolyticus UCN34]
 gi|304426950|gb|EFM30060.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus gallolyticus subsp. gallolyticus TX20005]
 gi|325177744|emb|CBZ47788.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus gallolyticus subsp. gallolyticus ATCC
           BAA-2069]
          Length = 342

 Score =  276 bits (705), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 159/354 (44%), Positives = 217/354 (61%), Gaps = 19/354 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVV-HPNLSCPLVISDHLVSDLPAFLNSNDAI 59
           M   +FDF+LP   IA  P+  RDS++L+V+ H          DH++ +L    N  DA+
Sbjct: 1   MNTNDFDFNLPEELIAQTPLEKRDSSKLLVIDHKTHEMVDAHFDHILDEL----NPGDAL 56

Query: 60  VFNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFS 119
           V NNT+V+ A+L G +          +   L      + W V A+P+K ++ G  + F  
Sbjct: 57  VMNNTRVLPARLYGEK----PDTHGHVELLLLKNTQGDQWEVLAKPAKRLRVGAKVSF-- 110

Query: 120 QDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVD 179
             G  RL ATV+++ + G  ++ F+  GI LE   SL G +PLPPYI  K  +D  D   
Sbjct: 111 --GDGRLTATVVEELDHGGRIVEFAYDGIFLEVLESL-GEMPLPPYIHEK--LDDPDR-- 163

Query: 180 YQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHI 239
           YQT YAK  GS AAPTAGLHFT +LL+++ + G+K+ ++TLHVG GTF PV V++ ++H 
Sbjct: 164 YQTVYAKENGSAAAPTAGLHFTQDLLAKIEAKGVKLVYLTLHVGLGTFRPVSVDNIEEHE 223

Query: 240 MHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFIT 298
           MHSE   +    AQ L  VK+ G R+V+VGTTS+R LET  ++ +G I   SG+TNIFI 
Sbjct: 224 MHSEFYTLSEEAAQTLRDVKAAGRRVVAVGTTSIRTLETIGSKFNGDIKADSGWTNIFIK 283

Query: 299 PGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           PGY F+ VD   +NFHLPKSTL+MLVSAF G E     YQHAI   YRF+S+GD
Sbjct: 284 PGYEFKVVDAFSTNFHLPKSTLVMLVSAFAGREFVLDAYQHAIDERYRFFSFGD 337


>gi|251782850|ref|YP_002997153.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus dysgalactiae subsp. equisimilis GGS_124]
 gi|242391480|dbj|BAH81939.1| S-adenosylmethionine/tRNA ribosyltransferase-isomerase
           [Streptococcus dysgalactiae subsp. equisimilis GGS_124]
          Length = 342

 Score =  276 bits (705), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 157/356 (44%), Positives = 215/356 (60%), Gaps = 23/356 (6%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVIS---DHLVSDLPAFLNSND 57
           M   +FDFDLP   IA  P+  RDS++L+++  +    ++I    DH++  L    N  D
Sbjct: 1   MNTNDFDFDLPEELIAQTPLEKRDSSKLLII--DHEQKIMIDSHFDHIIDQL----NPGD 54

Query: 58  AIVFNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHF 117
           A+V NNT+V+ A+L G +          +   L      + W V A+P+K +K G  + F
Sbjct: 55  ALVMNNTRVLPARLYGEK----PDTHGHVELLLLKNTHGDQWEVLAKPAKRLKVGSQVSF 110

Query: 118 FSQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDY 177
               G  RL AT++++   G  ++ F+  GI LE   SL G +PLPPYI  K     R  
Sbjct: 111 ----GDGRLTATIVEELEHGGRIVEFNYEGIFLEVLESL-GEMPLPPYIHEKLDDAER-- 163

Query: 178 VDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDD 237
             YQT YAK  GS AAPTAGLHFT++LLS++ + G+ + ++TLHVG GTF PV V++ DD
Sbjct: 164 --YQTVYAKENGSAAAPTAGLHFTTDLLSKIDAKGVHLVYLTLHVGLGTFRPVSVDNLDD 221

Query: 238 HIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIF 296
           H MHSE   +    AQ L  VK  GG +V+VGTTS+R LET  ++  G I   SG+TNIF
Sbjct: 222 HDMHSEFYSLSEEAAQTLRDVKKAGGHVVAVGTTSIRTLETIGSKFQGDIQADSGWTNIF 281

Query: 297 ITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           I PGY+F+ VD   +NFHLPKSTL+MLVSAF G +     Y+HA+   YRF+S+GD
Sbjct: 282 IKPGYQFKVVDAFSTNFHLPKSTLVMLVSAFAGRDFVLDAYKHAVDEKYRFFSFGD 337


>gi|16079825|ref|NP_390650.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           subtilis subsp. subtilis str. 168]
 gi|221310710|ref|ZP_03592557.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           subtilis subsp. subtilis str. 168]
 gi|221315034|ref|ZP_03596839.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           subtilis subsp. subtilis str. NCIB 3610]
 gi|221319955|ref|ZP_03601249.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           subtilis subsp. subtilis str. JH642]
 gi|221324236|ref|ZP_03605530.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           subtilis subsp. subtilis str. SMY]
 gi|321312300|ref|YP_004204587.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           subtilis BSn5]
 gi|3914532|sp|O32054|QUEA_BACSU RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|2635237|emb|CAB14732.1| S-adenosylmethionine tRNA ribosyltransferase-isomerase [Bacillus
           subtilis subsp. subtilis str. 168]
 gi|6977807|emb|CAB75332.1| QueA protein [Bacillus subtilis subsp. subtilis str. 168]
 gi|291485182|dbj|BAI86257.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           subtilis subsp. natto BEST195]
 gi|320018574|gb|ADV93560.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           subtilis BSn5]
          Length = 342

 Score =  276 bits (705), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 152/357 (42%), Positives = 214/357 (59%), Gaps = 17/357 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  FDF+LP   IA  P+  RD++RLMV+  +      ++D     + +F N  D +V
Sbjct: 1   MKVDLFDFELPERLIAQVPLEQRDASRLMVLDKHTG---ELTDSSFKHIISFFNEGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NNT+V+ A+L G +         ++   L  + + + W   A+P+K +KKG ++ F   
Sbjct: 58  LNNTRVLPARLFGTK----EDTGAKVELLLLKQETGDKWETLAKPAKRVKKGTVVTF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL+A   ++   G   + F   GI  E   SL G +PLPPYI  K  +D ++   Y
Sbjct: 111 -GDGRLKAICTEELEHGGRKMEFQYDGIFYEVLESL-GEMPLPPYI--KEQLDDKER--Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT Y+K  GS AAPTAGLHFT  +L +L   G+++ F+TLHVG GTF PV  ++ ++H M
Sbjct: 165 QTVYSKEIGSAAAPTAGLHFTEEILQQLKDKGVQIEFITLHVGLGTFRPVSADEVEEHNM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           H+E   +   TA ALN V+  GGRI+SVGTTS R LET   E DG     SG+T+IFI P
Sbjct: 225 HAEFYQMSEETAAALNKVRENGGRIISVGTTSTRTLETIAGEHDGQFKASSGWTSIFIYP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           GY F+A+D +++NFHLPKS+L+MLVSA  G E   + Y HA+   YRF+S+GD  L+
Sbjct: 285 GYEFKAIDGMITNFHLPKSSLIMLVSALAGRENILRAYNHAVEEEYRFFSFGDAMLI 341


>gi|320528956|ref|ZP_08030048.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Selenomonas
           artemidis F0399]
 gi|320138586|gb|EFW30476.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Selenomonas
           artemidis F0399]
          Length = 346

 Score =  275 bits (704), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 152/360 (42%), Positives = 211/360 (58%), Gaps = 18/360 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FD+DLP  RIA  P+ PRD++RLMV+ P       I      +L   L   D ++
Sbjct: 1   MDISDFDYDLPEERIAQTPLEPRDASRLMVLDP---AEQTIEHRHFYELDVLLQPGDVLI 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FN+T+VI A+L G R    ++   ++   L  ++  + W    +P K  + GD + F  +
Sbjct: 58  FNDTRVIPARLIGAR----DKTGAKVEVLLLRQIDRDRWEALVKPGKKARIGDRIRFGEE 113

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
                L   +I   + G  ++ F   GI  E  +  +G +PLPPYI  K      D   Y
Sbjct: 114 -----LSCGIISHTDFGGRIVKFIYQGI-FEEILDRLGEMPLPPYIREK----LSDADRY 163

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT Y++ +GS AAPTAGLHFT  LL RL   G+   FVTLHVG GTF PV+ +  ++H+M
Sbjct: 164 QTIYSRERGSAAAPTAGLHFTEELLVRLKEKGVIFGFVTLHVGLGTFRPVQEQTIENHVM 223

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           H E   I   TAQ +   K+ G RIV+VGTTS+R LE+A  E G I P SG+T+IFI PG
Sbjct: 224 HREYYAIPEETAQIIRRAKAEGRRIVAVGTTSIRTLESAAGETGEIRPTSGWTDIFIYPG 283

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLFQKR 360
           YRF+ VD +++NFHLPKSTL+ML+SAF G       Y+ A+   YRF+S+GD ++L Q R
Sbjct: 284 YRFKVVDAIITNFHLPKSTLIMLISAFAGRSFILNAYKQAVDEGYRFFSFGD-AMLIQGR 342


>gi|222528286|ref|YP_002572168.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Caldicellulosiruptor bescii DSM 6725]
 gi|222455133|gb|ACM59395.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Caldicellulosiruptor bescii DSM 6725]
          Length = 346

 Score =  275 bits (704), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 151/358 (42%), Positives = 214/358 (59%), Gaps = 22/358 (6%)

Query: 5   EFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIVFNNT 64
           +F +DLP   IA +PV PRDS+RLMV+ P+      I   +  D+  +LN  D +V NN+
Sbjct: 8   DFHYDLPDELIAQKPVEPRDSSRLMVILPDGR----IEHRIFRDIVEYLNEGDCLVLNNS 63

Query: 65  KVITAQLNGVRFCHINRREKE---ISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQD 121
           KVI A+L       I +RE+    I   L  R+  N+W V  RP K  +KG    F   +
Sbjct: 64  KVIPARL-------IGQREETGSFIEFLLIKRLDINTWEVMTRPGKKARKGR--RFVFGN 114

Query: 122 GQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDYQ 181
           G+ + E   +++   G  ++ F   G+  E  +  +G IPLPPYI  K  +D  D   YQ
Sbjct: 115 GELKAEVLHVNR-EEGTRVVRFYYDGV-FEEVLERLGKIPLPPYI--KEELD--DLSRYQ 168

Query: 182 TTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIMH 241
           T Y+K+ GS AAPTAGLHFT  LLSR+   G+++ +VTLHVG GTF PVKVE+ ++H MH
Sbjct: 169 TVYSKVPGSAAAPTAGLHFTEELLSRISKKGVEILYVTLHVGLGTFKPVKVENVEEHKMH 228

Query: 242 SEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPGY 301
            E   I     + +N  K  G R+++VGTTS R+LE+   E+G +    G+T+IFI PGY
Sbjct: 229 EEYYEISEDVTERINRAKELGKRVIAVGTTSCRVLESCCDENGKVKAKKGWTDIFIYPGY 288

Query: 302 RFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLFQK 359
            F+ +D L++NFHLP +TL+MLV AF G E     Y+ A+   YRF+S+GD  L+ ++
Sbjct: 289 EFKVLDGLVTNFHLPDTTLMMLVCAFGGYERIMNAYKIAVDMRYRFFSFGDAMLILRR 346


>gi|307692339|ref|ZP_07634576.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Ruminococcaceae bacterium D16]
          Length = 341

 Score =  275 bits (704), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 153/358 (42%), Positives = 207/358 (57%), Gaps = 20/358 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +FDF LP   IA  P+  RD++RL+ +  +      +  H   +LP FL   D +V
Sbjct: 1   MKTSDFDFYLPEELIAQTPLERRDASRLLTLDKHTG---AVEHHHFYELPQFLRPGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPN--SWSVYARPSKVIKKGDILHFF 118
            NN++VI A+L       I  R     C + + V      W    RP + +K G  + F 
Sbjct: 58  LNNSRVIPARL-------IGHRPTGGVCEVLLLVDKGDKCWECLVRPGRKLKPGAQVIF- 109

Query: 119 SQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYV 178
             DG + L AT+  + + G+ L+ F   GI LE  +  +G +PLPPYI      + +D  
Sbjct: 110 -GDG-TELTATIEKELDDGKRLVRFHYEGIFLE-ILERLGKMPLPPYIK----AELQDNE 162

Query: 179 DYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDH 238
            YQT Y+K+ GS AAPTAGLHFT  LL ++  +G+KV +VTLHVG GTF PVK ED  DH
Sbjct: 163 RYQTVYSKVVGSAAAPTAGLHFTPELLEKVQEMGVKVCYVTLHVGLGTFRPVKAEDIQDH 222

Query: 239 IMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFIT 298
            MHSE   I   TA  +N  K  GGR++ VGTTS R +E+   EDG +   SG+TNIFI 
Sbjct: 223 EMHSEYCMISQETADVINETKKNGGRVICVGTTSCRTIESFAAEDGTMTERSGWTNIFIY 282

Query: 299 PGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           PGYRF+ +D L++NFHLP+STL+MLVSA  G E     Y+ A+   YRF+S+GD   +
Sbjct: 283 PGYRFKVLDALITNFHLPESTLIMLVSALAGREHVLAAYEEAVRERYRFFSFGDAMFI 340


>gi|168179563|ref|ZP_02614227.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           botulinum NCTC 2916]
 gi|168181759|ref|ZP_02616423.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           botulinum Bf]
 gi|226950498|ref|YP_002805589.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           botulinum A2 str. Kyoto]
 gi|237796525|ref|YP_002864077.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           botulinum Ba4 str. 657]
 gi|254764272|sp|C1FKG0|QUEA_CLOBJ RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|259551441|sp|C3KTD1|QUEA_CLOB6 RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|182669806|gb|EDT81782.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           botulinum NCTC 2916]
 gi|182675035|gb|EDT86996.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           botulinum Bf]
 gi|226842049|gb|ACO84715.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           botulinum A2 str. Kyoto]
 gi|229263462|gb|ACQ54495.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           botulinum Ba4 str. 657]
          Length = 341

 Score =  275 bits (704), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 151/364 (41%), Positives = 210/364 (57%), Gaps = 32/364 (8%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M VK+FDF LP   IA  P+  RD ARL+V+         I   +  D+  +L  ND +V
Sbjct: 1   MKVKDFDFYLPEELIAQHPMEKRDEARLLVLDKKTGG---IEHKIFKDILDYLTPNDCLV 57

Query: 61  FNNTKVITAQLNGVR--------FCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKG 112
            NNT+V+ A+L G +        F  + R+EK++            W    +P K  + G
Sbjct: 58  LNNTRVLPARLIGAKEETGGKMEFLLLKRKEKDV------------WETLVKPGKRAQIG 105

Query: 113 DILHFFSQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPI 172
               F    G   L+A VI     G  ++ F   GI  E  +  +G +PLPPYI  K  +
Sbjct: 106 ARFIF----GNGELKAEVIGMGEEGSRIVKFYYEGI-FEEILDQLGQMPLPPYIKEK--L 158

Query: 173 DARDYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKV 232
           D ++   YQT Y+K +GS AAPTAGLHFT  LL ++   G+K+ F+TLHVG GTF PVKV
Sbjct: 159 DDKEM--YQTVYSKEEGSAAAPTAGLHFTEELLKKIKEKGVKLAFLTLHVGLGTFRPVKV 216

Query: 233 EDTDDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGF 292
           E+  +H+MHSE   +D  TA+ +N  K +GGR+++VGTTS R LET    +G +   SG+
Sbjct: 217 ENIQEHVMHSEYYKMDKETAEIINDTKEKGGRVIAVGTTSCRTLETIGDIEGKVREQSGW 276

Query: 293 TNIFITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           T+IFI PGY+++ VD L++NFHLP+STLLMLVSA  G +     Y  A+   YRF+S+GD
Sbjct: 277 TDIFIYPGYKYKVVDALITNFHLPQSTLLMLVSALAGRDNIMNAYNVAVEKEYRFFSFGD 336

Query: 353 TSLL 356
              +
Sbjct: 337 AMFI 340


>gi|312792494|ref|YP_004025417.1| s-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Caldicellulosiruptor kristjanssonii 177R1B]
 gi|312179634|gb|ADQ39804.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Caldicellulosiruptor kristjanssonii 177R1B]
          Length = 346

 Score =  275 bits (704), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 153/359 (42%), Positives = 212/359 (59%), Gaps = 24/359 (6%)

Query: 5   EFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIVFNNT 64
           +F +DLP   IA +PV PRDS+RLMV+ P+ +    I   +  D+  +LN  D +V NN+
Sbjct: 8   DFHYDLPEELIAQKPVEPRDSSRLMVILPDGT----IEHRIFRDIVEYLNEGDCLVLNNS 63

Query: 65  KVITAQLNGVRFCHINRREKE---ISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQD 121
           KVI A+L       I +RE     I   L  R+  N+W V  RP K  +KG    F    
Sbjct: 64  KVIPARL-------IGQREDTGSFIEFLLVKRLDINTWEVMTRPGKKARKGRKFVF---- 112

Query: 122 GQSRLEATVID-KWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
           G   L+A V+    + G  ++ F   G+  E  +  +G IPLPPYI  K  +D  D   Y
Sbjct: 113 GNGELKAEVLHVNQDEGTRIVRFYYEGV-FEEVLERLGKIPLPPYI--KEELD--DLSRY 167

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT Y+K+ GS AAPTAGLHFT  LL R+   G+++ +VTLHVG GTF PVKVE+ ++H M
Sbjct: 168 QTVYSKVPGSAAAPTAGLHFTEELLDRISKKGVEILYVTLHVGLGTFKPVKVENVEEHKM 227

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           H E   I    A  +N  K  G R+++VGTTS R+LE+ + E G +    G+T+IFI PG
Sbjct: 228 HEEYYEISQDVADKINRAKEVGKRVIAVGTTSCRVLESCSDETGRVKAKKGWTDIFIYPG 287

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLFQK 359
           Y F+ +D L++NFHLP +TL+MLV AF G E     Y+ A+   YRF+S+GD  L+ ++
Sbjct: 288 YNFKVLDGLVTNFHLPDTTLMMLVCAFGGYERIMNAYKIAVDMRYRFFSFGDAMLILRR 346


>gi|322807370|emb|CBZ04944.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           botulinum H04402 065]
          Length = 341

 Score =  275 bits (703), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 152/364 (41%), Positives = 209/364 (57%), Gaps = 32/364 (8%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M VK+FDF LP   IA  P+  RD ARL+V+         I   +  D+  +L  ND +V
Sbjct: 1   MKVKDFDFYLPEELIAQHPMEKRDEARLLVLDKETG---EIEHKIFKDILDYLTPNDCLV 57

Query: 61  FNNTKVITAQLNG--------VRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKG 112
            NNT+V+ A+L G        + F  + R+EK++            W    +P K  + G
Sbjct: 58  LNNTRVLPARLIGSKEETGGKMEFLLLKRKEKDV------------WETLVKPGKRAQIG 105

Query: 113 DILHFFSQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPI 172
               F    G   L+A VI     G  ++ F   GI  E  +  +G +PLPPYI  K  +
Sbjct: 106 ARFIF----GNGELKAEVIGMGEEGSRIVKFYYEGI-FEEILDQLGQMPLPPYIKEK--L 158

Query: 173 DARDYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKV 232
           D ++   YQT Y+K +GS AAPTAGLHFT  LL ++   G+K+ F+TLHVG GTF PVKV
Sbjct: 159 DDKEM--YQTVYSKEEGSAAAPTAGLHFTEELLKKIEEKGVKLAFLTLHVGLGTFRPVKV 216

Query: 233 EDTDDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGF 292
           ED  +H+MHSE   +D  TA+ +N  K  GGR+++VGTTS R LET    +G +   SG+
Sbjct: 217 EDIQEHVMHSEYYKMDKKTAEIINDTKENGGRVIAVGTTSCRTLETIGDIEGKVGEQSGW 276

Query: 293 TNIFITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           T+IFI PGY+++ VD L++NFHLP+STLLMLVSA  G +     Y  A+   YRF+S+GD
Sbjct: 277 TDIFIYPGYKYKVVDALITNFHLPQSTLLMLVSALAGRDNIMNAYNVAVEKEYRFFSFGD 336

Query: 353 TSLL 356
              +
Sbjct: 337 AMFI 340


>gi|22536961|ref|NP_687812.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus agalactiae 2603V/R]
 gi|76787449|ref|YP_329544.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus agalactiae A909]
 gi|76798552|ref|ZP_00780784.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus agalactiae 18RS21]
 gi|77406569|ref|ZP_00783618.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus agalactiae H36B]
 gi|77411332|ref|ZP_00787680.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus agalactiae CJB111]
 gi|46577057|sp|Q8E0D7|QUEA_STRA5 RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|91207329|sp|Q3K1Q9|QUEA_STRA1 RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|22533815|gb|AAM99684.1|AE014228_5 S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus agalactiae 2603V/R]
 gi|76562506|gb|ABA45090.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus agalactiae A909]
 gi|76586086|gb|EAO62612.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus agalactiae 18RS21]
 gi|77162592|gb|EAO73555.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus agalactiae CJB111]
 gi|77174822|gb|EAO77642.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus agalactiae H36B]
          Length = 342

 Score =  275 bits (703), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 158/354 (44%), Positives = 215/354 (60%), Gaps = 19/354 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVV-HPNLSCPLVISDHLVSDLPAFLNSNDAI 59
           M   +FDF LP   IA  P+  RD+++L+V+ H N +      DH++ +L       DA+
Sbjct: 1   MNTNDFDFYLPEELIAQTPLEKRDASKLLVIDHKNKTMTDSHFDHILDEL----KPGDAL 56

Query: 60  VFNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFS 119
           V NNT+V+ A+L G +          +   L      + W V A+P+K ++ G  + F  
Sbjct: 57  VMNNTRVLPARLYGEK----QDTHGHVELLLLKNTEGDQWEVLAKPAKRLRVGTKVSF-- 110

Query: 120 QDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVD 179
             G  RL ATV  +   G  ++ FS  GI LE   SL G +PLPPYI  K  ++ RD   
Sbjct: 111 --GDGRLIATVTKELEHGGRIVEFSYDGIFLEVLESL-GEMPLPPYIHEK--LEDRDR-- 163

Query: 180 YQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHI 239
           YQT YAK  GS AAPTAGLHFT  LL ++ + G+K+ ++TLHVG GTF PV V++ D+H 
Sbjct: 164 YQTVYAKENGSAAAPTAGLHFTKELLEKIETKGVKLVYLTLHVGLGTFRPVSVDNLDEHE 223

Query: 240 MHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFIT 298
           MHSE   +    A  LN+VK  GGRIV+VGTTS+R LET  ++ +G +   SG+TNIFI 
Sbjct: 224 MHSEFYQLSKEAADTLNAVKESGGRIVAVGTTSIRTLETIGSKFNGELKADSGWTNIFIK 283

Query: 299 PGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           PGY+F+ VD   +NFHLPKSTL+MLVSAF G +   + Y HA+   YRF+S+GD
Sbjct: 284 PGYQFKVVDAFSTNFHLPKSTLVMLVSAFAGRDFVLEAYNHAVEERYRFFSFGD 337


>gi|331269240|ref|YP_004395732.1| S-adenosylmethionine--tRNA-ribosyltransferase- isomerase
           [Clostridium botulinum BKT015925]
 gi|329125790|gb|AEB75735.1| S-adenosylmethionine--tRNA-ribosyltransferase- isomerase
           [Clostridium botulinum BKT015925]
          Length = 341

 Score =  275 bits (702), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 152/356 (42%), Positives = 200/356 (56%), Gaps = 16/356 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M VK+FDF LP   IA  P+  RD +RLMVV             +  D+  + N  D +V
Sbjct: 1   MKVKDFDFYLPEELIAQHPMEKRDESRLMVVDRKSGHR---EHKIFKDILGYFNEGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NNT+V+ A+L G +         +I   L  R+  + W    +P K  K G    F   
Sbjct: 58  LNNTRVLPARLIGEK----ENTGGKIEFLLLKRIEGDKWETLVKPGKKAKIGARFVF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G   L+A V      G  ++ F   GI  E  +  +G +PLPPYI  K     R    Y
Sbjct: 111 -GSGELKAEVKGMGQDGSRIIEFEYEGI-FEEVLDRLGQMPLPPYITEKLDDKER----Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT Y+K +GS AAPTAGLHFT  LL  + + G+K+ FVTLHVG GTF PVK ED ++H M
Sbjct: 165 QTVYSKEKGSAAAPTAGLHFTKELLKEIENKGVKIAFVTLHVGLGTFRPVKAEDIEEHHM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   +   TA  +N  K  GG+I++VGTTS R LET   E+G +   SG+T+IF+ PG
Sbjct: 225 HSEYYTMSKETADIINETKENGGKIIAVGTTSCRTLETIGDENGKVRETSGWTDIFMYPG 284

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           Y+F+ VD L++NFHLP+STLLMLVSAF   E     Y+ A+   YRF+S+GD   L
Sbjct: 285 YKFKIVDRLITNFHLPQSTLLMLVSAFSSRENIMNAYKEAVDEKYRFFSFGDAMFL 340


>gi|300856544|ref|YP_003781528.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           ljungdahlii DSM 13528]
 gi|300436659|gb|ADK16426.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           ljungdahlii DSM 13528]
          Length = 344

 Score =  275 bits (702), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 149/356 (41%), Positives = 205/356 (57%), Gaps = 16/356 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           + V +FDF LP   IA  P+  RD ARLMV+         I   +  D+  +LN  D +V
Sbjct: 4   LKVTDFDFYLPEELIAQHPLMQRDEARLMVLDKKTG---DIEHKVFKDILDYLNPGDCLV 60

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+V+ A+L G +     + E      L  R + ++W    +P K  K G    F   
Sbjct: 61  LNDTRVLPARLIGSKEGSGGKME----ILLLKRNADDTWETLVKPGKRAKVGSRFDF--- 113

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G   L+A ++     G  ++ F   GI  E  +  +G +PLPPYI  K      D   Y
Sbjct: 114 -GDGELKAEIVSVKEDGNRIVKFEYEGI-FEEVLDRLGQMPLPPYIKEK----LEDKEMY 167

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT Y+K +GS AAPTAGLHFT  LL ++   GIK+ F+TLHVG GTF PVKVE+ ++H M
Sbjct: 168 QTVYSKEEGSAAAPTAGLHFTKELLKKIEDKGIKLAFLTLHVGLGTFRPVKVENIEEHNM 227

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   +   TA  +N  + +GG I++VGTTS R LET   E+G +   SG+T+IFI PG
Sbjct: 228 HSEYYCMTKETADMINETREKGGSIIAVGTTSCRTLETIGDENGKVREQSGWTDIFIYPG 287

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           Y+++ VD L++NFHLP+STL+MLVSA CG E+    Y  A+   YRF+S+GD   L
Sbjct: 288 YKYKVVDKLITNFHLPQSTLIMLVSALCGREKILNAYNCAVKEKYRFFSFGDAMFL 343


>gi|154686913|ref|YP_001422074.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           amyloliquefaciens FZB42]
 gi|166216699|sp|A7Z767|QUEA_BACA2 RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|154352764|gb|ABS74843.1| QueA [Bacillus amyloliquefaciens FZB42]
          Length = 342

 Score =  274 bits (701), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 152/357 (42%), Positives = 212/357 (59%), Gaps = 17/357 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  FDF+LP   IA  P+  RD++RLMV+         ++D    ++ +F N  D +V
Sbjct: 1   MKVDLFDFELPERLIAQVPLKERDASRLMVLDKQTGG---LTDSSFKEIVSFFNEGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NNT+V+ A+L G +         ++   L  +   ++W    +P+K +KKG +L F   
Sbjct: 58  LNNTRVLPARLFGTK----EDTGAKVELLLLKQEENDTWETLVKPAKRVKKGTVLTF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL A   ++ + G   + F   GI  E   SL G +PLPPYI  K  +D ++   Y
Sbjct: 111 -GDGRLTAVCTEELDHGGRKIEFRYDGIFYEVLESL-GEMPLPPYI--KEQLDDKER--Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT ++K  GS AAPTAGLHFT  +L  L   G+++ F+TLHVG GTF PV  +D ++H M
Sbjct: 165 QTVFSKEIGSAAAPTAGLHFTEEILDELKQKGVRIEFITLHVGLGTFRPVSADDVEEHNM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           H+E   +   TA +LN V+  GGRIVSVGTTS R LET   E DG     SG+T+IFI P
Sbjct: 225 HAEFYEMTEETAASLNEVRKAGGRIVSVGTTSTRTLETIAGEHDGEFTASSGWTSIFIYP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           GY F+A+D +++NFHLPKS+L+MLVSA  G E     Y+HA+   YRF+S+GD  L+
Sbjct: 285 GYEFKAIDGMITNFHLPKSSLIMLVSALAGREHVLSAYRHAVEEEYRFFSFGDAMLI 341


>gi|77408883|ref|ZP_00785609.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus agalactiae COH1]
 gi|77172522|gb|EAO75665.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus agalactiae COH1]
          Length = 342

 Score =  274 bits (701), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 158/354 (44%), Positives = 216/354 (61%), Gaps = 19/354 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVV-HPNLSCPLVISDHLVSDLPAFLNSNDAI 59
           M   +FDF LP   IA  P+  RD+++L+V+ H N +      DH++ +L       DA+
Sbjct: 1   MNTNDFDFYLPEELIAQTPLEKRDASKLLVIDHKNKTMTDSHFDHILDEL----KPGDAL 56

Query: 60  VFNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFS 119
           V NNT+V+ A+L G +          +   L      + W V A+P+K ++ G+ + F  
Sbjct: 57  VMNNTRVLPARLYGEK----PDTHGHVELLLLKNTEGDQWEVLAKPAKRLRVGNRVSF-- 110

Query: 120 QDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVD 179
             G  RL ATV  +   G  ++ FS  GI LE   SL G +PLPPYI  K  ++ RD   
Sbjct: 111 --GDGRLIATVTKELEHGGRIVEFSYDGIFLEVLESL-GEMPLPPYIHEK--LEDRDR-- 163

Query: 180 YQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHI 239
           YQT YAK  GS AAPTAGLHFT  LL ++ + G+K+ ++TLHVG GTF PV V++ D+H 
Sbjct: 164 YQTVYAKENGSAAAPTAGLHFTKELLEKIETKGVKLVYLTLHVGLGTFRPVSVDNLDEHE 223

Query: 240 MHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFIT 298
           MHSE   +    A  LN+VK  GGRIV+VGTTS+R LET  ++ +G +   SG+TNIFI 
Sbjct: 224 MHSEFYQLSKEAADTLNAVKESGGRIVAVGTTSIRTLETIGSKFNGELKADSGWTNIFIK 283

Query: 299 PGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           PGY+F+ VD   +NFHLPKSTL+MLVSAF G +   + Y HA+   YRF+S+GD
Sbjct: 284 PGYQFKVVDAFSTNFHLPKSTLVMLVSAFAGHDFVLEAYNHAVEERYRFFSFGD 337


>gi|225870087|ref|YP_002746034.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus equi subsp. equi 4047]
 gi|225699491|emb|CAW93030.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus equi subsp. equi 4047]
          Length = 342

 Score =  274 bits (701), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 154/355 (43%), Positives = 211/355 (59%), Gaps = 19/355 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVV-HPNLSCPLVISDHLVSDLPAFLNSNDAI 59
           M   +FDF+LP   IA  P+  RD ++L+++ H   +      DH++  L       DA+
Sbjct: 1   MNTNDFDFELPEELIAQTPLEQRDRSKLLIIDHQEHTMTDSHFDHIIDQL----EPGDAL 56

Query: 60  VFNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFS 119
           V NNT+V+ A+L G +          +   L   +  + W V A+P+K +K G  + F  
Sbjct: 57  VMNNTRVLPARLYGEKM----ETHGHVELLLLKNIQGDQWEVLAKPAKRLKAGAQISF-- 110

Query: 120 QDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVD 179
             G  RL+A VI +   G  ++ FS  GI LE  +  +G +PLPPYI  K     R    
Sbjct: 111 --GDGRLKARVIQELEHGGRIVEFSYDGIFLEI-LETLGEMPLPPYIHEKLADAER---- 163

Query: 180 YQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHI 239
           YQT YAK  GS AAPTAGLHFT  LL ++ + G+ + ++TLHVG GTF PV V++ D+H 
Sbjct: 164 YQTVYAKENGSAAAPTAGLHFTQELLQKIEAKGVHLVYLTLHVGLGTFRPVSVDNIDEHD 223

Query: 240 MHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFIT 298
           MHSE   +    AQ L  VK+ GGRI++VGTTS+R LET  ++  G I   SG+TNIFI 
Sbjct: 224 MHSEFYLLSEEAAQTLRKVKAAGGRIIAVGTTSIRTLETIGSKFQGQILADSGWTNIFIK 283

Query: 299 PGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDT 353
           PGY+F+ VD   +NFHLPKSTL+MLVSAF G +   + Y+HAI   YRF+S+GD 
Sbjct: 284 PGYQFKVVDAFSTNFHLPKSTLVMLVSAFAGRDFVLEAYKHAIDEHYRFFSFGDA 338


>gi|93278505|pdb|1YY3|A Chain A, Structure Of S-Adenosylmethionine:trna Ribosyltransferase-
           Isomerase (Quea)
 gi|93278506|pdb|1YY3|B Chain B, Structure Of S-Adenosylmethionine:trna Ribosyltransferase-
           Isomerase (Quea)
          Length = 346

 Score =  274 bits (701), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 150/352 (42%), Positives = 212/352 (60%), Gaps = 17/352 (4%)

Query: 6   FDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIVFNNTK 65
           FDF+LP   IA  P+  RD++RLMV+  +      ++D     + +F N  D +V NNT+
Sbjct: 10  FDFELPERLIAQVPLEQRDASRLMVLDKHTG---ELTDSSFKHIISFFNEGDCLVLNNTR 66

Query: 66  VITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQDGQSR 125
           V+ A+L G +         ++   L  + + + W   A+P+K +KKG ++ F    G  R
Sbjct: 67  VLPARLFGTK----EDTGAKVELLLLKQETGDKWETLAKPAKRVKKGTVVTF----GDGR 118

Query: 126 LEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDYQTTYA 185
           L+A   ++   G   + F   GI  E   SL G +PLPPYI  K  +D ++   YQT Y+
Sbjct: 119 LKAICTEELEHGGRKMEFQYDGIFYEVLESL-GEMPLPPYI--KEQLDDKER--YQTVYS 173

Query: 186 KIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIMHSEIG 245
           K  GS AAPTAGLHFT  +L +L   G+++ F+TLHVG GTF PV  ++ ++H MH+E  
Sbjct: 174 KEIGSAAAPTAGLHFTEEILQQLKDKGVQIEFITLHVGLGTFRPVSADEVEEHNMHAEFY 233

Query: 246 FIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITPGYRFR 304
            +   TA ALN V+  GGRI+SVGTTS R LET   E DG     SG+T+IFI PGY F+
Sbjct: 234 QMSEETAAALNKVRENGGRIISVGTTSTRTLETIAGEHDGQFKASSGWTSIFIYPGYEFK 293

Query: 305 AVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           A+D +++NFHLPKS+L+MLVSA  G E   + Y HA+   YRF+S+GD  L+
Sbjct: 294 AIDGMITNFHLPKSSLIMLVSALAGRENILRAYNHAVEEEYRFFSFGDAMLI 345


>gi|25010872|ref|NP_735267.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus agalactiae NEM316]
 gi|77413595|ref|ZP_00789782.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus agalactiae 515]
 gi|46577062|sp|Q8E611|QUEA_STRA3 RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|23095251|emb|CAD46461.1| Unknown [Streptococcus agalactiae NEM316]
 gi|77160361|gb|EAO71485.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus agalactiae 515]
          Length = 342

 Score =  274 bits (700), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 159/354 (44%), Positives = 215/354 (60%), Gaps = 19/354 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVV-HPNLSCPLVISDHLVSDLPAFLNSNDAI 59
           M   +FDF LP   IA  P+  RD+++L+V+ H N +      DH++ +L       DA+
Sbjct: 1   MNTNDFDFYLPEELIAQTPLEKRDASKLLVIDHKNKTMTDSHFDHILDEL----KPGDAL 56

Query: 60  VFNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFS 119
           V NNT+V+ A+L G +          I   L      + W V A+P+K ++ G  + F  
Sbjct: 57  VMNNTRVLPARLYGEK----PDTHGHIELLLLKNTEGDQWEVLAKPAKRLRVGTKVSF-- 110

Query: 120 QDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVD 179
             G  RL ATV  +   G  ++ FS  GI LE   SL G +PLPPYI  K  ++ RD   
Sbjct: 111 --GDGRLIATVTKELEHGGRIVEFSYDGIFLEVLESL-GEMPLPPYIHEK--LEDRDR-- 163

Query: 180 YQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHI 239
           YQT YAK  GS AAPTAGLHFT  LL ++ + G+K+ ++TLHVG GTF PV V++ D+H 
Sbjct: 164 YQTVYAKENGSAAAPTAGLHFTKELLEKIETKGVKLVYLTLHVGLGTFRPVSVDNLDEHE 223

Query: 240 MHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFIT 298
           MHSE   +    A  LN+VK  GGRIV+VGTTS+R LET  ++ +G +   SG+TNIFI 
Sbjct: 224 MHSEFYQLSKEAADTLNAVKESGGRIVAVGTTSIRTLETIGSKFNGELKADSGWTNIFIK 283

Query: 299 PGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           PGY+F+ VD   +NFHLPKSTL+MLVSAF G +   + Y HA+   YRF+S+GD
Sbjct: 284 PGYQFKVVDAFSTNFHLPKSTLVMLVSAFAGRDFVLEAYNHAVEERYRFFSFGD 337


>gi|168208647|ref|ZP_02634272.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           perfringens B str. ATCC 3626]
 gi|170713009|gb|EDT25191.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           perfringens B str. ATCC 3626]
          Length = 341

 Score =  274 bits (700), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 146/356 (41%), Positives = 207/356 (58%), Gaps = 16/356 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V +F F+LP   IA  P+  RDS+RLMV+         I      D+  +LN  D +V
Sbjct: 1   MKVSDFYFELPEELIAQYPLEKRDSSRLMVLDKKTGE---IEHRKFHDILEYLNEGDTLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NNT+V+ A+L G +         +I   L  R+  + W   A+P +  K G +  F   
Sbjct: 58  LNNTRVLPARLIGEK----EETGGKIEFLLLKRIEGDKWECLAKPGRKAKVGTVFTF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G+ +L+A V +    G  ++ F   GI  E+ +  +G +PLPPYI  K      D   Y
Sbjct: 111 -GEGKLKAIVREIGEEGNRIIEFKYDGI-FEQVLDELGQMPLPPYIHEK----LEDKERY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT Y+K +GS AAPTAGLHFT  LL  +   G+ + ++TLHVG GTF PVKV+D ++H+M
Sbjct: 165 QTVYSKEKGSAAAPTAGLHFTEELLKEIKDKGVNIAYLTLHVGLGTFRPVKVDDVNNHVM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   +D   A+ +N  K  G R+++VGTTS R LET   E+G +   SG+T+IFI PG
Sbjct: 225 HSEYYHLDKENAELINKTKEAGNRVIAVGTTSSRTLETIGDENGRVREQSGWTDIFIYPG 284

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           Y+F+ VD L++NFHLP+STL+MLVSA  G +     Y  A+   YRF+S+GD+  +
Sbjct: 285 YKFKIVDNLITNFHLPESTLIMLVSALAGQDNIMNAYNTAVKEKYRFFSFGDSMFI 340


>gi|225025895|ref|ZP_03715087.1| hypothetical protein EUBHAL_00123 [Eubacterium hallii DSM 3353]
 gi|224956792|gb|EEG38001.1| hypothetical protein EUBHAL_00123 [Eubacterium hallii DSM 3353]
          Length = 342

 Score =  274 bits (700), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 151/356 (42%), Positives = 205/356 (57%), Gaps = 16/356 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +F+FDLP   IA  P+  R S+RLMV++        I+  +  D+  +L+  D +V
Sbjct: 2   MKTSDFNFDLPQELIAQDPLEDRSSSRLMVLNKESG---EIAHRIFHDITEYLHPGDCLV 58

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+TKVI A+L G +          I   L  R   + W    +P K  + G  + F   
Sbjct: 59  INDTKVIPARLIGTK----EDTGAHIEILLLKRKENDVWETLVKPGKKCRPGARVVF--- 111

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G   L+A ++D    G  L+ F   GI  E  +  +G +PLPPYI  K     +D   Y
Sbjct: 112 -GNGELKAEIVDVLEDGNRLVHFEYEGI-FEEVLDRLGQMPLPPYITHK----LQDKNRY 165

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK +GS AAPTAGLHFT  LL ++  +G+ +  VTLHVG GTF PVKVE+  +H M
Sbjct: 166 QTVYAKYEGSAAAPTAGLHFTKELLKQIEDMGVNIARVTLHVGLGTFRPVKVENVLEHHM 225

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   +    A+ +N  K  GGRI++VGTTS R LE+   E+GII+P  G T IFI PG
Sbjct: 226 HSEYYNVTETAAKMINDTKKNGGRIIAVGTTSTRTLESVADENGIIHPGCGNTEIFIYPG 285

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           Y+F+A+D L++NFHLP+STLLMLVSA  G E     Y+ A+   YRF+S+GD   +
Sbjct: 286 YKFKAIDCLITNFHLPESTLLMLVSALAGKEHIMAAYKEAVKERYRFFSFGDAMFI 341


>gi|311069257|ref|YP_003974180.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           atrophaeus 1942]
 gi|310869774|gb|ADP33249.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           atrophaeus 1942]
          Length = 342

 Score =  274 bits (700), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 153/357 (42%), Positives = 214/357 (59%), Gaps = 17/357 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V+ FDF+LP   IA  P+  RD++RLMV+  +      +SD    ++ +F    D +V
Sbjct: 1   MKVELFDFELPERLIAQVPLEQRDASRLMVLDKHTGG---LSDSSFKEIVSFFKEGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NNT+V+ A+L GV+         ++   L  + + + W    +P+K +KKG +L F   
Sbjct: 58  LNNTRVLPARLFGVK----EDTGAKVELLLLKQETGDRWETLVKPAKRVKKGTVLTF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G   L+A   ++   G   + F   GI  E   SL G +PLPPYI  K  +D R+   Y
Sbjct: 111 -GDGLLQAVCTEELEHGGRKVEFRYDGIFYEVLESL-GEMPLPPYI--KEQLDDRER--Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT ++K  GS AAPTAGLHFT  +L  L   G+++ F+TLHVG GTF PV  ++ ++H M
Sbjct: 165 QTVFSKEIGSAAAPTAGLHFTEEILGELKEKGVRIEFITLHVGLGTFRPVSADEVEEHNM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           H+E   + A TA ALN V+  GGRIVSVGTTS R LET   E +G     SG+T+IFI P
Sbjct: 225 HAEFYEMSAETAAALNHVRETGGRIVSVGTTSTRTLETIAGENNGSFKASSGWTSIFIYP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           GY F+A+D +++NFHLPKS+L+MLVSA  G E   + Y HA+   YRF+S+GD  L+
Sbjct: 285 GYEFKAIDGMITNFHLPKSSLIMLVSALAGREHVLRAYNHAVEKEYRFFSFGDAMLI 341


>gi|110802898|ref|YP_699223.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           perfringens SM101]
 gi|123047252|sp|Q0SRN4|QUEA_CLOPS RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|110683399|gb|ABG86769.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           perfringens SM101]
          Length = 341

 Score =  274 bits (700), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 146/356 (41%), Positives = 208/356 (58%), Gaps = 16/356 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V +F F+LP   IA  P+  RDS+RLMV+         I      D+  +LN  D +V
Sbjct: 1   MKVSDFYFELPEELIAQYPLEKRDSSRLMVLDKKTGE---IEHRKFHDILEYLNEGDTLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NNT+V+ A+L G +         +I   L  R+  + W   A+P +  K G +  F   
Sbjct: 58  LNNTRVLPARLIGEK----EETGGKIEFLLLKRIEGDKWECLAKPGRKAKVGTVFTF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G+ +L+A V +    G  ++ F   GI  E+ +  +G +PLPPYI  K      D   Y
Sbjct: 111 -GEGKLKAIVREIGEEGNRIIEFKYDGI-FEQVLDELGQMPLPPYIHEK----LEDKERY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT Y+K +GS AAPTAGLHFT +LL  +   G+ + ++TLHVG GTF PVKV+D ++H+M
Sbjct: 165 QTVYSKEKGSAAAPTAGLHFTEDLLKEIKDKGVNIAYLTLHVGLGTFRPVKVDDVNNHVM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   +D   A+ +N  K  G R+++VGTTS R LET   E+G +   SG+T+IFI PG
Sbjct: 225 HSEYYHLDKENAELINKTKEAGKRVIAVGTTSSRTLETIGDENGRVREQSGWTDIFIYPG 284

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           Y+F+ VD L++NFHLP+STL+MLVSA  G +     Y  A+   YRF+S+GD+  +
Sbjct: 285 YKFKIVDNLITNFHLPESTLIMLVSALAGQDNIMNAYNTAVKEKYRFFSFGDSMFI 340


>gi|291546236|emb|CBL19344.1| S-adenosylmethionine--tRNA ribosyltransferase-isomerase
           [Ruminococcus sp. SR1/5]
          Length = 341

 Score =  273 bits (699), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 153/356 (42%), Positives = 206/356 (57%), Gaps = 16/356 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +F +DLP   IA  P+  R S+RLM  H +L    +   H  +D+  +L+  D +V
Sbjct: 1   MKTSDFYYDLPQELIAQDPLEDRSSSRLM--HLSLKDGSIEHRHF-TDILDYLHKGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+TKVI A+L G    H       I   L  R   + W    +P K  + G  + F   
Sbjct: 58  INDTKVIPARLYG----HKEETGALIEILLLKRRENDIWECLVKPGKKARPGAKITF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G   L+  +ID  + G  L+ F   GI  E  +  +G +PLPPYI  K     +D   Y
Sbjct: 111 -GDGILKGEIIDIVDEGNRLIQFHYEGI-FEEILDQLGEMPLPPYITHK----LKDKNRY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK +GS AAPTAGLHFT  LL ++   G+ +  VTLHVG GTF PVKV+D + H M
Sbjct: 165 QTVYAKNEGSAAAPTAGLHFTPELLEKVKEKGVNIAHVTLHVGLGTFRPVKVDDVEKHHM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   ++   A+ +N  K  GGR++SVGTTS R LE+A  EDGI+   SG+T IFI PG
Sbjct: 225 HSEFYIVEEDQAKLINDTKKNGGRVISVGTTSCRTLESAAGEDGIVKAGSGWTEIFIYPG 284

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           Y+F+A+D L++NFHLP+STLLMLVSA  G E     Y+ A+   YRF+S+GD  ++
Sbjct: 285 YKFKAIDGLITNFHLPESTLLMLVSALAGKEHIMAAYEEAVKERYRFFSFGDAMMI 340


>gi|225181933|ref|ZP_03735367.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Dethiobacter alkaliphilus AHT 1]
 gi|225167373|gb|EEG76190.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Dethiobacter alkaliphilus AHT 1]
          Length = 342

 Score =  273 bits (699), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 151/356 (42%), Positives = 207/356 (58%), Gaps = 16/356 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + EFD++LP   IA  P+  R+++RL+++H        +     SD+ + L + D +V
Sbjct: 1   MHLSEFDYELPEELIAQVPLTDREASRLLILHRKSGA---VEHGNFSDILSHLQAGDTLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+TKV+ A+L G +       E      L  R     W    +P + ++ G  + F   
Sbjct: 58  LNDTKVLPARLTGRKKGGGAMAE----VLLLTRKDKACWEALVKPGRRLRPGAEVEF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G   L A + ++   G  L+ F   GI  E  +  +G +PLPPYI  K      D   Y
Sbjct: 111 -GNGELTAVIKEELADGTRLVEFRYDGI-FEEVLDRLGEMPLPPYITEKLA----DRQRY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK +GS AAPTAGLHFT  LL+     GI V ++TLHVG GTF PVK ED  +H M
Sbjct: 165 QTVYAKNEGSAAAPTAGLHFTPRLLAEAQDRGINVVYLTLHVGLGTFRPVKTEDIREHHM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   I   +AQ LNS +  GGRIV+VGTTS R+LET   +DG IN  SG+T+IFI PG
Sbjct: 225 HSEYYNISPESAQILNSCRRAGGRIVAVGTTSCRVLETVAQDDGTINAGSGWTDIFIYPG 284

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           YRF+ V+ L++NFHLPKSTL+M++SAF G +     Y+ A+   YRF+S+GD  L+
Sbjct: 285 YRFKTVNALLTNFHLPKSTLIMMISAFAGRDNVLNAYREAVQERYRFFSFGDAMLI 340


>gi|157826819|ref|YP_001495883.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Rickettsia
           bellii OSU 85-389]
 gi|166216747|sp|A8GVG9|QUEA_RICB8 RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|157802123|gb|ABV78846.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Rickettsia
           bellii OSU 85-389]
          Length = 353

 Score =  273 bits (699), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 152/375 (40%), Positives = 224/375 (59%), Gaps = 39/375 (10%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FDFDLP   IA  P+  RD + L++     S    +      ++  +L   D +V
Sbjct: 1   MKLSDFDFDLPLELIAQNPISKRDESNLLIA----STQQYVKTKFY-NIIDYLKEGDLLV 55

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNS---------------WSVYARP 105
           FNN+KVI A+L+          +K I+  L+ R+  N                WS +A+P
Sbjct: 56  FNNSKVIKAKLS---------LDKNITINLNQRLKDNRRATNDDAGRLKSIDYWSAFAKP 106

Query: 106 SKVIKKGDILHFFSQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPY 165
           ++ +K GD  +F +       +  + +K   GEI + F ++ I +   +   G +PLP Y
Sbjct: 107 ARKLKVGDEFYFDNH------KIIITEKLEMGEIKIKFELANISVFEFLDKYGEMPLPLY 160

Query: 166 IARKRPIDAR-DYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGA 224
           I  KRP   + D   YQT Y+ IQGSVAAPTAGLHFT++++++L + G++V FVTLHVGA
Sbjct: 161 I--KRPERQKSDDERYQTVYSNIQGSVAAPTAGLHFTNDIINKLKAKGVQVAFVTLHVGA 218

Query: 225 GTFMPVKVEDTDDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDG 284
           GTFMPVK E+ ++H MH+E   I   TA  +N  K    RI++VGTTSLR LE++   +G
Sbjct: 219 GTFMPVKTENINEHKMHTEYCSITPETAAIINKAKKEKRRIIAVGTTSLRTLESSGI-NG 277

Query: 285 IINPWSGFTNIFITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHA 344
            +N     T+IFITPG++F+ VD+L++NFH PKSTL MLV AF G +E  ++Y++AI   
Sbjct: 278 NVNSGDFETDIFITPGFKFQIVDMLLTNFHFPKSTLFMLVCAFAGFKEMHELYKYAIEEQ 337

Query: 345 YRFYSYGDTSLLFQK 359
            RF+SYGD +LL++K
Sbjct: 338 MRFFSYGDATLLYKK 352


>gi|312877417|ref|ZP_07737381.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Caldicellulosiruptor lactoaceticus 6A]
 gi|311795806|gb|EFR12171.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Caldicellulosiruptor lactoaceticus 6A]
          Length = 346

 Score =  273 bits (699), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 152/359 (42%), Positives = 212/359 (59%), Gaps = 24/359 (6%)

Query: 5   EFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIVFNNT 64
           +F +DLP   IA +PV PRDS+RLMV+ P+ +    I   +  ++  +LN  D +V NN+
Sbjct: 8   DFHYDLPEELIAQKPVEPRDSSRLMVILPDGT----IEHRIFREIVEYLNEGDCLVLNNS 63

Query: 65  KVITAQLNGVRFCHINRREKE---ISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQD 121
           KVI A+L       I +RE     I   L  R+  N+W V  RP K  +KG    F    
Sbjct: 64  KVIPARL-------IGQREDTGSFIEFLLVKRLDINTWEVMTRPGKKARKGRKFVF---- 112

Query: 122 GQSRLEATVID-KWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
           G   L+A V+    + G  ++ F   G+  E  +  +G IPLPPYI  K  +D  D   Y
Sbjct: 113 GNGELKAEVLHVNQDEGTRIVRFYYEGV-FEEVLERLGKIPLPPYI--KEELD--DLSRY 167

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT Y+K+ GS AAPTAGLHFT  LL R+   G+++ +VTLHVG GTF PVKVE+ ++H M
Sbjct: 168 QTVYSKVPGSAAAPTAGLHFTEELLDRISKKGVEILYVTLHVGLGTFKPVKVENVEEHKM 227

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           H E   I    A  +N  K  G R+++VGTTS R+LE+ + E G +    G+T+IFI PG
Sbjct: 228 HEEYYEISQDVADKINRAKEVGKRVIAVGTTSCRVLESCSDETGRVKAKKGWTDIFIYPG 287

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLFQK 359
           Y F+ +D L++NFHLP +TL+MLV AF G E     Y+ A+   YRF+S+GD  L+ ++
Sbjct: 288 YNFKVLDGLVTNFHLPDTTLMMLVCAFGGYERIMNAYKIAVDMRYRFFSFGDAMLILRR 346


>gi|312128550|ref|YP_003993424.1| s-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Caldicellulosiruptor hydrothermalis 108]
 gi|311778569|gb|ADQ08055.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Caldicellulosiruptor hydrothermalis 108]
          Length = 346

 Score =  273 bits (699), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 151/359 (42%), Positives = 211/359 (58%), Gaps = 24/359 (6%)

Query: 5   EFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIVFNNT 64
           +F +DLP   IA +PV PRDS+RLMV+ P+      +   +  D+  +LN  D +V NN+
Sbjct: 8   DFHYDLPDELIAQKPVEPRDSSRLMVILPDGR----LEHRIFRDIVEYLNEGDCLVLNNS 63

Query: 65  KVITAQLNGVRFCHINRREKE---ISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQD 121
           KVI A+L       I +RE     I   L  R+  N+W V  RP K  +KG    F    
Sbjct: 64  KVIPARL-------IGQREDTGSFIEFLLVKRLDINTWEVMTRPGKKARKGRKFVF---- 112

Query: 122 GQSRLEATVID-KWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
           G   L+A V+      G  ++ F   G+  E  +  +G IPLPPYI  K  +D  D   Y
Sbjct: 113 GNGELKAEVLHVNQEEGTRIVRFYYEGV-FEEVLERLGKIPLPPYI--KEELD--DLSRY 167

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT Y+K+ GS AAPTAGLHFT  LL ++   G+++ +VTLHVG GTF PVKVE+ ++H M
Sbjct: 168 QTVYSKVPGSAAAPTAGLHFTEELLEKISKKGVEILYVTLHVGLGTFKPVKVENVEEHKM 227

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           H E   I    A+ +N  K  G R+++VGTTS R+LE+   E+G +    G+T+IFI PG
Sbjct: 228 HEEYYEISEDVAERINRAKELGKRVIAVGTTSCRVLESCCDENGKVRAKKGWTDIFIYPG 287

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLFQK 359
           Y F+ +D L++NFHLP +TL+MLV AF G E     Y+ A+   YRF+S+GD  L+ ++
Sbjct: 288 YEFKVLDGLVTNFHLPDTTLMMLVCAFGGYERIMNAYKIAVDMRYRFFSFGDAMLILRR 346


>gi|308174473|ref|YP_003921178.1| S-adenosylmethionine tRNA ribosyltransferase-isomerase [Bacillus
           amyloliquefaciens DSM 7]
 gi|307607337|emb|CBI43708.1| S-adenosylmethionine tRNA ribosyltransferase-isomerase [Bacillus
           amyloliquefaciens DSM 7]
 gi|328554393|gb|AEB24885.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           amyloliquefaciens TA208]
 gi|328912798|gb|AEB64394.1| S-adenosylmethionine tRNA ribosyltransferase-isomerase [Bacillus
           amyloliquefaciens LL3]
          Length = 342

 Score =  273 bits (699), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 151/357 (42%), Positives = 212/357 (59%), Gaps = 17/357 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  FDF+LP   IA  P+  RD++RLMV+         ++D    ++ +F    D +V
Sbjct: 1   MKVDLFDFELPERLIAQVPLKERDASRLMVLDKQTGG---LTDSSFKEIVSFFKEGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NNT+V+ A+L G +         ++   L  +   ++W    +P+K ++KG IL F   
Sbjct: 58  LNNTRVLPARLFGTK----EDTGAKVELLLLKQEENDTWETLVKPAKRVRKGTILTF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL A   ++ + G   + F   GI  E   SL G +PLPPYI  K  +D ++   Y
Sbjct: 111 -GDGRLTAVCTEELDHGGRKIKFRYDGIFYEVLESL-GEMPLPPYI--KEQLDDKER--Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT ++K  GS AAPTAGLHFT  +L  L   G+++ F+TLHVG GTF PV  +D ++H M
Sbjct: 165 QTVFSKEIGSAAAPTAGLHFTEEILDELKQKGVRIEFITLHVGLGTFRPVSADDVEEHNM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           H+E   +   TA +LN V+  GGRIVSVGTTS R LET   E DG+    SG+T+IFI P
Sbjct: 225 HAEFYEMTEETAASLNEVRKAGGRIVSVGTTSTRTLETIAGEHDGVFTASSGWTSIFIYP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           GY F+A+D +++NFHLPKS+L+MLVSA  G E     Y+HA+   YRF+S+GD  L+
Sbjct: 285 GYEFKAIDGMITNFHLPKSSLIMLVSALAGREHVLSAYRHAVEEEYRFFSFGDAMLI 341


>gi|18310928|ref|NP_562862.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           perfringens str. 13]
 gi|110799784|ref|YP_696626.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           perfringens ATCC 13124]
 gi|168204870|ref|ZP_02630875.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           perfringens E str. JGS1987]
 gi|168214133|ref|ZP_02639758.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           perfringens CPE str. F4969]
 gi|168215572|ref|ZP_02641197.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           perfringens NCTC 8239]
 gi|182624446|ref|ZP_02952230.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           perfringens D str. JGS1721]
 gi|21263867|sp|Q8XJ15|QUEA_CLOPE RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|123344605|sp|Q0TP14|QUEA_CLOP1 RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|18145610|dbj|BAB81652.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           perfringens str. 13]
 gi|110674431|gb|ABG83418.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           perfringens ATCC 13124]
 gi|170663657|gb|EDT16340.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           perfringens E str. JGS1987]
 gi|170714349|gb|EDT26531.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           perfringens CPE str. F4969]
 gi|177910449|gb|EDT72826.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           perfringens D str. JGS1721]
 gi|182382391|gb|EDT79870.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           perfringens NCTC 8239]
          Length = 341

 Score =  273 bits (699), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 146/356 (41%), Positives = 207/356 (58%), Gaps = 16/356 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V +F F+LP   IA  P+  RDS+RLMV+         I      D+  +LN  D +V
Sbjct: 1   MKVSDFYFELPEELIAQYPLEKRDSSRLMVLDKKTGE---IEHRKFHDILEYLNEGDTLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NNT+V+ A+L G +         +I   L  R+  + W   A+P +  K G +  F   
Sbjct: 58  LNNTRVLPARLIGEK----EETGGKIEFLLLKRIEGDKWECLAKPGRKAKVGTVFTF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G+ +L+A V +    G  ++ F   GI  E+ +  +G +PLPPYI  K      D   Y
Sbjct: 111 -GEGKLKAIVREIGEEGNRIIEFKYDGI-FEQVLDELGQMPLPPYIHEK----LEDKERY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT Y+K +GS AAPTAGLHFT  LL  +   G+ + ++TLHVG GTF PVKV+D ++H+M
Sbjct: 165 QTVYSKEKGSAAAPTAGLHFTEELLKEIKDKGVNIAYLTLHVGLGTFRPVKVDDVNNHVM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   +D   A+ +N  K  G R+++VGTTS R LET   E+G +   SG+T+IFI PG
Sbjct: 225 HSEYYHLDKENAELINKTKEAGKRVIAVGTTSSRTLETIGDENGRVREQSGWTDIFIYPG 284

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           Y+F+ VD L++NFHLP+STL+MLVSA  G +     Y  A+   YRF+S+GD+  +
Sbjct: 285 YKFKIVDNLITNFHLPESTLIMLVSALAGQDNIMNAYNTAVKEKYRFFSFGDSMFI 340


>gi|319744823|gb|EFV97162.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus agalactiae ATCC 13813]
          Length = 342

 Score =  273 bits (698), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 157/354 (44%), Positives = 215/354 (60%), Gaps = 19/354 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVV-HPNLSCPLVISDHLVSDLPAFLNSNDAI 59
           M   +FDF LP   IA  P+  RD+++L+V+ H N +      DH++ +L       DA+
Sbjct: 1   MNTNDFDFYLPEELIAQTPLEKRDASKLLVIDHKNKTMADSHFDHILDEL----KPGDAL 56

Query: 60  VFNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFS 119
           V NNT+V+ A+L G +          +   L      + W V A+P+K ++ G  + F  
Sbjct: 57  VMNNTRVLPARLYGEK----PDTHGHVELLLLKNTEGDQWEVLAKPAKRLRVGTKVSF-- 110

Query: 120 QDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVD 179
             G  RL ATV  +   G  ++ FS  GI LE   SL G +PLPPYI  K  ++ RD   
Sbjct: 111 --GDGRLIATVTKELEHGGRIVEFSYDGIFLEVLESL-GEMPLPPYIHEK--LEDRDR-- 163

Query: 180 YQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHI 239
           YQT YAK  GS AAPTAGLHFT  LL ++ + G+K+ ++TLHVG GTF PV V++ D+H 
Sbjct: 164 YQTVYAKENGSAAAPTAGLHFTKELLEKIETKGVKLVYLTLHVGLGTFRPVSVDNLDEHE 223

Query: 240 MHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFIT 298
           MHSE   +    A  LN+VK  GGRI++VGTTS+R LET  ++ +G +   SG+TNIFI 
Sbjct: 224 MHSEFYQLSKEAADTLNAVKESGGRIIAVGTTSIRTLETIGSKFNGELKADSGWTNIFIK 283

Query: 299 PGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           PGY+F+ VD   +NFHLPKSTL+MLVSAF G +   + Y HA+   YRF+S+GD
Sbjct: 284 PGYQFKVVDAFSTNFHLPKSTLVMLVSAFAGRDFVLEAYNHAVEERYRFFSFGD 337


>gi|331083879|ref|ZP_08332988.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Lachnospiraceae bacterium 6_1_63FAA]
 gi|330403304|gb|EGG82864.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Lachnospiraceae bacterium 6_1_63FAA]
          Length = 341

 Score =  273 bits (698), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 152/358 (42%), Positives = 209/358 (58%), Gaps = 20/358 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISD--HLVSDLPAFLNSNDA 58
           M   +F +DLP   IA  P+  R S+RLM +    +  +  +D  H++     +LN  D 
Sbjct: 1   MRTADFYYDLPEELIAQDPLLDRSSSRLMHLDKQ-TGEICHTDFKHIID----YLNPEDC 55

Query: 59  IVFNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFF 118
           +V N+T+VI A+L G +       +  I   L  R   N W    +P K  K G  + F 
Sbjct: 56  LVINDTRVIPARLYGSKVG----TDAGIEILLLKRRENNIWETLVKPGKKAKPGTKISF- 110

Query: 119 SQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYV 178
              G   L   V+D    G  L+ F   GI  E  +  +G +PLPPYI  K     +D  
Sbjct: 111 ---GDGLLIGEVLDIVEEGNRLIQFQYEGI-FEEILDKLGEMPLPPYITHK----LQDKE 162

Query: 179 DYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDH 238
            YQT YAK +GS AAPTAGLHFT  LL  +   G+K+  VTLHVG GTF PVKV+D + H
Sbjct: 163 RYQTVYAKNEGSAAAPTAGLHFTKELLKEIEEKGVKIAHVTLHVGLGTFRPVKVDDVESH 222

Query: 239 IMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFIT 298
            MHSE   ++   A+ +N  K++GGR++SVGTTS R LE+AT E+GI+   SG+T+IFI 
Sbjct: 223 HMHSEFYVVEEEQAKIINETKAKGGRVISVGTTSCRTLESATDENGILQAKSGWTDIFIY 282

Query: 299 PGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           PGY+F+ +D L++NFHLP+STLLMLVSA  G E+    Y+ A+   YRF+S+GD  ++
Sbjct: 283 PGYQFKMIDALITNFHLPESTLLMLVSALAGKEKIMNAYEEAVKERYRFFSFGDAMII 340


>gi|260587878|ref|ZP_05853791.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Blautia
           hansenii DSM 20583]
 gi|260542143|gb|EEX22712.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Blautia
           hansenii DSM 20583]
          Length = 355

 Score =  273 bits (698), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 152/358 (42%), Positives = 209/358 (58%), Gaps = 20/358 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISD--HLVSDLPAFLNSNDA 58
           M   +F +DLP   IA  P+  R S+RLM +    +  +  +D  H++     +LN  D 
Sbjct: 15  MRTADFYYDLPEELIAQDPLLDRSSSRLMHLDKQ-TGEICHTDFKHIID----YLNPEDC 69

Query: 59  IVFNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFF 118
           +V N+T+VI A+L G +       +  I   L  R   N W    +P K  K G  + F 
Sbjct: 70  LVINDTRVIPARLYGSKVG----TDAGIEILLLKRRENNIWETLVKPGKKAKPGTKISF- 124

Query: 119 SQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYV 178
              G   L   V+D    G  L+ F   GI  E  +  +G +PLPPYI  K     +D  
Sbjct: 125 ---GDGLLIGEVLDIVEEGNRLIQFQYEGI-FEEILDKLGEMPLPPYITHK----LQDKE 176

Query: 179 DYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDH 238
            YQT YAK +GS AAPTAGLHFT  LL  +   G+K+  VTLHVG GTF PVKV+D + H
Sbjct: 177 RYQTVYAKNEGSAAAPTAGLHFTKELLKEIEEKGVKIAHVTLHVGLGTFRPVKVDDVESH 236

Query: 239 IMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFIT 298
            MHSE   ++   A+ +N  K++GGR++SVGTTS R LE+AT E+GI+   SG+T+IFI 
Sbjct: 237 HMHSEFYVVEEEQAKIINETKAKGGRVISVGTTSCRTLESATDENGILQAKSGWTDIFIY 296

Query: 299 PGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           PGY+F+ +D L++NFHLP+STLLMLVSA  G E+    Y+ A+   YRF+S+GD  ++
Sbjct: 297 PGYQFKMIDALITNFHLPESTLLMLVSALAGKEKIMNAYEEAVKERYRFFSFGDAMII 354


>gi|302389934|ref|YP_003825755.1| S-adenosylmethionine--tRNA ribosyltransferase-isomerase
           [Thermosediminibacter oceani DSM 16646]
 gi|302200562|gb|ADL08132.1| S-adenosylmethionine--tRNA ribosyltransferase-isomerase
           [Thermosediminibacter oceani DSM 16646]
          Length = 341

 Score =  273 bits (698), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 144/356 (40%), Positives = 213/356 (59%), Gaps = 16/356 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M VK+F ++LP   IA  P+  RD++RLMVV  +     +    +  ++  +L   D +V
Sbjct: 1   MDVKDFYYELPEELIAQEPLEKRDTSRLMVVKRDTR---IFEHRIFENITEYLEEGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+V+ A+L GV+         +I   L  R+  N+W V  +P +  + G +  F   
Sbjct: 58  LNDTRVMPARLLGVK----EDTGGKIEFVLLKRIKENTWEVLVKPGRRARIGSVFVF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL A V+D  + G  ++ F   GI  E+ +  +G +P+PPYI +    + +D   Y
Sbjct: 111 -GDGRLRAKVLDFTDAGGRIVEFYYDGI-FEQVLDELGQMPVPPYIKK----ELKDKERY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YA+  GS AAPTAGLHFT  LL ++   G+K+ ++TLHVG GTF PVKV + ++H M
Sbjct: 165 QTVYARNPGSAAAPTAGLHFTEELLRKIEQNGVKICYITLHVGLGTFRPVKVRNIEEHKM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           H E   + +  A+ +N  K  G R+++VGTTS R LET   ++G +   SG+T++FI PG
Sbjct: 225 HHEYFEVGSHAAETINRAKESGKRVIAVGTTSTRTLETVADQNGFVKSGSGWTDLFIYPG 284

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           YRF+ VD +++NFHLP+STLLMLVSAF G +     Y+ AI   YRFYS+GD  L+
Sbjct: 285 YRFKVVDGMVTNFHLPESTLLMLVSAFAGRDLIMAAYREAIDKRYRFYSFGDAMLI 340


>gi|284052392|ref|ZP_06382602.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Arthrospira
           platensis str. Paraca]
          Length = 405

 Score =  273 bits (698), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 159/368 (43%), Positives = 206/368 (55%), Gaps = 26/368 (7%)

Query: 3   VKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIVFN 62
           ++ +D++LPP RIA  PV PRDS+RL+VV      P      L  DLP  L   D ++ N
Sbjct: 45  LQGYDYELPPDRIAQNPVIPRDSSRLLVV----DSPQSHQHRLFRDLPDLLQPQDLLILN 100

Query: 63  NTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQDG 122
           NT+V+ A+L G +      R   I   L    +PN W    +P K  K GD L F S+ G
Sbjct: 101 NTRVLPARLYGRK-----SRSAAIEILLLQEQAPNCWLALVKPGKRFKIGDRLEFQSKSG 155

Query: 123 QSRLEATVID-KWNTGEILLVFSI-SGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
              L ATVID   +TG  LL F +  G  L   +   G IP PPY+   + +  +    Y
Sbjct: 156 GEILYATVIDTNPSTGGRLLKFEVPQGQSLVSILDQFGEIPFPPYVTDSQALAEQ----Y 211

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT Y    G+VAAPTAGLHFT  L  RL    I   FVTLHVG GTF PV+VED   H M
Sbjct: 212 QTIYGDRPGAVAAPTAGLHFTEQLFQRLSQQHIDHAFVTLHVGLGTFRPVEVEDITTHQM 271

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLE----TATTEDGIINPWSGFTNIF 296
           H+E   +   T + +N  ++RGGRI++VGTT +R LE       + D  I P+ G  N+F
Sbjct: 272 HAEWVELPPETVEKINQTRARGGRIIAVGTTVVRTLEGIAAAQNSGDRSIQPYCGEINLF 331

Query: 297 ITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHA-------YRFYS 349
           I PGYR+R +D L++NFHLP+S+LLMLVSA  G E   K+YQ A+          YRFYS
Sbjct: 332 IYPGYRWRVIDGLITNFHLPRSSLLMLVSALIGRERLMKLYQDALEQPPNDFGNRYRFYS 391

Query: 350 YGDTSLLF 357
           +GD  L+ 
Sbjct: 392 FGDAMLIL 399


>gi|167766704|ref|ZP_02438757.1| hypothetical protein CLOSS21_01210 [Clostridium sp. SS2/1]
 gi|317497532|ref|ZP_07955851.1| tRNA ribosyltransferase-isomerase [Lachnospiraceae bacterium
           5_1_63FAA]
 gi|167711641|gb|EDS22220.1| hypothetical protein CLOSS21_01210 [Clostridium sp. SS2/1]
 gi|316895215|gb|EFV17378.1| tRNA ribosyltransferase-isomerase [Lachnospiraceae bacterium
           5_1_63FAA]
          Length = 342

 Score =  273 bits (698), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 150/356 (42%), Positives = 203/356 (57%), Gaps = 16/356 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V +F FDLP   IA  P+  R S+RL+ +  N      I   +  ++  +L   D +V
Sbjct: 1   MKVSDFTFDLPEELIAQDPLEDRSSSRLLTLDKNTGE---IGHDVFHNIVNYLKPGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NNTKVI A+L G +         ++   L  R   N W    +P K  + G  + F   
Sbjct: 58  LNNTKVIPARLIGAK----EETGGKVEVLLLKRKQDNVWETLVKPGKKARPGARISF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  +L   VID  + G  L+ F   GI  E  +  +G +PLPPYI  +     +D   Y
Sbjct: 111 -GDGKLVGEVIDVVDEGNRLVKFEYEGI-FEEVLDELGQMPLPPYITHQ----LKDKNRY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL ++  +G+ + +VTLHVG GTF PVKV+D  +H M
Sbjct: 165 QTVYAKYDGSAAAPTAGLHFTKELLQQIKDMGVNIAYVTLHVGLGTFRPVKVDDVLEHHM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   I+   A+ +N  K  GGR++SVGTTS R LE+   EDG ++  SG+T+IFI PG
Sbjct: 225 HSEFYRIEEEDAELINETKKNGGRVISVGTTSTRTLESVAEEDGTLHAKSGWTDIFIYPG 284

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           Y+F+ +D L++NFHLP+STLLMLVSA  G E     Y  A+   YRF+S+GD   +
Sbjct: 285 YKFKVIDGLITNFHLPESTLLMLVSALAGREHILNAYNIAVKERYRFFSFGDAMFI 340


>gi|291566847|dbj|BAI89119.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Arthrospira
           platensis NIES-39]
          Length = 441

 Score =  273 bits (698), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 159/368 (43%), Positives = 206/368 (55%), Gaps = 26/368 (7%)

Query: 3   VKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIVFN 62
           ++ +D++LPP RIA  PV PRDS+RL+VV      P      L  DLP  L   D ++ N
Sbjct: 81  LQGYDYELPPDRIAQNPVIPRDSSRLLVV----DSPQSHQHRLFRDLPDLLQPQDLLILN 136

Query: 63  NTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQDG 122
           NT+V+ A+L G +      R   I   L    +PN W    +P K  K GD L F S+ G
Sbjct: 137 NTRVLPARLYGRK-----SRSAAIEILLLQEQAPNCWLALVKPGKRFKIGDRLEFQSKSG 191

Query: 123 QSRLEATVID-KWNTGEILLVFSI-SGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
              L ATVID   +TG  LL F +  G  L   +   G IP PPY+   + +  +    Y
Sbjct: 192 GEILYATVIDTNPSTGGRLLKFEVPQGQSLVSILDQFGEIPFPPYVTDSQALAEQ----Y 247

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT Y    G+VAAPTAGLHFT  L  RL    I   FVTLHVG GTF PV+VED   H M
Sbjct: 248 QTIYGDRPGAVAAPTAGLHFTEQLFQRLSQQHIDHAFVTLHVGLGTFRPVEVEDITTHQM 307

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLE----TATTEDGIINPWSGFTNIF 296
           H+E   +   T + +N  ++RGGRI++VGTT +R LE       + D  I P+ G  N+F
Sbjct: 308 HAEWVELPPETVEKINQTRARGGRIIAVGTTVVRTLEGIAAAQNSGDRSIQPYCGEINLF 367

Query: 297 ITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHA-------YRFYS 349
           I PGYR+R +D L++NFHLP+S+LLMLVSA  G E   K+YQ A+          YRFYS
Sbjct: 368 IYPGYRWRVIDGLITNFHLPRSSLLMLVSALIGRERLMKLYQDALEQPPNDFGNRYRFYS 427

Query: 350 YGDTSLLF 357
           +GD  L+ 
Sbjct: 428 FGDAMLIL 435


>gi|169343759|ref|ZP_02864758.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           perfringens C str. JGS1495]
 gi|169298319|gb|EDS80409.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           perfringens C str. JGS1495]
          Length = 341

 Score =  273 bits (697), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 146/356 (41%), Positives = 207/356 (58%), Gaps = 16/356 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V +F F+LP   IA  P+  RDS+RLMV+         I      D+  +LN  D +V
Sbjct: 1   MKVSDFYFELPEELIAQYPLEKRDSSRLMVLDKKTGE---IEHRKFHDILEYLNEGDTLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NNT+V+ A+L G +         +I   L  R+  + W   A+P +  K G +  F   
Sbjct: 58  LNNTRVLPARLIGEK----EETGGKIEFLLLKRIEGDKWECLAKPGRKAKVGTVFTF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G+ +L+A V +    G  ++ F   GI  E+ +  +G +PLPPYI  K      D   Y
Sbjct: 111 -GEGKLKAIVREIGEEGNRIIEFKYDGI-FEQVLDELGQMPLPPYIHEK----LEDKERY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT Y+K +GS AAPTAGLHFT  LL  +   G+ + ++TLHVG GTF PVKV+D ++H+M
Sbjct: 165 QTVYSKEKGSAAAPTAGLHFTEELLKEIKDKGVNIAYLTLHVGLGTFRPVKVDDVNNHVM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   +D   A+ +N  K  G R+++VGTTS R LET   E+G +   SG+T+IFI PG
Sbjct: 225 HSEYYHLDKENAELINKTKEVGKRVIAVGTTSSRTLETIGDENGRVREQSGWTDIFIYPG 284

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           Y+F+ VD L++NFHLP+STL+MLVSA  G +     Y  A+   YRF+S+GD+  +
Sbjct: 285 YKFKIVDNLITNFHLPESTLIMLVSALAGQDNIMNAYNTAVKEKYRFFSFGDSMFI 340


>gi|302870943|ref|YP_003839579.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Caldicellulosiruptor obsidiansis OB47]
 gi|302573802|gb|ADL41593.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Caldicellulosiruptor obsidiansis OB47]
          Length = 346

 Score =  273 bits (697), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 149/359 (41%), Positives = 210/359 (58%), Gaps = 24/359 (6%)

Query: 5   EFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIVFNNT 64
           +F +DLP   IA +PV PRD++RLMV+ P+ +    I   +  D+  +LN  D +V NN+
Sbjct: 8   DFHYDLPDELIAQKPVEPRDNSRLMVILPDGT----IEHRIFRDIVEYLNEGDCLVLNNS 63

Query: 65  KVITAQLNGVRFCHINRREKE---ISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQD 121
           KVI A+L       I +RE     I   L  R+  N+W V  RP K  ++G    F    
Sbjct: 64  KVIPARL-------IGQREDTGSFIEFLLVKRLDINTWEVMTRPGKKARRGRKFVF---- 112

Query: 122 GQSRLEATVID-KWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
           G   L+A V+    + G  ++ F   G+  E  +  +G IPLPPYI      +  D   Y
Sbjct: 113 GNGELKAEVLHVNQDEGTRIVRFYYEGV-FEEVLEKLGKIPLPPYIKE----ELEDLSRY 167

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT Y+K+ GS AAPTAGLHFT  LL ++   G+++ +VTLHVG GTF PVKVE+ ++H M
Sbjct: 168 QTVYSKVPGSAAAPTAGLHFTEELLEKISKKGVEILYVTLHVGLGTFKPVKVENVEEHKM 227

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           H E   I    A  +N  K  G R+++VGTTS R+LE+ + E G +    G+TNIFI PG
Sbjct: 228 HEEYYEISQDVADRINRAKELGKRVIAVGTTSCRVLESCSDEAGRVKAQKGWTNIFIYPG 287

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLFQK 359
           Y F+ +D L++NFHLP +TL+MLV AF G E     Y+ A+   YRF+S+GD  L+ ++
Sbjct: 288 YNFKVLDGLVTNFHLPDTTLMMLVCAFGGYERIMNAYKIAVDMRYRFFSFGDAMLILRR 346


>gi|312134251|ref|YP_004001589.1| s-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Caldicellulosiruptor owensensis OL]
 gi|311774302|gb|ADQ03789.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Caldicellulosiruptor owensensis OL]
          Length = 345

 Score =  272 bits (696), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 149/358 (41%), Positives = 210/358 (58%), Gaps = 24/358 (6%)

Query: 5   EFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIVFNNT 64
           +F +DLP   IA +PV PRDS+RLMV+ P+ +    I   +  D+  +LN  D +V NN+
Sbjct: 8   DFHYDLPDELIAQKPVEPRDSSRLMVILPDGT----IEHRIFRDIVEYLNEGDCLVLNNS 63

Query: 65  KVITAQLNGVRFCHINRREKE---ISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQD 121
           KVI A+L       I +RE     I   L  R+  N+W V  RP K  ++G    F    
Sbjct: 64  KVIPARL-------IGQREDTGSFIEFLLVKRLDINTWEVMTRPGKKARRGRKFIF---- 112

Query: 122 GQSRLEATVID-KWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
           G   L+A V+    + G  ++ F   G+  E  +  +G IPLPPYI      +  D   Y
Sbjct: 113 GNGELKAKVLHVNQDEGTRIVRFYYEGV-FEEVLEKLGKIPLPPYIKE----ELEDLSRY 167

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT Y+K+ GS AAPTAGLHFT  LL ++   G+++ +VTLHVG GTF PVKVE+ ++H M
Sbjct: 168 QTVYSKVPGSAAAPTAGLHFTEELLKKIEEKGVEILYVTLHVGLGTFKPVKVENIEEHRM 227

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           H E   I    A  +N  K  G R+++VGTTS R+LE+ + E+G +    G+T+IFI PG
Sbjct: 228 HDEYYEISQEVADRINKAKEFGKRVIAVGTTSCRVLESCSDENGRLKAKKGWTDIFIYPG 287

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLFQ 358
           Y F+ +D L++NFHLP +TL+MLV AF G E     Y+ A+   YRF+S+GD  L+ +
Sbjct: 288 YEFKVLDGLVTNFHLPDTTLMMLVCAFGGYERIMNAYKIAVEMKYRFFSFGDAMLILR 345


>gi|326791986|ref|YP_004309807.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase [Clostridium
           lentocellum DSM 5427]
 gi|326542750|gb|ADZ84609.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase [Clostridium
           lentocellum DSM 5427]
          Length = 340

 Score =  272 bits (696), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 153/356 (42%), Positives = 205/356 (57%), Gaps = 17/356 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +F F LP  +IA  P+  R ++RLMV+         I      D+ A+L   D +V
Sbjct: 1   MKTSDFYFHLPEEQIAQVPLKDRTTSRLMVLDQKTG---EIEHKHFYDIKAYLKPGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+VI A+L G R         ++   L  R     W V  +P K  K GD + F   
Sbjct: 58  LNDTRVIPARLFGARPSG-----GKVEFLLLTRKEEKRWEVLVKPGKKAKIGDEIIF--- 109

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G+  L+A V +    G+ ++ F   GI  E  +  +G +PLPPYI  K      D   Y
Sbjct: 110 -GEGLLKAKVEEIIEDGKRIVRFEYEGI-FEEVLDALGEMPLPPYIHEK----LEDKERY 163

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT Y+K +GS AAPTAGLHFT  LL  +  +G+K+ +VTLHVG GTF PVKVED  +H M
Sbjct: 164 QTVYSKHEGSAAAPTAGLHFTKELLKEIEEMGVKIAYVTLHVGLGTFRPVKVEDVLNHEM 223

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   ID   A  +N VK+ GGR+++VGTTS R LE+   E G+I   SG+TNIFI PG
Sbjct: 224 HSEYYSIDEENATIINKVKAEGGRVIAVGTTSTRTLESNADEKGLIKAGSGWTNIFIYPG 283

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           Y F+ V+ L++NFHLP+STL+MLVSA  G E     Y  A++  YRF+S+GD  L+
Sbjct: 284 YTFKCVEELITNFHLPESTLIMLVSALAGKEAILNAYNTAVNEGYRFFSFGDAMLI 339


>gi|238926810|ref|ZP_04658570.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase QueA
           [Selenomonas flueggei ATCC 43531]
 gi|238885342|gb|EEQ48980.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase QueA
           [Selenomonas flueggei ATCC 43531]
          Length = 343

 Score =  272 bits (696), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 153/360 (42%), Positives = 215/360 (59%), Gaps = 18/360 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FD+ LP  +IA  P  PRDS+R+MV+ P       I       L  +L   D ++
Sbjct: 1   MNISDFDYFLPEEQIAQVPADPRDSSRMMVLSPKTQS---IEHRHFYQLDEYLTDGDVLI 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FN+T+VI A+L GVR     + E      L  ++  + W V  +P K ++ G ++ F  +
Sbjct: 58  FNDTRVIPARLIGVRQPTGGKAE----VFLLRQLERDRWEVLVKPGKKMRVGSVITFGHE 113

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
                L   V+   + G  ++ FS  GI  E  +  +GT+PLPPYI         D   Y
Sbjct: 114 -----LSCEVLAYTDFGGRIVKFSYEGI-FEEILDRLGTMPLPPYIHET----LEDPERY 163

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT Y++ +GS AAPTAGLHFT +L+ RL   G+ + FVTLHVG GTF PV+V++ +DH+M
Sbjct: 164 QTIYSREKGSAAAPTAGLHFTESLMDRLRKKGVHLGFVTLHVGLGTFRPVQVDEIEDHVM 223

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   I   TA  +   K  G R+V+VGTTS+R LE+A  + G+I    G TNIFI PG
Sbjct: 224 HSEFYSIPTETADLIRMAKQEGRRVVAVGTTSIRTLESAAVDHGMIEEKRGQTNIFIYPG 283

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLFQKR 360
           Y+F+ VD +++NFHLPKSTL+MLVSAF G E T + Y+ A+   YRF+S+GD ++L Q R
Sbjct: 284 YQFKIVDAVITNFHLPKSTLIMLVSAFAGREFTLQAYRTAVEENYRFFSFGD-AMLIQSR 342


>gi|70726282|ref|YP_253196.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus haemolyticus JCSC1435]
 gi|91207406|sp|Q4L6Y5|QUEA_STAHJ RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|68447006|dbj|BAE04590.1| S-adenosylmethionine tRNA ribosyltransferase [Staphylococcus
           haemolyticus JCSC1435]
          Length = 341

 Score =  272 bits (695), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 154/356 (43%), Positives = 213/356 (59%), Gaps = 16/356 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V+EFD+DLP S IA  P+  RD +RL+V+  N      I      D+  +L + D +V
Sbjct: 1   MNVEEFDYDLPESLIAQTPLKDRDQSRLLVLGRNSGN---IEHKHFKDVINYLETGDTLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+V+ A+L G++         ++   +  R+  N W V  +P+K IK G+ L F   
Sbjct: 58  LNDTRVMPARLFGLK----EETGAKVEMLMLTRIENNDWEVLLKPAKRIKVGNKLSF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G+ ++ A  I++ + G  ++     GI LE +++ +G +PLPPYI  K  +D  D   Y
Sbjct: 111 -GEGKIIAECIEELDQGGRIMRLHYEGI-LEERLNELGEMPLPPYI--KERLDDPDR--Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL  + + GI + F+TLHVG GTF PV VED +DH M
Sbjct: 165 QTVYAKESGSAAAPTAGLHFTDELLDEIRAKGINIAFITLHVGLGTFRPVSVEDINDHEM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   +   TA  LN  K  G RI+SVGTTS R LET   +       SG+T+IFI PG
Sbjct: 225 HSEYYQMTQETANLLNQTKKEGHRIISVGTTSTRTLETIRRDYNEFVAVSGWTDIFIYPG 284

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           + ++A+D L++NFHLPKSTL+MLVSAF   E     Y+ A+   YRF+S+GD  L+
Sbjct: 285 FTYKAIDGLITNFHLPKSTLVMLVSAFSSRENILNAYKEAVKLEYRFFSFGDAMLI 340


>gi|299822808|ref|ZP_07054694.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Listeria
           grayi DSM 20601]
 gi|299816337|gb|EFI83575.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Listeria
           grayi DSM 20601]
          Length = 342

 Score =  272 bits (695), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 152/353 (43%), Positives = 212/353 (60%), Gaps = 17/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V++FDFDLP   IA  P+  R ++RLMV++        I D   + +  +L   DA+V
Sbjct: 1   MKVEDFDFDLPEELIAQTPLLDRTASRLMVLNKETGA---IDDKHFASIVDYLEPGDALV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NNT+V+ A+L+G++    +     I   L  + + N W    +P+K I+ G  + F   
Sbjct: 58  LNNTRVLPARLHGLK----DETGAHIEVLLLKQKADNEWETLVKPAKRIRVGQTITF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G   L+A   ++   G  +L F   GI  E  +  +G +PLPPYI  +     R    Y
Sbjct: 111 -GNGELKAVCKEELEHGGRILEFHYEGIFYE-VLENLGEMPLPPYIKEQLEDQGR----Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL ++   G+KV F+TLHVG GTF PV V DTD+H M
Sbjct: 165 QTVYAKENGSAAAPTAGLHFTEALLDQIREKGVKVIFLTLHVGLGTFRPVDVADTDNHKM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLET-ATTEDGIINPWSGFTNIFITP 299
           HSE   +    A  L+ VK+ G RI++VGTTS+R LET A+  +G +   SG+T+IFI+P
Sbjct: 225 HSEFYRLTKEAAAELSEVKAAGKRIIAVGTTSIRTLETIASRNNGALVEESGWTDIFISP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           G+ F+AVD L++NFHLPKSTL+MLVSA    +     Y+HA+ + YRF+S+GD
Sbjct: 285 GFTFQAVDALITNFHLPKSTLIMLVSALSNRDIILHAYRHAVENRYRFFSFGD 337


>gi|225868906|ref|YP_002744854.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus equi subsp. zooepidemicus]
 gi|225702182|emb|CAW99893.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus equi subsp. zooepidemicus]
          Length = 342

 Score =  272 bits (695), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 154/355 (43%), Positives = 210/355 (59%), Gaps = 19/355 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVV-HPNLSCPLVISDHLVSDLPAFLNSNDAI 59
           M   +FDF+LP   IA  P+  RD ++L+++ H   +      DH++  L       DA+
Sbjct: 1   MNTNDFDFELPEELIAQTPLEQRDRSKLLIIDHQEHTMTDSHFDHIIDQL----EPGDAL 56

Query: 60  VFNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFS 119
           V NNT+V+ A+L G +          +   L   +  + W V A+P+K +K G  + F  
Sbjct: 57  VMNNTRVLPARLYGEKM----ETHGHVELLLLKNIQGDQWEVLAKPAKRLKAGAQISF-- 110

Query: 120 QDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVD 179
             G   L+A VI +   G  ++ FS  GI LE  +  +G +PLPPYI  K     R    
Sbjct: 111 --GDGLLKARVIQELEHGGRIVEFSYDGIFLEI-LETLGEMPLPPYIHEKLADAER---- 163

Query: 180 YQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHI 239
           YQT YAK  GS AAPTAGLHFT  LL ++ + G+ + ++TLHVG GTF PV V++ D+H 
Sbjct: 164 YQTVYAKENGSAAAPTAGLHFTQELLQKIEAKGVHLVYLTLHVGLGTFRPVSVDNIDEHD 223

Query: 240 MHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFIT 298
           MHSE   +    AQ L  VK+ GGRIV+VGTTS+R LET  ++  G I   SG+TNIFI 
Sbjct: 224 MHSEFYLLSEEAAQTLRKVKAAGGRIVAVGTTSIRTLETIGSKFQGQILADSGWTNIFIK 283

Query: 299 PGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDT 353
           PGY+F+ VD   +NFHLPKSTL+MLVSAF G +   + Y+HAI   YRF+S+GD 
Sbjct: 284 PGYQFKVVDAFSTNFHLPKSTLVMLVSAFAGRDFVLEAYKHAIDEHYRFFSFGDA 338


>gi|113869066|ref|YP_727555.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Ralstonia
           eutropha H16]
 gi|123133638|sp|Q0K734|QUEA_RALEH RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|113527842|emb|CAJ94187.1| queuosine biosynthesis protein [Ralstonia eutropha H16]
          Length = 352

 Score =  271 bits (694), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 161/366 (43%), Positives = 218/366 (59%), Gaps = 25/366 (6%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVH----PNLSCPLVISDHLVSDLPAFLNSN 56
           + + +FDF LPP  IA   +  R ++RL+VV      + +  + + D   SD+  +L  +
Sbjct: 2   LTLSDFDFPLPPELIAQSALPDRSASRLLVVERLAPADTADAVRMVDRAFSDIVDYLRPD 61

Query: 57  DAIVFNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILH 116
           D +VFN+T+VI A     RF        +I   +   V  ++     R SK   +G ILH
Sbjct: 62  DLLVFNDTRVIKA-----RFFGHKPSGGKIEVLVERVVDSHTVLAQVRASKTPTEGSILH 116

Query: 117 FFSQDGQSRLEATV---IDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPID 173
               DG      TV   +D++ T    L F    ++L   I   G +PLPPYI R  P D
Sbjct: 117 L--ADGA--FAVTVGPRVDQFFT----LRFPEPALDL---IERYGRLPLPPYI-RHDP-D 163

Query: 174 ARDYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVE 233
           A D   YQT YA+  G+VAAPTAGLHF   L +RL + G++  F+TLHVGAGTF PV+ E
Sbjct: 164 AYDETRYQTVYARSPGAVAAPTAGLHFDDALFARLNAAGVRRAFLTLHVGAGTFQPVRTE 223

Query: 234 DTDDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFT 293
           +  +H MHSE   + A  AQA+   ++RGGR+++VGTTSLR LE+A   DG +   SG T
Sbjct: 224 NLAEHKMHSEWYAVSADLAQAVRDTRARGGRVIAVGTTSLRALESAAQADGTLAAGSGDT 283

Query: 294 NIFITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDT 353
           +IFITPGYRFR VD L++NFHLPKSTLLMLVSA  G+E  +  Y+HA+   YRF+SYGD 
Sbjct: 284 DIFITPGYRFRLVDALITNFHLPKSTLLMLVSALAGVEAIRAAYRHAVEQRYRFFSYGDA 343

Query: 354 SLLFQK 359
            LL ++
Sbjct: 344 MLLTRQ 349


>gi|91205719|ref|YP_538074.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Rickettsia
           bellii RML369-C]
 gi|122425478|sp|Q1RI29|QUEA_RICBR RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|91069263|gb|ABE04985.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Rickettsia
           bellii RML369-C]
          Length = 353

 Score =  271 bits (694), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 151/375 (40%), Positives = 224/375 (59%), Gaps = 39/375 (10%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FDFDLP   IA  P+  RD + L++     S    +      ++  +L   D +V
Sbjct: 1   MKLSDFDFDLPLELIAQNPISKRDESNLLIA----STQQYVKTKFY-NIIDYLKEGDLLV 55

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNS---------------WSVYARP 105
           FNN+KVI A+L+          +K I+  L+ R+  N                WS +A+P
Sbjct: 56  FNNSKVIKAKLS---------LDKNITINLNQRLKDNRRATNDDAGRLKSIDYWSAFAKP 106

Query: 106 SKVIKKGDILHFFSQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPY 165
           ++ +K GD  +F +       +  + +K   GEI + F ++ I +   +   G +PLP Y
Sbjct: 107 ARKLKVGDEFYFDNH------KIIITEKLEMGEIKIKFELANISVFEFLDKYGEMPLPLY 160

Query: 166 IARKRPIDAR-DYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGA 224
           I  KRP   + D   YQT Y+ IQGSVAAPTAGLHFT++++++L + G++V FVTLHVGA
Sbjct: 161 I--KRPERQKSDDERYQTVYSNIQGSVAAPTAGLHFTNDIINKLKAKGVQVAFVTLHVGA 218

Query: 225 GTFMPVKVEDTDDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDG 284
           GTFMPVK E+ ++H MH+E   I   TA  +N  K    RI++VGTTSLR LE++   +G
Sbjct: 219 GTFMPVKTENINEHKMHTEYCSITPETAAIINKAKKEKRRIIAVGTTSLRTLESSGI-NG 277

Query: 285 IINPWSGFTNIFITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHA 344
            +N     T+IFITPG++F+ VD+L++NFH PKSTL MLV AF G ++  ++Y++AI   
Sbjct: 278 NVNSGDFETDIFITPGFKFQIVDMLLTNFHFPKSTLFMLVCAFAGFKKMHELYKYAIEEQ 337

Query: 345 YRFYSYGDTSLLFQK 359
            RF+SYGD +LL++K
Sbjct: 338 MRFFSYGDATLLYRK 352


>gi|261381310|ref|ZP_05985883.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Neisseria
           subflava NJ9703]
 gi|284795799|gb|EFC51146.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Neisseria
           subflava NJ9703]
          Length = 342

 Score =  271 bits (694), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 155/357 (43%), Positives = 211/357 (59%), Gaps = 20/357 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FDF+LP   IA  P   R S+RL+V  P L     I D    DLP ++   D +V
Sbjct: 1   MDISDFDFELPEKLIAQHPPEVRGSSRLLVALPTLP----IEDKHFGDLPDYVAPGDVLV 56

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FNNTKV+ A+L G +         +I   +   +  ++   + R SK  K G  L F   
Sbjct: 57  FNNTKVMKARLFGQKASG-----GKIEALIERVLDAHTALAHIRSSKSPKPGTELIF--- 108

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIE-LERQISLVGTIPLPPYIARKRPIDARDYVD 179
             +  + A ++++    E L      G + +   +   G +PLPPYI  +R  D  D   
Sbjct: 109 --EGDIRAVMMER---AEELFCLKFEGEQTVYELLEQNGHLPLPPYI--ERVADDEDDSR 161

Query: 180 YQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHI 239
           YQT YAK QG+VAAPTAGLHFT  LL RL + G++   VTLHVGAGTF PV+V+  ++H 
Sbjct: 162 YQTVYAKYQGAVAAPTAGLHFTDELLGRLKAKGVETAEVTLHVGAGTFQPVRVDKIEEHK 221

Query: 240 MHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITP 299
           MHSE   + A T  A+ + K+RG ++ +VGTTS+R LE+A  E G +    G T+IFITP
Sbjct: 222 MHSEWFDVPAETVAAIEAAKARGNKVWAVGTTSMRALESAARETGRLKAGRGDTDIFITP 281

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           GYRF   D L++NFHLPKSTLLMLVSAF G+E  + +Y+HA+   YRF+SYGD  +L
Sbjct: 282 GYRFNVADRLITNFHLPKSTLLMLVSAFSGMEHIRSVYRHAVEQEYRFFSYGDAMIL 338


>gi|153955757|ref|YP_001396522.1| hypothetical protein CKL_3143 [Clostridium kluyveri DSM 555]
 gi|219856124|ref|YP_002473246.1| hypothetical protein CKR_2781 [Clostridium kluyveri NBRC 12016]
 gi|189038515|sp|A5N205|QUEA_CLOK5 RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|254764273|sp|B9E5Q7|QUEA_CLOK1 RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|146348615|gb|EDK35151.1| QueA [Clostridium kluyveri DSM 555]
 gi|219569848|dbj|BAH07832.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 341

 Score =  271 bits (694), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 150/356 (42%), Positives = 209/356 (58%), Gaps = 16/356 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V +FDF LP   IA +P+  RD  RLMV+         +   +  D+  +LN  D +V
Sbjct: 1   MEVTDFDFYLPEELIAQKPLEQRDEGRLMVLDKKTGK---VCHKIFKDIVYYLNPGDCVV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+V+ A+L GVR   + +    I   L  R    +W    +P +  K G+  +F   
Sbjct: 58  LNDTRVLPARLIGVREDTMGK----IEFLLLKRRDNFTWETLVKPGRRAKVGNRFNF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  +L+A V+     G  ++ F  +G+  E  +  +G IPLPPYI  K  ++ ++   Y
Sbjct: 111 -GSGQLKAEVVSINEDGNRIVRFEYNGV-FEEILDKLGQIPLPPYIKEK--LENKEL--Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT Y+K +GS AAPTAGLHFT  LL  L   G+ + F+TLHVG GTF PVKVE+ +DH M
Sbjct: 165 QTVYSKEEGSAAAPTAGLHFTEELLRELREKGVNLAFLTLHVGLGTFRPVKVENIEDHAM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   +   TA  +N+ K  G  ++SVGTTS R LET   E+G +   SG+T+IFI PG
Sbjct: 225 HSEFYSMSKETADMINAAKESGHSVISVGTTSCRTLETIGDENGRVKEQSGWTDIFIYPG 284

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           Y+++ VD L++NFHLPKSTL+MLVSAF G E T   Y  A+   YRF+S+GD   +
Sbjct: 285 YKYKVVDKLITNFHLPKSTLIMLVSAFYGRENTLHAYNVAVKEKYRFFSFGDAMFI 340


>gi|28378877|ref|NP_785769.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Lactobacillus plantarum WCFS1]
 gi|254557082|ref|YP_003063499.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Lactobacillus plantarum JDM1]
 gi|300768017|ref|ZP_07077923.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase QueA
           [Lactobacillus plantarum subsp. plantarum ATCC 14917]
 gi|308181076|ref|YP_003925204.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Lactobacillus plantarum subsp. plantarum ST-III]
 gi|38258031|sp|Q88V04|QUEA_LACPL RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|28271714|emb|CAD64620.1| S-adenosylmethionine tRNA ribosyltransferase-isomerase
           [Lactobacillus plantarum WCFS1]
 gi|254046009|gb|ACT62802.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Lactobacillus plantarum JDM1]
 gi|300494366|gb|EFK29528.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase QueA
           [Lactobacillus plantarum subsp. plantarum ATCC 14917]
 gi|308046567|gb|ADN99110.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Lactobacillus plantarum subsp. plantarum ST-III]
          Length = 344

 Score =  271 bits (694), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 155/357 (43%), Positives = 213/357 (59%), Gaps = 17/357 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           + +++FD+DLP   IA  P+  RDS+RL+ +         + D    D+   LN  DA+V
Sbjct: 3   LTLEDFDYDLPHELIAQTPIKKRDSSRLLELDRQTGE---MQDKHFYDIIDQLNPGDAVV 59

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NN++V+ A+L GV+       E      L      + W    +P+K  K G ++ F   
Sbjct: 60  MNNSRVMPARLYGVKPETGGHAE----VLLLHNTEGDEWETLMKPAKRAKVGTVISF--- 112

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  +L ATV  +   G  ++ F   GI +E   SL G  PLPPYI  K  +D  D   Y
Sbjct: 113 -GDGKLTATVTAEKEDGIRMIEFHYDGIFMEILESL-GETPLPPYIKEK--LDDPDR--Y 166

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLH+T  LL ++   GIK+ ++TLHVG GTF PV+ ++ DDH M
Sbjct: 167 QTVYAKENGSAAAPTAGLHWTKELLQKVQDKGIKLVYLTLHVGLGTFRPVEEDNIDDHKM 226

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           HSE   +D   A+ LN V+  GGRI++ GTTS+R LET  ++ DG I P SG+T+IFI P
Sbjct: 227 HSEFYRLDEDAAKTLNEVRQNGGRIIATGTTSIRTLETIGSKFDGEIKPDSGWTDIFIKP 286

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           GY+++ VD  ++NFHLPKSTL+MLV+AF G +   K YQHAI   YRF+S+GD   +
Sbjct: 287 GYQWKVVDAFITNFHLPKSTLVMLVAAFTGRDMILKAYQHAIDEKYRFFSFGDAMFI 343


>gi|197121715|ref|YP_002133666.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Anaeromyxobacter sp. K]
 gi|238689888|sp|B4UID2|QUEA_ANASK RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|196171564|gb|ACG72537.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Anaeromyxobacter sp. K]
          Length = 345

 Score =  271 bits (694), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 154/359 (42%), Positives = 209/359 (58%), Gaps = 14/359 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FDF LP   +A  PV PRD++RLMV+ P    P   +    +DLP  L   D +V
Sbjct: 1   MRLSDFDFALPEGLVAQAPVTPRDASRLMVLAPGEGAP---AHRGFADLPELLAPGDLLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FN+T+VI A+L G +      + + + C          W    + SK I++G +L F   
Sbjct: 58  FNDTRVIPARLLGHKAS--GGKVELLLCEPLEGGLGRRWRAMGQASKPIREGAVLTF--- 112

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
           DG   LEA V      G   +     G ELE  +   G IPLPPYI  +R  DA D   Y
Sbjct: 113 DG---LEARVDGVEGEGFYRVTLDRQGPELEAALGRAGRIPLPPYI--RRAPDAEDAARY 167

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT +A+  GS AAPTAGLHFT  LL+RL + GI+   VTLHVG GTF+P++ +D D H M
Sbjct: 168 QTIWARAPGSAAAPTAGLHFTEPLLARLAARGIRRTAVTLHVGPGTFLPIRGDDLDLHRM 227

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           H E   +    A+ L + ++RGGRIV+VGTTS+R LE+A   DG +    G T +FI PG
Sbjct: 228 HGERYEVSPAAAEELAATRARGGRIVAVGTTSVRTLESA-WRDGAVAAGPGRTELFIRPG 286

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLFQK 359
           + F AVD +++NFHLP+STLL+LV AF G       Y+ A++  YRF+SYGD  L+ ++
Sbjct: 287 HPFHAVDAMVTNFHLPRSTLLVLVCAFGGQGRVLAAYREAVARGYRFFSYGDAMLVLRR 345


>gi|209527446|ref|ZP_03275951.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase [Arthrospira
           maxima CS-328]
 gi|209492119|gb|EDZ92469.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase [Arthrospira
           maxima CS-328]
          Length = 375

 Score =  271 bits (693), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 158/368 (42%), Positives = 205/368 (55%), Gaps = 26/368 (7%)

Query: 3   VKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIVFN 62
           ++ +D++LPP RIA  PV PRDS+RL+VV      P      L  DLP  L   D ++ N
Sbjct: 15  LQGYDYELPPDRIAQNPVIPRDSSRLLVV----DSPPSHQHRLFRDLPDLLQPEDLLILN 70

Query: 63  NTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQDG 122
           NT+V+ A+L G +          I   L    +PN W    +P K  K GD L F S+ G
Sbjct: 71  NTRVLPARLYGRKST-----SAAIEILLLQEQAPNCWLALVKPGKRFKIGDRLEFPSKSG 125

Query: 123 QSRLEATVID-KWNTGEILLVFSI-SGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
           +  L ATVID    TG  LL F +  G  L   +   G IP PPY+   + +  +    Y
Sbjct: 126 REILYATVIDTNPGTGGRLLKFEVPQGQSLVSILDQFGEIPFPPYVTDSQAVAEQ----Y 181

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT Y    G+VAAPTAGLHFT  L  RL    I   F+TLHVG GTF PV+VED   H M
Sbjct: 182 QTIYGTRPGAVAAPTAGLHFTEELFQRLSDHHIDHAFLTLHVGLGTFRPVEVEDITTHQM 241

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLE----TATTEDGIINPWSGFTNIF 296
           H+E   +   T   +N  ++RGGRI++VGTT +R LE       + DG I P+ G  N+F
Sbjct: 242 HAEWVELRPETVDKINQTRARGGRIIAVGTTVVRTLEGIAAAQNSLDGCIQPYCGEINLF 301

Query: 297 ITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHA-------YRFYS 349
           I PGYR+R +D L++NFHLP+S+LLMLVSA  G E   K+YQ A+          YRFYS
Sbjct: 302 IYPGYRWRVIDGLITNFHLPRSSLLMLVSALIGRERLMKLYQDALEQPPNDFGNRYRFYS 361

Query: 350 YGDTSLLF 357
           +GD  L+ 
Sbjct: 362 FGDAMLIL 369


>gi|188586408|ref|YP_001917953.1| S-adenosylmethionine--tRNA-ribosyltransferase-isomerase
           [Natranaerobius thermophilus JW/NM-WN-LF]
 gi|229892797|sp|B2A5L1|QUEA_NATTJ RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|179351095|gb|ACB85365.1| S-adenosylmethionine--tRNA-ribosyltransferase-isomerase
           [Natranaerobius thermophilus JW/NM-WN-LF]
          Length = 343

 Score =  271 bits (693), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 149/356 (41%), Positives = 208/356 (58%), Gaps = 15/356 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M ++EF+++LP   IA +P+  R  +RLMVV  N S   V  +H    LP ++   D  V
Sbjct: 1   MKLEEFNYELPEELIAQKPLANRSKSRLMVVSINSSD--VQHNHF-EKLPQYVKDGDLFV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NN++VI A+L G +     + E      LH     + W V  +P K  K G++  F   
Sbjct: 58  INNSRVIPARLFGNKKQTGGKLE---MVLLHPLEGKDEWEVLVKPGKRAKPGNVFEF--- 111

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            GQ  LEA ++D    G   + F   G   ++ +  +G +PLPPYI      +  D   Y
Sbjct: 112 -GQETLEAEILDITPEGSRRVKFYYQG-NFQQVLDQLGQMPLPPYIKE----ELEDPERY 165

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GSVAAPTAGLHFT  ++S +   G +V  +TLHVG GTF PV+  + ++H M
Sbjct: 166 QTVYAKESGSVAAPTAGLHFTPEIISDIKDQGGEVAELTLHVGLGTFRPVETPNIEEHEM 225

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           H+E   +   TA+ +N  K RG R+++VGTT +R LET  T+DG++ P  G+T+IFI PG
Sbjct: 226 HAEYYQLPEETAKKINQAKQRGNRVIAVGTTVVRTLETVKTDDGLVQPGKGWTDIFIYPG 285

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           Y F+ VD +++NFHLPKSTLLMLVSAF G +     YQ AI   YRF+S+GD   +
Sbjct: 286 YEFKVVDAMLTNFHLPKSTLLMLVSAFAGKDLIMSAYQAAIEERYRFFSFGDAMFI 341


>gi|194017396|ref|ZP_03056008.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           pumilus ATCC 7061]
 gi|194011264|gb|EDW20834.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           pumilus ATCC 7061]
          Length = 342

 Score =  271 bits (693), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 151/357 (42%), Positives = 211/357 (59%), Gaps = 17/357 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M ++ FDFDLP   IA  P+  RD++RLMV++        I     S +  +  + D +V
Sbjct: 1   MKLELFDFDLPERLIAQVPLEKRDASRLMVLNKQTGA---IKHDTFSQITDYFQTGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NNT+V+ A+L G++         ++   L  +   + W    +P+K +KKG ++ F   
Sbjct: 58  LNNTRVLPARLFGMK----EDTGAKVELLLLKQEEGDKWETLVKPAKRVKKGTVITF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL+A   ++   G   + F  +GI  E   SL G +PLPPYI  K  +D R+   Y
Sbjct: 111 -GDGRLQAVCTEELEHGGRKVEFQYTGIFYEVLESL-GEMPLPPYI--KEQLDDRER--Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT Y+K  GS AAPTAGLHFT+ LL  L   G+ + F+TLHVG GTF PV  +  ++H M
Sbjct: 165 QTVYSKEVGSAAAPTAGLHFTNELLDALKEKGVHIAFITLHVGLGTFRPVSADRIEEHEM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLET-ATTEDGIINPWSGFTNIFITP 299
           H+E   ++  TA  LN V+  GGRI+SVGTTS R LET A+  DG     SG+T+IFI P
Sbjct: 225 HAEFYEMNEETAAELNRVRKEGGRIISVGTTSTRTLETIASAHDGEFKASSGWTSIFIYP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           GY F+A+D +++NFHLPKS+L+MLVSA  G E   K Y  A+   YRF+S+GD  L+
Sbjct: 285 GYTFKAIDGMITNFHLPKSSLIMLVSALAGREHVLKAYNEAVKEEYRFFSFGDAMLI 341


>gi|23099489|ref|NP_692955.1| S-adenosylmethionine-tRNA ribosyltransferase-isomerase
           [Oceanobacillus iheyensis HTE831]
 gi|38372491|sp|Q8EPQ8|QUEA_OCEIH RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|22777718|dbj|BAC13990.1| S-adenosylmethionine-tRNA ribosyltransferase-isomerase
           [Oceanobacillus iheyensis HTE831]
          Length = 342

 Score =  271 bits (693), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 152/358 (42%), Positives = 212/358 (59%), Gaps = 17/358 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M +++FDF LP   IA  P+  R S+RL V+    S    I+     D+  +L + D +V
Sbjct: 1   MQIEDFDFHLPEELIAQTPLKDRTSSRLCVLDKQTS---EITHRSFKDITTYLQAGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+TKV+ A+L GV+    +    +I   L  +   ++W V  +P+K +K G  + F   
Sbjct: 58  LNDTKVLPARLYGVK----SDTGAKIEVLLLHQQEEDTWEVLVKPAKKVKVGTEIIF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  +L+AT ID  + G  ++ FS +GI  E  +  +G +PLPPYI  + P   R    Y
Sbjct: 111 -GNGKLKATCIDLKDHGGRIMTFSYTGIFYE-ILDQLGEMPLPPYIKEQLPEQDR----Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK +GS AAPTAGLHFT  LL  + ++G+ + FVTLHVG GTF PV V+  +DH M
Sbjct: 165 QTVYAKEKGSAAAPTAGLHFTDKLLEDIKAMGVNIVFVTLHVGLGTFRPVSVDSVEDHDM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           HSE   +    A+ LN  K+ G RI+SVGTTS R LET   + DG      G+T+IFI P
Sbjct: 225 HSEFYSMSESAAKTLNEAKAAGRRIISVGTTSTRTLETIVRDHDGKFVATRGWTDIFIYP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
            Y+FRA+D L++NFHLPKSTL+M++SA  G E     Y  A+   YRF+S+GD  L+ 
Sbjct: 285 PYKFRAIDGLITNFHLPKSTLIMMISALAGKEAILHAYNEAVKEEYRFFSFGDAMLIL 342


>gi|220932067|ref|YP_002508975.1| S-adenosylmethionine--tRNA-ribosyltransferase-isomerase
           [Halothermothrix orenii H 168]
 gi|254764280|sp|B8CXG1|QUEA_HALOH RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|219993377|gb|ACL69980.1| S-adenosylmethionine--tRNA-ribosyltransferase-isomerase
           [Halothermothrix orenii H 168]
          Length = 341

 Score =  271 bits (693), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 147/357 (41%), Positives = 208/357 (58%), Gaps = 16/357 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V+EFD++LP   IA +P+  RD +RLMV+H        I + +  ++  FL   D +V
Sbjct: 1   MKVEEFDYELPEELIAQKPLPNRDDSRLMVLHRKTGE---IEETVFKNIIKFLEPGDLLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+TKVI A+L G +     R    I   L   ++   W V  RP + +KKG+ + F   
Sbjct: 58  LNDTKVIPARLFGEKIPSGTR----IEVLLLKSITEGLWEVLVRPGRRMKKGNRVSF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  +L   V D  + G  ++ F   G + ++ I  +G +PLPPYI RK      D   Y
Sbjct: 111 -GDGKLVGIVKDYTDFGGRIMQFEYDG-DFDKVIEELGEMPLPPYITRK----VEDKGRY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YA+ +GSVAAPTAGLHFT  LL ++   GI + ++TLHVG GTF PV+ E+ +DH M
Sbjct: 165 QTVYARKKGSVAAPTAGLHFTDRLLKKIKEQGIGIIYLTLHVGLGTFRPVRAENVEDHKM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   +       +   K +G ++++VGTT  R LE+A  E   +    G+T+IFI PG
Sbjct: 225 HSEYFEVSTDVVNRIKETKEKGKKVIAVGTTVTRALESAAVEKRHLKAMRGWTDIFIYPG 284

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           Y F+ +D L++NFHLPKSTLLMLVSAF G +     Y+ AI + YRF+S+GD  L+ 
Sbjct: 285 YNFKVIDGLITNFHLPKSTLLMLVSAFAGKDMVMSAYKLAIKNKYRFFSFGDAMLIL 341


>gi|260583655|ref|ZP_05851403.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Granulicatella elegans ATCC 700633]
 gi|260158281|gb|EEW93349.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Granulicatella elegans ATCC 700633]
          Length = 345

 Score =  271 bits (692), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 155/361 (42%), Positives = 214/361 (59%), Gaps = 27/361 (7%)

Query: 4   KEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIVFNN 63
           ++FDFDLP  +IA  P+  R S+RL+VV+        + D   S++  +L   D +V NN
Sbjct: 6   QDFDFDLPEEQIAQTPLKDRTSSRLLVVNETEHS---VEDKHFSEIIDYLEEGDILVVNN 62

Query: 64  TKVITAQLNGVRFCHINRREKE-----ISCTLHMRVSPNSWSVYARPSKVIKKGDILHFF 118
           T+V+ A+L G         EKE     I   L      + W    +P+K +K G ++ F 
Sbjct: 63  TRVLPARLYG---------EKEGTGAHIEVLLLHNTHGDCWETLVKPAKRMKVGTVVSF- 112

Query: 119 SQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYV 178
              G  RL+ATV ++   G  ++ F   G+ LE   SL G +PLPPYI  K  +D  D  
Sbjct: 113 ---GDGRLKATVTEELEQGGRIIEFQYDGVFLEILESL-GEMPLPPYI--KERLD--DQE 164

Query: 179 DYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDH 238
            YQT YAK  GS AAPTAGLHFT  L+ ++   GI++  +TLHVG GTF PV V+  +DH
Sbjct: 165 RYQTVYAKENGSAAAPTAGLHFTKELMEKIQQKGIQIVPITLHVGLGTFRPVSVDHLEDH 224

Query: 239 IMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLET-ATTEDGIINPWSGFTNIFI 297
            MHSE   I   TA+ +   K  G R+++VGTTS+R LET  +   G I P SG+T+IFI
Sbjct: 225 KMHSEYYHISKETAEVIAETKKNGKRVIAVGTTSIRTLETVGSANQGEIVPSSGWTDIFI 284

Query: 298 TPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           +PGY F+ VD  ++NFHLPKSTL+MLVSA+ G + T + Y HAI   YRF+S+GD   ++
Sbjct: 285 SPGYEFKVVDAFITNFHLPKSTLVMLVSAYLGRDFTLEAYHHAIRERYRFFSFGDAMFVY 344

Query: 358 Q 358
           +
Sbjct: 345 R 345


>gi|306821137|ref|ZP_07454753.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Eubacterium
           yurii subsp. margaretiae ATCC 43715]
 gi|304550830|gb|EFM38805.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Eubacterium
           yurii subsp. margaretiae ATCC 43715]
          Length = 344

 Score =  271 bits (692), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 144/356 (40%), Positives = 215/356 (60%), Gaps = 16/356 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M  +EF +DLP   IA  P+  R S++L++++            +  ++  +L+ ND +V
Sbjct: 1   MKTEEFFYDLPERLIAQTPLKDRSSSKLLLLNKESGN---TKHEIFKNIIDYLDKNDVLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FNNT+V+ A+L G++          +   L  R S   W V  +P+K +KKG  + F   
Sbjct: 58  FNNTRVLPARLYGLK----KDTGANVEILLLKRYSMKKWQVLVKPAKRLKKGSTVSF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G+  L  T++++++ G   + FS  G+  E  IS +G +PLPPYI  K     +D   Y
Sbjct: 111 -GEDLLLMTILEEYDEGIRDVEFSYEGV-FEDIISQIGFMPLPPYIKEK----LQDKERY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT Y+KI GS AAPTAGLHFT  L++ L   G+++ ++TLHVG GTF PVK E+  DH+M
Sbjct: 165 QTIYSKINGSSAAPTAGLHFTKELIASLEEKGVQIEYLTLHVGLGTFRPVKAEEVTDHVM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   ID  TAQ LN  K  G +I++VGTT++R LE+A   D I+      T+IFI P 
Sbjct: 225 HSEHYVIDEDTAQRLNKAKKEGKKIIAVGTTTVRTLESAVNRDNILEKLEDDTSIFIYPP 284

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           Y F+ VD +++NFHLP+STL+M++SAF G ++    Y+ AI + YRF+S+GD+  +
Sbjct: 285 YDFKFVDSIITNFHLPQSTLIMMISAFAGKDKVFNAYKVAIENEYRFFSFGDSMFI 340


>gi|298244051|ref|ZP_06967858.1| S-adenosylmethionine/tRNA-ribosyltransferase-iso merase
           [Ktedonobacter racemifer DSM 44963]
 gi|297557105|gb|EFH90969.1| S-adenosylmethionine/tRNA-ribosyltransferase-iso merase
           [Ktedonobacter racemifer DSM 44963]
          Length = 379

 Score =  270 bits (691), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 150/371 (40%), Positives = 221/371 (59%), Gaps = 22/371 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           + + +FD+ LP   IA  P+ PRDS+RL+VV         ++     D+  +L   D ++
Sbjct: 17  LKISDFDYHLPNELIAQTPIEPRDSSRLLVVKRQDET---LAHQHFRDIEEYLQPGDLLI 73

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N ++VI A+L G R       E  +       +  ++W    RP + +++G  + F ++
Sbjct: 74  ANQSRVIPARLLGKRAESGGAVEV-LLLAERSDLGQDTWEALVRPGRRLREGARIFFGAE 132

Query: 121 -DGQSRLEATVIDKWNTGEILLVFSISGIELERQ------------ISLVGTIPLPPYIA 167
            + Q+RL   ++++   G  ++ F + G   ERQ            I  +G +PLPPYI 
Sbjct: 133 TEEQARLIGEILERTEAGGRVVRFHVPGRSQERQNDPYALLDVRQVIDEIGKMPLPPYI- 191

Query: 168 RKRPIDARDYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTF 227
               +D  D   YQT YA+I+GS AAPTAGLHFT  LL RL + G++  FVTLHVG  TF
Sbjct: 192 -HETLD--DPERYQTVYARIRGSAAAPTAGLHFTPQLLERLRARGVRTGFVTLHVGLDTF 248

Query: 228 MPVKVEDTDDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLET-ATTEDGII 286
            PV+ ED  +H MHSE   +D  TA  +N  ++RGGR+V+VGTTS+R+LE+ A+  +G I
Sbjct: 249 RPVESEDVREHKMHSEEIELDETTAALINETRARGGRVVAVGTTSVRVLESVASLHEGRI 308

Query: 287 NPWSGFTNIFITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYR 346
            P+ G T +FITPGYR++AVD L++NFHLP+STLL+LVSAF      ++ YQ AI+  YR
Sbjct: 309 VPYKGHTRLFITPGYRYQAVDALITNFHLPRSTLLLLVSAFMTKPLMERAYQEAITERYR 368

Query: 347 FYSYGDTSLLF 357
           F+S+GD  L+ 
Sbjct: 369 FFSFGDAMLIL 379


>gi|315221824|ref|ZP_07863736.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus anginosus F0211]
 gi|315189057|gb|EFU22760.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus anginosus F0211]
          Length = 342

 Score =  270 bits (691), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 156/353 (44%), Positives = 211/353 (59%), Gaps = 17/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +FDF LP   IA  P+  RD++RL+VV+        + D     +   LN  DA+V
Sbjct: 1   MNTADFDFHLPEELIAQTPLEKRDASRLLVVNHETGQ---MEDTHFDAIIDQLNPGDALV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+V+ A+L+G +          +   L   ++ + W V A+P+K +K G  + F   
Sbjct: 58  MNDTRVLPARLHGEK----PETGGHVELLLLKNIAGDDWEVLAKPAKRLKVGAAISF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL ATV+++   G   + F   GI LE   SL G +PLPPYI  K     +D   Y
Sbjct: 111 -GDGRLTATVLEELEHGGRTVRFHYQGIFLEVLESL-GEMPLPPYIHEK----LKDRERY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL+++ + G+K+ ++TLHVG GTF PV V++ D+H M
Sbjct: 165 QTVYAKENGSAAAPTAGLHFTKELLAQIEAKGVKLVYLTLHVGLGTFRPVSVDNVDEHEM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           HSE   +    A  L  VK+ G R+V+VGTTS+R LET  ++ +G I   SG+TNIFI P
Sbjct: 225 HSEFYTLSEEAANTLRQVKASGHRVVAVGTTSIRTLETIGSKFNGEIKADSGWTNIFIKP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           GY ++ VD   +NFHLPKSTL+MLVSAF G E     YQHAI   YRF+S+GD
Sbjct: 285 GYDWKVVDAFSTNFHLPKSTLVMLVSAFAGRELVLSAYQHAIDEKYRFFSFGD 337


>gi|255066143|ref|ZP_05317998.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Neisseria
           sicca ATCC 29256]
 gi|255049688|gb|EET45152.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Neisseria
           sicca ATCC 29256]
          Length = 343

 Score =  270 bits (691), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 155/361 (42%), Positives = 215/361 (59%), Gaps = 28/361 (7%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FDF LP   IA  P   R S+RL+V  P++     + D +  DLP ++ + D +V
Sbjct: 1   MDISDFDFTLPDQLIAQHPPEVRGSSRLLVALPDMP----LQDRVFGDLPDYIEAGDVLV 56

Query: 61  FNNTKVITAQLNGVRFCHINRREKE----ISCTLHMRVSPNSWSVYARPSKVIKKGDILH 116
           FNNTKV+ A+L G         EKE    I   +   +  ++   + R SK  K G  L 
Sbjct: 57  FNNTKVMKARLFG---------EKESGGKIEALIERVLDNHTALAHIRSSKSPKPGTKLI 107

Query: 117 FFSQDGQSRLEATVIDKWNTGEILLVFSISGIE-LERQISLVGTIPLPPYIARKRPIDAR 175
           F     +  + A ++++ +    L      G + +   +   G +PLPPYI  +R   A 
Sbjct: 108 F-----EGDICAVMVERADE---LFCLRFEGEQTVYELLEQNGHLPLPPYI--ERAAGAD 157

Query: 176 DYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDT 235
           D   YQT YAK QG+VAAPTAGLHFT  LL RL + G++   VTLHVGAGTF PV+V+  
Sbjct: 158 DDTRYQTVYAKHQGAVAAPTAGLHFTDELLGRLKAKGVETAEVTLHVGAGTFQPVRVDKI 217

Query: 236 DDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNI 295
           ++H MHSE   +   T  A+ +  +RG ++ +VGTTS+R LE+A  E G +    G T+I
Sbjct: 218 EEHKMHSEWFDVPPETVAAIEAAHARGNKVWAVGTTSMRALESAARETGRLKAGQGDTDI 277

Query: 296 FITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSL 355
           FITPGYRFR +D L++NFHLPKSTLLMLVSAF G+E  + +Y+HA+ H YRF+SYGD  +
Sbjct: 278 FITPGYRFRVIDRLITNFHLPKSTLLMLVSAFSGMEHIRAVYRHAVEHEYRFFSYGDAMV 337

Query: 356 L 356
           L
Sbjct: 338 L 338


>gi|255656788|ref|ZP_05402197.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           difficile QCD-23m63]
 gi|296452383|ref|ZP_06894084.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           difficile NAP08]
 gi|296877731|ref|ZP_06901758.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           difficile NAP07]
 gi|296258713|gb|EFH05607.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           difficile NAP08]
 gi|296431264|gb|EFH17084.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           difficile NAP07]
          Length = 341

 Score =  270 bits (691), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 147/356 (41%), Positives = 201/356 (56%), Gaps = 16/356 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +F FDLP   IA  P+  R S+RLMV+         I   +  D+  +LN  D +V
Sbjct: 1   MKTSDFKFDLPQELIAQVPIEDRASSRLMVLDKETGN---IEHKVFRDIIEYLNPGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NNT+VI A+L G +         +I   L  R   ++W    +P K  K G    F   
Sbjct: 58  LNNTRVIPARLMGEKL----ETGGKIEFLLLKRTEEDTWQALVKPGKRAKVGTKFSF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  +L   V+D  + G  ++ F   GI  E  +  +G +PLPPYI  +  +D ++   Y
Sbjct: 111 -GNGKLIGEVVDLSDEGSRIIKFHYDGI-FEEILDELGNMPLPPYITAR--LDEKER--Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT Y+K  GS AAPTAGLHFT  LLS++   G+ + FVTLHVG GTF PVKVED  +H M
Sbjct: 165 QTVYSKHNGSAAAPTAGLHFTEELLSKIKEKGVDIAFVTLHVGLGTFRPVKVEDVLNHKM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   +    A  +N  K  G  ++ VGTTS R +E+A  EDG +   SG+T IFI PG
Sbjct: 225 HSEYYMVSQEAADKINRAKENGNNVICVGTTSCRTIESACNEDGKMKETSGWTEIFIYPG 284

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           Y+F+ +D L++NFHLP+STL+MLVSA CG +     Y  A+   YRF+S+GD  ++
Sbjct: 285 YKFKVLDKLITNFHLPESTLIMLVSAICGKDNVLNAYNEAVKERYRFFSFGDAMII 340


>gi|212638559|ref|YP_002315079.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Anoxybacillus flavithermus WK1]
 gi|212560039|gb|ACJ33094.1| S-adenosylmethionine:tRNA-ribosyltransferase-isomerase (queuine
           synthetase) [Anoxybacillus flavithermus WK1]
          Length = 345

 Score =  270 bits (691), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 154/357 (43%), Positives = 210/357 (58%), Gaps = 16/357 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M +  FDF LP   IA  P+  RD++RLMV+  +     V  +     + ++L   D +V
Sbjct: 3   MKIDLFDFYLPEELIAQTPLPNRDASRLMVL--DKQTGEVTHESTFRSILSYLKEGDCLV 60

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+V+ A+L G +          I   L  ++  + W    +P+K +K G I+ F   
Sbjct: 61  LNDTRVLPARLYGEK----EETGAHIEVLLLKQLDGDQWETLVKPAKRVKVGTIISF--- 113

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL A  + +   G  +L FS  GI LE   SL G +PLPPYI  +      D   Y
Sbjct: 114 -GDGRLRAECVAELEHGGRILSFSYDGIFLEVLESL-GEMPLPPYIKAQ----LHDRERY 167

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YA+  GS AAPTAGLHFT  LL  +   G+ + F+TLHVG GTF PV VE+ ++H M
Sbjct: 168 QTVYAREAGSAAAPTAGLHFTEQLLEDVRKKGVHLAFITLHVGLGTFRPVNVENIEEHDM 227

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLET-ATTEDGIINPWSGFTNIFITP 299
           H+E   +   TAQ LN VK++GGRI++VGTTS R LET A+  DG     SG+T+IFI P
Sbjct: 228 HAEFYQMSEQTAQLLNDVKAQGGRIIAVGTTSTRTLETIASRHDGTFVAESGWTDIFIYP 287

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           GY FRA+D +++NFHLPKSTL+MLVSA  G E   + Y+ A+   YRF+S+GD  L+
Sbjct: 288 GYTFRAIDGIITNFHLPKSTLIMLVSALAGREHVLRAYEEAVKERYRFFSFGDAMLI 344


>gi|94311875|ref|YP_585085.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Cupriavidus
           metallidurans CH34]
 gi|166216742|sp|Q1LJ60|QUEA_RALME RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|93355727|gb|ABF09816.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Cupriavidus
           metallidurans CH34]
          Length = 353

 Score =  270 bits (691), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 157/363 (43%), Positives = 213/363 (58%), Gaps = 19/363 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVH----PNLSCPLVISDHLVSDLPAFLNSN 56
           + + +FDF LPP  IA   +  R ++RL+VV      + S  + + D   SD+  +LN +
Sbjct: 2   LTLSDFDFPLPPELIAQSALPDRSASRLLVVERTAPEDTSEAVRLVDRAFSDILEYLNPD 61

Query: 57  DAIVFNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILH 116
           D +VFN+T+VI A     RF         I   +   V  ++     R SK   +G +LH
Sbjct: 62  DLLVFNDTRVIKA-----RFFGHKPSGGRIEVLVERVVDTHTVLAQVRASKTPVEGSLLH 116

Query: 117 FFSQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARD 176
             + D  +      +D++ T    L F    ++L   I   G +PLPPYI      DA D
Sbjct: 117 L-ADDAFAVTVGPRVDQFFT----LRFPEPALDL---IERYGRLPLPPYITHD--PDAYD 166

Query: 177 YVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTD 236
              YQT YA+  G+VAAPTAGLHF   L +RL + GI+  F+TLHVGAGTF PV+ E+  
Sbjct: 167 ETRYQTVYARNPGAVAAPTAGLHFDDALFARLDAAGIRRAFLTLHVGAGTFQPVRTENLS 226

Query: 237 DHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIF 296
           +H MHSE   I    A A+   ++RGGR+++VGTTSLR LE+A  EDG +   SG T+IF
Sbjct: 227 EHKMHSEWYAISPELADAVRETRARGGRVIAVGTTSLRALESAAAEDGTLEAGSGDTDIF 286

Query: 297 ITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           ITPGY FR VD L++NFHLPKSTLLMLVSA  G+E  +  Y+HA+   YRF+SYGD  LL
Sbjct: 287 ITPGYAFRIVDALITNFHLPKSTLLMLVSALAGVEAIRDAYRHAVDARYRFFSYGDAMLL 346

Query: 357 FQK 359
            ++
Sbjct: 347 TRR 349


>gi|153816035|ref|ZP_01968703.1| hypothetical protein RUMTOR_02281 [Ruminococcus torques ATCC 27756]
 gi|317500973|ref|ZP_07959183.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Lachnospiraceae bacterium 8_1_57FAA]
 gi|331089128|ref|ZP_08338031.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Lachnospiraceae bacterium 3_1_46FAA]
 gi|145846682|gb|EDK23600.1| hypothetical protein RUMTOR_02281 [Ruminococcus torques ATCC 27756]
 gi|316897676|gb|EFV19737.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Lachnospiraceae bacterium 8_1_57FAA]
 gi|330405905|gb|EGG85431.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Lachnospiraceae bacterium 3_1_46FAA]
          Length = 341

 Score =  270 bits (691), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 148/357 (41%), Positives = 203/357 (56%), Gaps = 16/357 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +F +DLP   IA  P+  R S+RLM V         I  H+ S++  +LN  D +V
Sbjct: 1   MKTSDFYYDLPEELIAQDPLEDRSSSRLMTVDKETG---KIGHHVFSEIIDYLNEGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+TKVI A+L G +         +I   L  R + + W    +P +  K G  + F   
Sbjct: 58  INDTKVIPARLIGAK----EETGAKIEVLLLKRGADDVWETLVKPGRKAKPGTRISF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G   L   V+D  + G  L+ F   GI  E  +  +G +PLPPYI  +     +D   Y
Sbjct: 111 -GDGLLVGEVVDIVDEGNRLIHFEYEGI-FEEILDQLGQMPLPPYITHQ----LQDKNRY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
            T YA+  GS AAPTAGLHFT  LL ++   G+ +  VTLHVG GTF PVKV+D ++H M
Sbjct: 165 NTVYAEHSGSAAAPTAGLHFTPELLRKIEEKGVDIARVTLHVGLGTFRPVKVDDVENHHM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   I+   A+ +N  K RGGR++ VGTTS R +E+A  E+G +   SG+T IFI PG
Sbjct: 225 HSEFYMINEEAAEKINHAKDRGGRVICVGTTSCRTIESAADENGRLKACSGWTEIFIYPG 284

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           YRF+ +D L++NFHLP+STL+MLVSA  G E     Y+ A+   YRF+S+GD  L+ 
Sbjct: 285 YRFKTLDCLITNFHLPESTLIMLVSALAGKEHVMAAYEEAVKERYRFFSFGDAMLIL 341


>gi|153810635|ref|ZP_01963303.1| hypothetical protein RUMOBE_01019 [Ruminococcus obeum ATCC 29174]
 gi|149833031|gb|EDM88113.1| hypothetical protein RUMOBE_01019 [Ruminococcus obeum ATCC 29174]
          Length = 341

 Score =  270 bits (690), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 152/356 (42%), Positives = 205/356 (57%), Gaps = 16/356 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +F +DLP   IA  P+  R S+RL+  H ++        H  +D+  +L+  D +V
Sbjct: 1   MKTSDFYYDLPKELIAQDPLEDRSSSRLL--HLSMQDGSFEHRHF-TDILDYLHKGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+TKVI A+L G    H       I   L  R   + W    +P K  + G  + F   
Sbjct: 58  INDTKVIPARLYG----HKEETGAVIEILLLKRRENDIWECLVKPGKKARPGAKITF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G   L+  +ID  + G  L+ F   GI  E  +  +G +PLPPYI  K     +D   Y
Sbjct: 111 -GDGILKGEIIDVVDEGNRLIQFHYDGI-FEEILDQLGEMPLPPYITHK----LKDKNRY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL ++  +G+K+  VTLHVG GTF PVKV+D + H M
Sbjct: 165 QTVYAKNDGSAAAPTAGLHFTRELLKQVEDMGVKIAHVTLHVGLGTFRPVKVDDVEQHHM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   ++   A+ +N  K  GGR++SVGTTS R LE+AT E+GI+   SG+T IFI PG
Sbjct: 225 HSEFYMVEEDQAKLINDTKKNGGRVISVGTTSCRTLESATDENGILQAGSGWTEIFIYPG 284

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           Y F+ +D L++NFHLP+STLLMLVSA  G E     Y+ A+   YRF+S+GD  L+
Sbjct: 285 YHFKMIDGLITNFHLPESTLLMLVSALAGKEHIMAAYEEAVKERYRFFSFGDAMLI 340


>gi|269213885|ref|ZP_06158238.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Neisseria
           cinerea ATCC 14685]
 gi|269145271|gb|EEZ71689.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Neisseria
           cinerea ATCC 14685]
          Length = 356

 Score =  270 bits (690), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 153/356 (42%), Positives = 211/356 (59%), Gaps = 18/356 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FDF LP   IA  P   R S+RL+V  P++     + D +  DLP ++   D +V
Sbjct: 11  MDISDFDFTLPEKLIAQHPPEVRGSSRLLVALPDMP----LQDRVFGDLPDYVGEGDVLV 66

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FNNTKV+ A+L G +          I   +   +  ++   + R SK  K G  L F   
Sbjct: 67  FNNTKVMKARLFGQKDSG-----GRIEALIERVLDSHTALAHIRSSKSPKPGMGLVF--- 118

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
             +  + A ++++   G +  +    G  +   +   G +PLPPYI  +R  DA D   Y
Sbjct: 119 --EGGIRAVMVER--AGALFCLRFEGGQTVYELLEQNGHLPLPPYI--ERAADADDDSRY 172

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK QG+VAAPTAGLHFT  LL RL   G++   VTLHVGAGTF PV+VE  ++H M
Sbjct: 173 QTVYAKYQGAVAAPTAGLHFTEELLLRLKGKGVETAEVTLHVGAGTFQPVRVEKIEEHKM 232

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   + + T  A+ + K+RG ++ +VGTTS+R LE+A  E G +    G T+IFITPG
Sbjct: 233 HSEWFEVPSETVAAVEAAKARGNKVWAVGTTSMRALESAARETGHLKDGQGDTDIFITPG 292

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           YRF  VD L++NFHLPKSTLLMLVSAF G+   + +Y+HA+   YRF+SYGD  +L
Sbjct: 293 YRFNVVDRLVTNFHLPKSTLLMLVSAFSGMGHIRAVYRHAVEREYRFFSYGDAMIL 348


>gi|228960691|ref|ZP_04122335.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           thuringiensis serovar pakistani str. T13001]
 gi|228798997|gb|EEM45970.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           thuringiensis serovar pakistani str. T13001]
          Length = 352

 Score =  270 bits (690), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 151/353 (42%), Positives = 209/353 (59%), Gaps = 15/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M +  FDF LP   IA  P+  R+++RLMV+         I     +D+ ++L+  D +V
Sbjct: 1   MDINLFDFHLPEELIAQVPLEDRETSRLMVLDRETGD---IEHKHFTDILSYLHEGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N TKV+ A+L+GV+          I   L  +   + W    +P+K +K+G ++ F   
Sbjct: 58  LNETKVMPARLHGVK----EDTGAHIEVLLLKQEEGDKWETLVKPAKRVKEGTVISF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G+ +L+AT     + G   L FS  GI  E  +  +G +PLPPYI  K  ++ RD   Y
Sbjct: 111 -GEGKLKATCTGTADQGGRQLEFSYDGIFYE-ILDELGEMPLPPYI--KETLEDRDRYRY 166

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL +L   G+++ F+TLHVG GTF PV  +  ++H M
Sbjct: 167 QTVYAKEIGSAAAPTAGLHFTEELLEKLKQKGVQLAFITLHVGLGTFRPVSADTIEEHHM 226

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLET-ATTEDGIINPWSGFTNIFITP 299
           H+E   +   TA  LN VK  GGRI++VGTTS R LET AT  DG +   SG+T+IF+ P
Sbjct: 227 HAEYYHMSEETAALLNRVKENGGRIITVGTTSTRTLETIATDHDGKLCAASGWTDIFMYP 286

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           GY F+A+D L++NFHLPKSTL+MLVSAF   +     Y  A+   YRF+S+GD
Sbjct: 287 GYEFKAIDGLITNFHLPKSTLIMLVSAFANRDNVLHAYNEAVKEKYRFFSFGD 339


>gi|157150443|ref|YP_001450865.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus gordonii str. Challis substr. CH1]
 gi|157075237|gb|ABV09920.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus gordonii str. Challis substr. CH1]
          Length = 342

 Score =  270 bits (689), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 158/353 (44%), Positives = 209/353 (59%), Gaps = 17/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +FDF LP   IA  P+  RD++RL+VV  +       SD     +   L   DA+V
Sbjct: 1   MNTADFDFHLPEELIAQTPLEKRDASRLLVVDRSSGE---FSDQHFDSIIDQLQPGDALV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NNT+V+ A+L G +          +   L      + W V A+P+K +K G  + F   
Sbjct: 58  MNNTRVLPARLYGEK----PGTGGHVELLLLKNTEGDQWEVLAKPAKRLKVGAQVSF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL ATV+D+   G  ++ F   GI LE   SL G +PLPPYI  K     R    Y
Sbjct: 111 -GDGRLTATVVDELEHGGRIVRFDYQGIFLEVLESL-GEMPLPPYIHEKLADRER----Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL+++ + G+K+ ++TLHVG GTF PV V++ DDH M
Sbjct: 165 QTVYAKENGSAAAPTAGLHFTKELLAQIEAKGVKLVYLTLHVGLGTFRPVSVDNLDDHEM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           HSE   +    A  L  VK+ G R+++VGTTS+R LET   +  G I   SG+TNIFI P
Sbjct: 225 HSEFYTLSEEAAATLREVKANGHRVIAVGTTSIRTLETIGNKFKGDIQADSGWTNIFIKP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           GY+++ VD   +NFHLPKSTL+MLVSAF G + T K Y+HAI+  YRF+S+GD
Sbjct: 285 GYQWQIVDAFSTNFHLPKSTLVMLVSAFAGRDLTLKAYEHAIAERYRFFSFGD 337


>gi|157693175|ref|YP_001487637.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           pumilus SAFR-032]
 gi|167016403|sp|A8FFR0|QUEA_BACP2 RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|157681933|gb|ABV63077.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           pumilus SAFR-032]
          Length = 342

 Score =  270 bits (689), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 150/357 (42%), Positives = 212/357 (59%), Gaps = 17/357 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M ++ FDFDLP   IA  P+  RD++RLMV++        ++    S +  +  + D +V
Sbjct: 1   MKLELFDFDLPERLIAQVPLEKRDASRLMVLNKQTG---EVTHDTFSQITDYFQTGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NNT+V+ A+L G++         ++   L  +   + W    +P+K +KKG ++ F   
Sbjct: 58  LNNTRVLPARLFGMK----EDTGAKVELLLLKQEEGDKWETLVKPAKRVKKGTVITF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL+A   ++   G   + F  +GI  E   SL G +PLPPYI  K  +D R+   Y
Sbjct: 111 -GDGRLQAVCTEELEHGGRKVEFQYTGIFYEVLESL-GEMPLPPYI--KEQLDDRER--Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT Y+K  GS AAPTAGLHFT+ LL  L   G+ + F+TLHVG GTF PV  +  ++H M
Sbjct: 165 QTVYSKEVGSAAAPTAGLHFTNELLDALKEKGVHIAFITLHVGLGTFRPVSADRIEEHEM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLET-ATTEDGIINPWSGFTNIFITP 299
           H+E   ++  TA  LN V+  GGRI+SVGTTS R LET A+  DG     SG+T+IFI P
Sbjct: 225 HAEFYEMNEETAAELNRVRKEGGRIISVGTTSTRTLETIASAHDGEFKASSGWTSIFIYP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           GY F+A+D +++NFHLPKS+L+MLVSA  G E   K Y  A+   YRF+S+GD  L+
Sbjct: 285 GYTFKAIDGMITNFHLPKSSLIMLVSALAGREHVLKAYNEAVKEEYRFFSFGDAMLI 341


>gi|307709512|ref|ZP_07645968.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus mitis SK564]
 gi|307619731|gb|EFN98851.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus mitis SK564]
          Length = 342

 Score =  270 bits (689), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 156/358 (43%), Positives = 211/358 (58%), Gaps = 17/358 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +FDF LP   IA  P+  RD+++L++V+ +         H + D+   L   DA+V
Sbjct: 1   MNTADFDFHLPEELIAQTPLEKRDASKLLIVNRDTGEMQDKHFHSIIDM---LEPGDALV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+V+ A+L G +          +   L    S + W V A+P+K +K G  + F   
Sbjct: 58  MNDTRVLPARLYGQK----EETGGHVELLLLKNTSGDEWEVLAKPAKRLKVGTRVSF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL A V ++   G  ++ F   GI LE   SL G +PLPPYI  K  +D R+   Y
Sbjct: 111 -GDGRLSAVVTEELTHGGRIVRFEYQGIFLEVLESL-GEMPLPPYIHEK--LDDRER--Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL+ + + G+ + ++TLHVG GTF PV V++ D+H M
Sbjct: 165 QTVYAKESGSAAAPTAGLHFTKELLAEIQAKGVHLVYLTLHVGLGTFRPVSVDNLDEHEM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           HSE   +    A  L SVK  GGRI++VGTTS+R LET  ++ DG I   SG+TNIFI P
Sbjct: 225 HSEFYQLSEEAASTLRSVKENGGRIIAVGTTSIRTLETVGSKFDGQIQADSGWTNIFIKP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           GY ++ VD   +NFHLPKSTL+MLVSAF G E     Y HAI   YRF+S+GD   ++
Sbjct: 285 GYEWKVVDAFSTNFHLPKSTLVMLVSAFAGRELVLDAYHHAIQEHYRFFSFGDAMFIY 342


>gi|298492038|ref|YP_003722215.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase ['Nostoc
           azollae' 0708]
 gi|298233956|gb|ADI65092.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase ['Nostoc
           azollae' 0708]
          Length = 372

 Score =  270 bits (689), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 154/365 (42%), Positives = 214/365 (58%), Gaps = 23/365 (6%)

Query: 6   FDFDLPPSRIALRPVFPRDSARLMVVH-PNLSCPLVISDHLVSDLPAFLNSNDAIVFNNT 64
           +D++LPP  IA  P  PRD++RL+VV+ PN+   +   +H+  DLP  L   D +V NNT
Sbjct: 18  YDYELPPELIAQNPAVPRDTSRLLVVNSPNIGEEIPALNHIFRDLPDLLQPGDLLVMNNT 77

Query: 65  KVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQD-GQ 123
           KV+ A+L G +         E+   L     PN W    +P K  K G  + F     G+
Sbjct: 78  KVMPARLYGRKLTG-----AEVEVLLLEEKQPNCWLALVKPGKHFKVGTKIIFGGNKLGR 132

Query: 124 SR---------LEATVIDK-WNTGEILLVFSISGIE-LERQISLVGTIPLPPYIARKRPI 172
           ++         L A V+DK   TG  LL F +     L + +   G IPLPPYI      
Sbjct: 133 AKHPATTNDDELMAIVVDKDTATGGRLLQFDLPEYRSLVQVLENFGEIPLPPYITGSTAA 192

Query: 173 DARDYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKV 232
           D +    YQT YA+  G++AAPTAGLHFT  LL +L + GI   F+TLHVG GTF PV+V
Sbjct: 193 DEQ----YQTVYAQQTGAIAAPTAGLHFTPELLEKLRARGINQAFLTLHVGVGTFRPVEV 248

Query: 233 EDTDDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGF 292
           ED   H MHSE   +++ T + + + K+ GGRI+++GTT +R LE A  + G + P+ G 
Sbjct: 249 EDVTTHQMHSEWIEVNSATVEEIRATKAAGGRIIAIGTTVVRALEGA-AQSGDLQPYVGK 307

Query: 293 TNIFITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
            N+FI PGY+++ V+ L++NFHLP+S+LLMLVSA  G E   K+YQ AI+  YRFYS+GD
Sbjct: 308 VNLFIYPGYQWQVVEGLITNFHLPRSSLLMLVSALIGRERLLKIYQQAIASQYRFYSFGD 367

Query: 353 TSLLF 357
             L+ 
Sbjct: 368 AMLIL 372


>gi|329769851|ref|ZP_08261250.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Gemella
           sanguinis M325]
 gi|328837905|gb|EGF87529.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Gemella
           sanguinis M325]
          Length = 342

 Score =  270 bits (689), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 151/357 (42%), Positives = 209/357 (58%), Gaps = 17/357 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M ++EFDF LP   IA  P+  RD+++L+ ++   +        + SD+  + N  D +V
Sbjct: 1   MKLEEFDFYLPEELIAQTPLLKRDTSKLLTINRKENT---YEHKVFSDIIDYFNPGDTLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NNT+V+ A+L G +          I   L      N W    +P+K IK G I+ F   
Sbjct: 58  LNNTRVMPARLYGQK----KDTGAAIEVLLLKNKEHNMWECLVKPAKRIKVGSIVSF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G   +EA  +   + G     F   GI  ER +  +GT+PLPPYI  +     R    Y
Sbjct: 111 -GDGIMEAECVKVLDDGFRYFEFKYEGIFQER-LDELGTMPLPPYIKERLTDKER----Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT Y+K  GS AAPTAGLHFT+ LL ++   G+ + ++TLHVG GTF PV VE+ +DH M
Sbjct: 165 QTVYSKEVGSSAAPTAGLHFTNELLDKIKQKGVNIVYLTLHVGLGTFRPVSVENIEDHDM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLET-ATTEDGIINPWSGFTNIFITP 299
           HSE   +D  TA  +N  K  GGR+ SVGTTS R LET A   DG I P SG+TNIFI P
Sbjct: 225 HSEYYTLDEETANVINETKKNGGRVFSVGTTSTRTLETIARDNDGEIVPASGWTNIFIYP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           G+ F+ VD L++NFHLPKS+L+MLVSAF   E+  ++Y+ A+ + YRF+S+GD  ++
Sbjct: 285 GFEFKCVDGLITNFHLPKSSLIMLVSAFYNREKVLELYKIAVENKYRFFSFGDAMII 341


>gi|126700420|ref|YP_001089317.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           difficile 630]
 gi|123363078|sp|Q183N9|QUEA_CLOD6 RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|115251857|emb|CAJ69692.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase (Queuosine
           biosynthesis protein QueA) [Clostridium difficile]
          Length = 341

 Score =  269 bits (688), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 146/356 (41%), Positives = 202/356 (56%), Gaps = 16/356 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M  ++F FDLP   IA  P+  R S+RLMV+         I   +  D+  +LN  D +V
Sbjct: 1   MKTRDFKFDLPQELIAQVPIEDRASSRLMVLDKETGN---IEHKVFRDIIEYLNPGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NNT+VI A+L G +         +I   L  R   ++W    +P K  K G    F   
Sbjct: 58  LNNTRVIPARLIGEKL----ETGGKIEFLLLKRTEEDTWQALVKPGKRAKVGTKFSF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  +L   V+D  + G  ++ F   GI  E  +  +G +PLPPYI  +  +D ++   Y
Sbjct: 111 -GNGKLIGEVVDLSDEGSRIIKFHYDGI-FEEILDELGNMPLPPYITAR--LDEKER--Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT Y+K  GS AAPTAGLHFT  LL+++   G+ + FVTLHVG GTF PVKVED  +H M
Sbjct: 165 QTVYSKHNGSAAAPTAGLHFTEELLNKIKEKGVDIAFVTLHVGLGTFRPVKVEDVLNHKM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   +    A  +N  K  G  ++ VGTTS R +E+A  EDG +   SG+T IFI PG
Sbjct: 225 HSEYYMVSQEAADKINRAKENGKNVICVGTTSCRTIESACNEDGKMKETSGWTEIFIYPG 284

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           Y+F+ +D L++NFHLP+STL+MLVSA CG +     Y  A+   YRF+S+GD  ++
Sbjct: 285 YKFKVLDKLITNFHLPESTLIMLVSAICGKDNVLNAYNEAVKERYRFFSFGDAMII 340


>gi|164687536|ref|ZP_02211564.1| hypothetical protein CLOBAR_01177 [Clostridium bartlettii DSM
           16795]
 gi|164603310|gb|EDQ96775.1| hypothetical protein CLOBAR_01177 [Clostridium bartlettii DSM
           16795]
          Length = 341

 Score =  269 bits (688), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 146/356 (41%), Positives = 205/356 (57%), Gaps = 16/356 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +F+FDLP   IA  P+  R S++LMV+         I   +  D+  +LN  D +V
Sbjct: 1   MKTSDFNFDLPEELIAQVPIKDRTSSKLMVLDKETGE---IEHRIFRDIIDYLNPGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+VI A+L G +         +I   L  R   ++W    +P K  K G    F   
Sbjct: 58  LNDTRVIPARLIGSKV----ETGGKIEFLLLKRTEDDTWETLVKPGKRAKIGARFSF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  +L A V+     G  ++ F  +GI  E  +  +G +PLPPYI  K  +D R+   Y
Sbjct: 111 -GDGKLIAEVVGMGEDGARIVKFEYNGI-FEEILDELGNMPLPPYITEK--LDERER--Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT Y+K  GS AAPTAGLHFT  LL+++   G+ + FVTLHVG GTF PVKV+D D+H M
Sbjct: 165 QTVYSKHNGSAAAPTAGLHFTEELLAKIKEKGVDLAFVTLHVGLGTFRPVKVDDVDNHQM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   +    A  +N  K+ G R++SVGTTS R +E+   E+GI+   SG+TNIFI PG
Sbjct: 225 HSEFYMVTQEAADKINKAKANGNRVISVGTTSTRTIESVADENGIVKATSGWTNIFIYPG 284

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           Y+++ +D L++NFHLP+STL+MLVS+  G E     Y  A+   YRF+S+GD   +
Sbjct: 285 YKWKVIDNLITNFHLPESTLIMLVSSLAGKEHVLNAYNEAVKERYRFFSFGDAMFI 340


>gi|303240766|ref|ZP_07327279.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase [Acetivibrio
           cellulolyticus CD2]
 gi|302591654|gb|EFL61389.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase [Acetivibrio
           cellulolyticus CD2]
          Length = 341

 Score =  269 bits (688), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 152/361 (42%), Positives = 206/361 (57%), Gaps = 26/361 (7%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V EF +DLP   IA  P+  R  +RLMVV         I   +  D+  +LN+ D +V
Sbjct: 1   MRVSEFFYDLPEELIAQEPLQDRKQSRLMVVDRKTG---EIEHRIFKDIIEYLNTGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKE-----ISCTLHMRVSPNSWSVYARPSKVIKKGDIL 115
            N+T+VI A+L G         EKE     I   L      + W V  +P +  K G   
Sbjct: 58  LNDTRVIPARLLG---------EKEDTGGKIEFVLLKNTGGDIWEVILKPGRRAKPGSRF 108

Query: 116 HFFSQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDAR 175
            F    G   L+A +ID    G  L+ F   G+  E+ +  VG +PLPPYI +K      
Sbjct: 109 VF----GNGELKAEIIDVVEEGNRLVRFEYEGV-FEQILDRVGIMPLPPYITKK----LE 159

Query: 176 DYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDT 235
           D   YQT Y+K +GS AAPTAGLHFT+ LL ++   GI++ +VTLHVG GTF PVKVE+ 
Sbjct: 160 DKERYQTVYSKHKGSAAAPTAGLHFTTELLEKIKEKGIEIAYVTLHVGLGTFRPVKVENI 219

Query: 236 DDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNI 295
            +H MHSE   +       +N+ +  GG+I++VGTTS R++ET   E G + P SG+T+I
Sbjct: 220 LEHKMHSEYYNLKEEDCNKINNTRKNGGKIIAVGTTSCRVIETIGDEFGALKPQSGWTDI 279

Query: 296 FITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSL 355
           FI PGY F+ VD L++NFHLP+STLLMLVSA  G +   K Y  A++  YRF+S+GD   
Sbjct: 280 FIYPGYNFKVVDKLITNFHLPESTLLMLVSALAGRDTIMKAYNEAVNEKYRFFSFGDAMF 339

Query: 356 L 356
           +
Sbjct: 340 I 340


>gi|306824944|ref|ZP_07458287.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus sp. oral taxon 071 str. 73H25AP]
 gi|304432771|gb|EFM35744.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus sp. oral taxon 071 str. 73H25AP]
          Length = 342

 Score =  269 bits (688), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 155/358 (43%), Positives = 212/358 (59%), Gaps = 17/358 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +FDF LP   IA  P+  RD+++L++V+           H + D+   L   DA+V
Sbjct: 1   MNTADFDFHLPEELIAQTPLEKRDASKLLIVNRETGEMQDKHFHSIIDM---LEPGDALV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+V+ A+L G +          +   L    S + W V A+P+K +K G  ++F   
Sbjct: 58  MNDTRVLPARLYGQK----EETGGHVELLLLKNTSGDEWEVLAKPAKRLKVGTRVNF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL A + ++   G  ++ F   GI LE   SL G +PLPPYI  K  +D R+   Y
Sbjct: 111 -GDGRLSAVITEELTHGGRIVRFEYQGIFLEVLESL-GEMPLPPYIHEK--LDDRER--Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL+ + + G+ + ++TLHVG GTF PV V++ D+H M
Sbjct: 165 QTVYAKESGSAAAPTAGLHFTKELLAEIQAKGVHLVYLTLHVGLGTFRPVSVDNLDEHEM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           HSE   +    A  L SVK  GGRI++VGTTS+R LET  ++ DG I   SG+TNIFI P
Sbjct: 225 HSEFYQLSEEAAATLRSVKEDGGRIIAVGTTSIRTLETIGSKFDGQIQADSGWTNIFIKP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           GY ++ VD   +NFHLPKSTL+MLVSAF G +     YQHAI   YRF+S+GD   ++
Sbjct: 285 GYEWKVVDAFSTNFHLPKSTLVMLVSAFAGRDLVLDAYQHAIQERYRFFSFGDAMFIY 342


>gi|67458722|ref|YP_246346.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Rickettsia
           felis URRWXCal2]
 gi|75536818|sp|Q4UMM7|QUEA_RICFE RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|67004255|gb|AAY61181.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Rickettsia
           felis URRWXCal2]
          Length = 367

 Score =  269 bits (687), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 146/388 (37%), Positives = 226/388 (58%), Gaps = 51/388 (13%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FDFDLP   IA  P   RD++ L++     + P+    + + D   +L   D +V
Sbjct: 1   MKLSDFDFDLPTELIAQYPASERDNSDLLIA---TTPPIKTKFYNIID---YLKEGDLLV 54

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FNN+KVI A+LN          E+ I+  L+ ++S +SWS +A+P++ +  GD   F+S 
Sbjct: 55  FNNSKVIKAKLN---------LERNITINLNQKLSDDSWSAFAKPARKLNIGD--EFYSD 103

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKR---------- 170
           + +      + +K+  GEI + F +  I +   +   G +PLP YI R +          
Sbjct: 104 NHK----VIITEKFAMGEIKVKFELDNISVFEFLDKYGEMPLPVYIRRSKRHGEEEESSD 159

Query: 171 -------------------PIDARDYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISI 211
                                D  D + YQT Y++I+GSVAAPTAGLHFT  +L +L + 
Sbjct: 160 EAISSQNPEIATESKRTPSNDDKLDSLRYQTIYSQIEGSVAAPTAGLHFTKEILDKLKAK 219

Query: 212 GIKVYFVTLHVGAGTFMPVKVEDTDDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTT 271
           G+++ FVTLHVGAGTF+PVK E+  +H +H+E   I   TA+ +N  K    RI++VGTT
Sbjct: 220 GVQIAFVTLHVGAGTFLPVKTENIHEHKIHTEYCSITPETAEIINKAKQERRRIIAVGTT 279

Query: 272 SLRLLETATTEDGIINPWSGFTNIFITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIE 331
           +LR LE++   +G++   S  T+IFITPG++F+  D+L++NFH PKSTL ML+ AF G +
Sbjct: 280 TLRTLESSCN-NGVVKAGSFETDIFITPGFKFQTTDMLLTNFHFPKSTLFMLICAFAGFK 338

Query: 332 ETKKMYQHAISHAYRFYSYGDTSLLFQK 359
           E  ++Y++AI    RF+SYGD ++L++K
Sbjct: 339 EMHELYKYAIKEKMRFFSYGDATVLYRK 366


>gi|157828160|ref|YP_001494402.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Rickettsia
           rickettsii str. 'Sheila Smith']
 gi|165932858|ref|YP_001649647.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Rickettsia
           rickettsii str. Iowa]
 gi|166216749|sp|A8GR69|QUEA_RICRS RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|189038875|sp|B0BWL5|QUEA_RICRO RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|157800641|gb|ABV75894.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Rickettsia
           rickettsii str. 'Sheila Smith']
 gi|165907945|gb|ABY72241.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Rickettsia
           rickettsii str. Iowa]
          Length = 365

 Score =  269 bits (687), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 149/387 (38%), Positives = 228/387 (58%), Gaps = 50/387 (12%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FDFDLP   IA  P   RD++ L++    ++ P+    + + D   +L   D +V
Sbjct: 1   MKLSDFDFDLPSELIAQYPSSERDNSDLLIA---VTPPIKTKFYNIID---YLKEGDLLV 54

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FNN+KVI AQLN           K I+  L+ ++S +SWS +A+P++ +   D  +F + 
Sbjct: 55  FNNSKVIKAQLN---------LGKNITINLNQKLSDDSWSAFAKPARKLHVNDEFYFDNH 105

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPI-------- 172
                 +  + +K   GEI + F ++ I +   ++  G +PLP YI R   +        
Sbjct: 106 ------KVIITEKLAMGEIKVKFKLNDISVFEFLNKYGEMPLPVYIRRSHSLCHPVATTT 159

Query: 173 DARDYVD--------------------YQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIG 212
            ++ Y++                    YQT Y++I+GSVAAPTAGLHFT ++L +L + G
Sbjct: 160 GSKTYLNNDWIPWSNHGMTNTQNDNDRYQTVYSQIEGSVAAPTAGLHFTKDILDKLKAEG 219

Query: 213 IKVYFVTLHVGAGTFMPVKVEDTDDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTS 272
           I+  F+TLHVGAGTF+PVK E+  +H MH+E   I   TA+ +N  K  G RI++VGTT+
Sbjct: 220 IQATFLTLHVGAGTFLPVKTENIHEHKMHTEYCSITPDTAEIINKAKQEGKRIIAVGTTT 279

Query: 273 LRLLETATTEDGIINPWSGFTNIFITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEE 332
           LR LE++   +GI+   S  T+IFITPG++F+  D+L++NFH PKSTL ML+ AF G +E
Sbjct: 280 LRTLESSCN-NGIVKAGSFKTDIFITPGFKFQTADMLLTNFHFPKSTLFMLICAFAGFKE 338

Query: 333 TKKMYQHAISHAYRFYSYGDTSLLFQK 359
             ++Y++AI  A RF+SYGD +LL +K
Sbjct: 339 MHELYKYAIKEAMRFFSYGDATLLCRK 365


>gi|291539017|emb|CBL12128.1| S-adenosylmethionine--tRNA ribosyltransferase-isomerase [Roseburia
           intestinalis XB6B4]
          Length = 345

 Score =  269 bits (687), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 153/356 (42%), Positives = 202/356 (56%), Gaps = 16/356 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M VK+F +DLP   IA  P+  R S+RLMV+  N      ++  +  D+  +L   D +V
Sbjct: 1   MDVKDFYYDLPQELIAQDPLKDRSSSRLMVLDKNTG---EVTHRVFKDITDYLRPGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NNTKVI A+L GV+       E +I   L  R   + W    +P K  K G  + F   
Sbjct: 58  INNTKVIPARLYGVK----EGTEAKIEILLLKRKENDIWETLVKPGKKCKVGTKISF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G   L   VID    G  L+ F   GI  E  +  +G +PLPPYI  +     +D   Y
Sbjct: 111 -GDGLLTGEVIDIVEEGNRLIQFHYDGI-FEEILDQLGQMPLPPYITHQ----LQDKNRY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL ++  +G+++  VTLHVG GTF PVK  D   H M
Sbjct: 165 QTVYAKYDGSAAAPTAGLHFTPELLKKVKEMGVEIAEVTLHVGLGTFRPVKETDVLKHHM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   I+   A  +N  K  G R+++VGTTS R LE A+ E+G +   SG+T IFI PG
Sbjct: 225 HSEFYRIEQSEADKINHAKETGHRVIAVGTTSTRTLEAASDENGFLRETSGWTEIFIYPG 284

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           YRF+ +D L++NFHLP+STL+MLVSA  G E     Y+ A+   YRF+S+GD  L+
Sbjct: 285 YRFKVIDSLITNFHLPESTLVMLVSALAGREHVLNAYEIAVQEKYRFFSFGDAMLI 340


>gi|296840698|ref|ZP_06863236.2| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Neisseria
           polysaccharea ATCC 43768]
 gi|296840202|gb|EFH24140.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Neisseria
           polysaccharea ATCC 43768]
          Length = 356

 Score =  269 bits (687), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 153/356 (42%), Positives = 211/356 (59%), Gaps = 18/356 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FDF LP   IA  P   R S+RL+V  P++     + D +  DLP ++   D +V
Sbjct: 11  MDISDFDFTLPEHLIAQHPPEVRGSSRLLVALPDMP----LQDRVFGDLPDYVGEGDVLV 66

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FNNTKV+ A+L G +          I   +   +  ++   + R SK  K    L F   
Sbjct: 67  FNNTKVMKARLFGQKDSG-----GRIEALIERVLDSHTALAHIRSSKSPKPDTKLIF--- 118

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
             +  +EA ++++   GE+  +   S   +   +   G +PLPPYI  +R  DA D   Y
Sbjct: 119 --EGGIEAVMLER--VGELFCLRFNSKQTVYELLEQNGHLPLPPYI--ERAADADDDSRY 172

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK QG+VAAPTAGLHFT  LL RL   G++   VTLHVGAGTF PV+VE  ++H M
Sbjct: 173 QTVYAKYQGAVAAPTAGLHFTEELLRRLKDKGVETAEVTLHVGAGTFQPVRVEKIEEHKM 232

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   + + T  A+ + K+RG ++ +VGTTS+R LE+A  E G +    G T+IFITPG
Sbjct: 233 HSEWFEVPSETVAAVGAAKARGNKVWAVGTTSMRALESAARETGHLKDGQGDTDIFITPG 292

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           YRF   D L++NFHLPKSTLLMLVSAF G+   + +Y+HA+   YRF+SYGD  +L
Sbjct: 293 YRFNVADRLITNFHLPKSTLLMLVSAFSGMGHIRAVYRHAVEREYRFFSYGDAMIL 348


>gi|240146016|ref|ZP_04744617.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Roseburia
           intestinalis L1-82]
 gi|257201829|gb|EEV00114.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Roseburia
           intestinalis L1-82]
 gi|291536123|emb|CBL09235.1| S-adenosylmethionine--tRNA ribosyltransferase-isomerase [Roseburia
           intestinalis M50/1]
          Length = 345

 Score =  269 bits (687), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 153/356 (42%), Positives = 202/356 (56%), Gaps = 16/356 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M VK+F +DLP   IA  P+  R S+RLMV+  N      ++  +  D+  +L   D +V
Sbjct: 1   MDVKDFYYDLPQELIAQDPLEDRSSSRLMVLDKNTG---EVTHRVFKDITDYLRPGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NNTKVI A+L GV+       E +I   L  R   + W    +P K  K G  + F   
Sbjct: 58  INNTKVIPARLYGVK----EGTEAKIEILLLKRKENDIWETLVKPGKKCKVGTKISF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G   L   VID    G  L+ F   GI  E  +  +G +PLPPYI  +     +D   Y
Sbjct: 111 -GDGLLTGEVIDIVEEGNRLIQFHYDGI-FEEILDQLGQMPLPPYITHQ----LQDKNRY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL ++  +G+++  VTLHVG GTF PVK  D   H M
Sbjct: 165 QTVYAKYDGSAAAPTAGLHFTPELLKKVKEMGVEIAEVTLHVGLGTFRPVKETDVLKHHM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   I+   A  +N  K  G R+++VGTTS R LE A+ E+G +   SG+T IFI PG
Sbjct: 225 HSEFYRIEQSEADKINHAKETGHRVIAVGTTSTRTLEAASDENGFLRETSGWTEIFIYPG 284

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           YRF+ +D L++NFHLP+STL+MLVSA  G E     Y+ A+   YRF+S+GD  L+
Sbjct: 285 YRFKVIDSLITNFHLPESTLVMLVSALAGREHVLNAYEIAVQEKYRFFSFGDAMLI 340


>gi|322392655|ref|ZP_08066115.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus peroris ATCC 700780]
 gi|321144647|gb|EFX40048.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus peroris ATCC 700780]
          Length = 342

 Score =  268 bits (686), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 153/358 (42%), Positives = 205/358 (57%), Gaps = 17/358 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +FDFDLP   IA  P+  RD++RL++V+          D     +   L   DA+V
Sbjct: 1   MNTNDFDFDLPEELIAQTPLEQRDASRLLIVNRKTGE---FQDRHFHSIIEMLEPGDALV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+V+ A+L+G +          +   L      + W V A+P+K +K G  + F   
Sbjct: 58  MNDTRVLPARLHGEK----EETGGHVELLLLKNTVGDEWEVLAKPAKRLKVGARVIF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL A V ++   G  ++ F   GI LE   SL G +PLPPYI  K     R    Y
Sbjct: 111 -GDGRLSAVVTEELTHGGRIVRFEYEGIFLEVLESL-GEMPLPPYIHEKLDDQER----Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL  +   G+ + ++TLHVG GTF PV V++ D+H M
Sbjct: 165 QTVYAKESGSAAAPTAGLHFTKELLEEIQQKGVHLVYLTLHVGLGTFRPVTVDNLDEHEM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           HSE   +    A  L  +K  GGR+++VGTTS+R LET  ++ DG I   SG+TNIFI P
Sbjct: 225 HSEFYQLSEEAAATLRQIKENGGRVIAVGTTSIRTLETIGSKFDGQIQADSGWTNIFIKP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           GY ++ VD   +NFHLPKSTL+MLVSAF G E   + YQHAI   YRF+S+GD   ++
Sbjct: 285 GYDWKVVDAFSTNFHLPKSTLVMLVSAFAGRELVLEAYQHAIEERYRFFSFGDAMFIY 342


>gi|225857051|ref|YP_002738562.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae P1031]
 gi|225724890|gb|ACO20742.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae P1031]
          Length = 342

 Score =  268 bits (686), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 155/358 (43%), Positives = 210/358 (58%), Gaps = 17/358 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +FDF LP   IA  P+  RD+++L++V+           H + D+   L   DA+V
Sbjct: 1   MNTADFDFHLPEELIAQTPLEKRDASKLLIVNRETGEMQDKHFHSIIDM---LEPGDALV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+V+ A+L G +          +   L    S + W V A+P+K +K G  + F   
Sbjct: 58  MNDTRVLPARLYGQKM----ETGGHVELLLLKNTSGDEWEVLAKPAKRLKVGTRISF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL A V ++   G  ++ F   GI LE   SL G +PLPPYI  K  +D R+   Y
Sbjct: 111 -GDGRLSAVVTEELTHGGRIVRFEYQGIFLEVLESL-GEMPLPPYIHEK--LDDRER--Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL+ + + G+ + ++TLHVG GTF PV V++ D+H M
Sbjct: 165 QTVYAKESGSAAAPTAGLHFTKELLAEIQAKGVHLVYLTLHVGLGTFRPVSVDNLDEHEM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           HSE   +    A  L SVK  GGR+++VGTTS+R LET  ++ DG I   SG+TNIFI P
Sbjct: 225 HSEFYQLSEEAAATLRSVKENGGRVIAVGTTSIRTLETIGSKFDGQIQADSGWTNIFIKP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           GY ++ VD   +NFHLPKSTL+MLVSAF G E     Y HAI   YRF+S+GD   ++
Sbjct: 285 GYEWKVVDAFSTNFHLPKSTLVMLVSAFAGRELVLDAYHHAIQEHYRFFSFGDAMFIY 342


>gi|304321743|ref|YP_003855386.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Parvularcula bermudensis HTCC2503]
 gi|303300645|gb|ADM10244.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Parvularcula bermudensis HTCC2503]
          Length = 356

 Score =  268 bits (686), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 152/365 (41%), Positives = 206/365 (56%), Gaps = 22/365 (6%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  FD+DLP  +IAL P   RD ARL++V PN          L++ L      +D ++
Sbjct: 1   MRVDLFDYDLPEEQIALVPPPERDGARLLIVPPNGP----FGHDLIAHLAEHFGPSDVLI 56

Query: 61  FNNTKVITAQLNGVRFCH---------INRREKEISCTLHMRVSPNSWSVYARPSKVIKK 111
            N+TKVI A L G+R            +      + C L  R     W  + RP+K ++ 
Sbjct: 57  LNDTKVIPATLAGMRPARDVGGGDPAGVGIDITLLKC-LEERDDGVRWQAFVRPAKRVRA 115

Query: 112 GDILHFFSQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRP 171
           GD +       +       + +    E +L   ++    +  +   GT+PLPPYIARKR 
Sbjct: 116 GDDIEIGPVTAR-------VKRREGAEAVLHIPLTPSAFQSFLYDHGTMPLPPYIARKRA 168

Query: 172 IDARDYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVK 231
           ++  D   YQT + K  GSVAAPTAGLHFT  LLS +   G  +  VTLHVGAGTF+P+ 
Sbjct: 169 VEVSDQDRYQTVFGKRPGSVAAPTAGLHFTDRLLSAIAERGATILRVTLHVGAGTFLPIT 228

Query: 232 VEDTDDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSG 291
             D  DH MHSE G +  P A+ L + K+ G RI  VGTT+LR++ETA  + G +  ++G
Sbjct: 229 AADCTDHRMHSEWGEVSPPVAERLRAAKAGGERITCVGTTALRIVETA-AQSGEVQAFAG 287

Query: 292 FTNIFITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYG 351
            T+IFITPG+ F+  D L++NFHLP+STLLMLVSAF G E     Y+ AI+  YRF+SYG
Sbjct: 288 ETDIFITPGFSFQCADRLLTNFHLPRSTLLMLVSAFSGRERILSAYREAINEGYRFFSYG 347

Query: 352 DTSLL 356
           D  LL
Sbjct: 348 DACLL 352


>gi|313201955|ref|YP_004040613.1| s-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Methylovorus sp. MP688]
 gi|312441271|gb|ADQ85377.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Methylovorus sp. MP688]
          Length = 351

 Score =  268 bits (686), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 153/359 (42%), Positives = 213/359 (59%), Gaps = 18/359 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M  ++FDF LP   IA  P   RD +RL+ +  N      I+DH   +LP FLN+ D ++
Sbjct: 1   MRTEDFDFFLPEELIAQFPAAERDGSRLLRLDGNSGA---IADHQFRELPQFLNAGDVLI 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FN+T+VI A+L G +          I   +   +  +    + R S+  K G     F  
Sbjct: 58  FNDTRVIKARLQGHK-----ESGGSIELLIERPLDTHRALAHIRASRSPKPGS--RIFIG 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
           DG   + A VI++ +  ++ L+       L   +   G +PLPPYI      DA D   Y
Sbjct: 111 DG---IPARVIERQD--DLFLIEVEHTTPLLDLLDQYGALPLPPYITHA--ADAEDDERY 163

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YA+  G+VAAPTAGLHF   +L RL + GI++ +VTLHVGAGTF PV+V+D  +H M
Sbjct: 164 QTVYARTPGAVAAPTAGLHFNQAMLDRLQTAGIQIAYVTLHVGAGTFQPVRVDDISEHRM 223

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSEI  +   T   +N+ ++ G +I +VGTT+LR LE+A    G +   SG T+IFITPG
Sbjct: 224 HSEIYTVPPATVDLINTARAAGHKITAVGTTALRALESA-ARSGALVAGSGETDIFITPG 282

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLFQK 359
           YRF+ V+ L++NFHLPKSTL+MLVSAF G+E  +  Y HAI+  YRF+SYGD  LL ++
Sbjct: 283 YRFQVVERLLTNFHLPKSTLMMLVSAFAGVENIRAAYAHAIASRYRFFSYGDAMLLERR 341


>gi|225854863|ref|YP_002736375.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae JJA]
 gi|225723833|gb|ACO19686.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae JJA]
          Length = 342

 Score =  268 bits (686), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 156/358 (43%), Positives = 210/358 (58%), Gaps = 17/358 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +FDF LP   IA  P+  RD+++L++V  N     +   H  S +   L   DA+V
Sbjct: 1   MNTADFDFHLPEELIAQTPLEKRDASKLLIV--NRETGEMQDKHFYS-IIDMLEPGDALV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+V+ A+L G +          +   L    S + W V A+P+K +K G  + F   
Sbjct: 58  MNDTRVLPARLYGQKV----ETGGHVELLLLKNTSGDEWEVLAKPAKRLKVGTRISF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL A V ++   G  ++ F   GI LE   SL G +PLPPYI  K  +D R+   Y
Sbjct: 111 -GDGRLSAVVTEELTHGGRIVRFEYQGIFLEVLESL-GEMPLPPYIHEK--LDDRE--RY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL+ + + G+ + ++TLHVG GTF PV V++ D+H M
Sbjct: 165 QTVYAKESGSAAAPTAGLHFTKELLAEIQAKGVHLVYLTLHVGLGTFRPVSVDNLDEHEM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           HSE   +    A  L SVK  GGR+++VGTTS+R LET  ++ DG I   SG+TNIFI P
Sbjct: 225 HSEFYQLSEEAAATLRSVKENGGRVIAVGTTSIRTLETIGSKFDGQIQADSGWTNIFIKP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           GY ++ VD   +NFHLPKSTL+MLVSAF G E     Y HAI   YRF+S+GD   ++
Sbjct: 285 GYEWKVVDAFSTNFHLPKSTLVMLVSAFAGRELVLDAYHHAIQEHYRFFSFGDAMFIY 342


>gi|160893033|ref|ZP_02073821.1| hypothetical protein CLOL250_00571 [Clostridium sp. L2-50]
 gi|156865116|gb|EDO58547.1| hypothetical protein CLOL250_00571 [Clostridium sp. L2-50]
          Length = 349

 Score =  268 bits (686), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 154/362 (42%), Positives = 207/362 (57%), Gaps = 26/362 (7%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +F +DLP   IA  P+  RD++RLMV+         I      D+ ++L   D +V
Sbjct: 9   MQLSDFYYDLPQELIAQDPLLKRDNSRLMVLDREEGT---IEHKHFYDVISYLKEGDCLV 65

Query: 61  FNNTKVITAQLNGVRFCHINRREKE-----ISCTLHMRVSPNSWSVYARPSKVIKKGDIL 115
            N+TKVI A+L G         EKE     I   L  R+   +W    +P K  + G  +
Sbjct: 66  INDTKVIPARLIG---------EKEGTGAAIEVLLLKRLDDCTWETLVKPGKKARVGARI 116

Query: 116 HFFSQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDAR 175
            F    G  +L   VID    G  ++ F   GI  E  +  +G +PLPPYI  K      
Sbjct: 117 IF----GGGKLVGEVIDIVEEGNRIVRFEYEGI-FEEILDELGQMPLPPYITHK----LE 167

Query: 176 DYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDT 235
           D   YQT YA+ +GS AAPTAGLHFT  LL  + + GIK+  VTLHVG GTF PVK ++ 
Sbjct: 168 DKNRYQTVYAEHEGSAAAPTAGLHFTKELLEEIKAKGIKIAHVTLHVGLGTFRPVKEDNI 227

Query: 236 DDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNI 295
            DH MHSE   ID   A+ +N  K  GGRI++VGTTS R LET   E+G++   SG+T+I
Sbjct: 228 LDHHMHSEFYVIDEKAAETINETKKNGGRIIAVGTTSTRTLETVADENGMLRACSGWTDI 287

Query: 296 FITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSL 355
           FI PGY+F+A+D L++NFHLP+STLLMLVSA    E+  + Y+ A+   YRF+S+GD  L
Sbjct: 288 FIYPGYKFKAIDGLITNFHLPESTLLMLVSALYSREKILEAYKVAVEERYRFFSFGDAML 347

Query: 356 LF 357
           + 
Sbjct: 348 IL 349


>gi|149002808|ref|ZP_01827734.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae SP14-BS69]
 gi|237650471|ref|ZP_04524723.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae CCRI 1974]
 gi|237821798|ref|ZP_04597643.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae CCRI 1974M2]
 gi|147759102|gb|EDK66096.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae SP14-BS69]
          Length = 342

 Score =  268 bits (686), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 155/358 (43%), Positives = 211/358 (58%), Gaps = 17/358 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +FDF LP   IA  P+  RD+++L++V+           H + D+   L   DA+V
Sbjct: 1   MNTADFDFHLPEELIAQTPLEKRDASKLLIVNRETGEMQDKHFHSIIDM---LEPGDALV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+V+ A+L G +          +   L    S + W V A+P+K +K G  + F   
Sbjct: 58  MNDTRVLPARLYGQKV----ETGGHVELLLLKNTSGDEWEVLAKPAKRLKVGTRISF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL A V ++   G  ++ F   GI LE   SL G +PLPPYI  K  +D R+   Y
Sbjct: 111 -GDGRLSAVVTEELTHGGRIVRFEYQGIFLEVLESL-GEMPLPPYIHEK--LDDRER--Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL+ + + G+ + ++TLHVG GTF PV V++ D+H M
Sbjct: 165 QTVYAKESGSAAAPTAGLHFTKELLAEIQAKGVHLVYLTLHVGLGTFRPVSVDNLDEHEM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           HSE   +    A  L SVK  GGR+++VGTTS+R LET  ++ DG I   SG+TNIFI P
Sbjct: 225 HSEFYQLSEEAAATLRSVKENGGRVIAVGTTSIRTLETIGSKFDGQIQADSGWTNIFIKP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           GY ++ VD   +NFHLPKSTL+MLVSAF G E     Y HAI   YRF+S+GD+  ++
Sbjct: 285 GYEWKVVDAFSTNFHLPKSTLVMLVSAFAGRELVLDAYHHAIQEHYRFFSFGDSMFIY 342


>gi|262283157|ref|ZP_06060924.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus sp. 2_1_36FAA]
 gi|262261409|gb|EEY80108.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus sp. 2_1_36FAA]
          Length = 342

 Score =  268 bits (686), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 156/354 (44%), Positives = 210/354 (59%), Gaps = 17/354 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +FDF LP   IA  P+  RD++RL++V  +       SD     +   L   DA+V
Sbjct: 1   MNTADFDFHLPEELIAQTPLEKRDASRLLIVDRSSGE---FSDQHFDSIIDQLQPGDALV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NNT+V+ A+L G +          +   L   +  + W V A+P+K +K G  + F   
Sbjct: 58  MNNTRVLPARLYGEK----PGTGGHVELLLLKNIEGDHWEVLAKPAKRLKVGAQVSF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL ATV+++   G  ++ F   GI LE   SL G +PLPPYI  K      D   Y
Sbjct: 111 -GDGRLTATVVEELEHGGRIVRFDYQGIFLEVLESL-GEMPLPPYIHEKLA----DRERY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL+++ + G+K+ ++TLHVG GTF PV V++ DDH M
Sbjct: 165 QTVYAKENGSAAAPTAGLHFTKELLAQIEAKGVKLVYLTLHVGLGTFRPVSVDNLDDHEM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           HSE   +    A  L  VK+ G R+++VGTTS+R LET   +  G I   SG+TNIFI P
Sbjct: 225 HSEFYTLSEEAAATLREVKANGHRVIAVGTTSIRTLETIGNKFQGDIQADSGWTNIFIKP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDT 353
           GY+++ VD   +NFHLPKSTL+MLVSAF G + T K Y+HAI+  YRF+S+GD 
Sbjct: 285 GYQWQIVDAFSTNFHLPKSTLVMLVSAFAGRDLTLKAYEHAIAERYRFFSFGDA 338


>gi|257870720|ref|ZP_05650373.1| queuosine biosynthesis protein [Enterococcus gallinarum EG2]
 gi|257804884|gb|EEV33706.1| queuosine biosynthesis protein [Enterococcus gallinarum EG2]
          Length = 343

 Score =  268 bits (685), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 157/357 (43%), Positives = 209/357 (58%), Gaps = 17/357 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           +  ++FDF+LP   IA  P+  R S+RL+VV         + D    D+   L   DA+V
Sbjct: 2   LTTEDFDFELPEELIAQTPLSDRSSSRLLVVDRESGA---MEDKRFYDIIDELAPGDALV 58

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+V+ A++ G +          +   L   +  +SW    +P+K  K G  + F   
Sbjct: 59  MNDTRVLPARIYGEKI----ETGAHLEILLLNNIEGDSWETLIKPAKRAKVGTKITF--- 111

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RLEA V  +   G  ++ FS  GI LE   SL G +PLPPYI  +      D   Y
Sbjct: 112 -GDGRLEAVVEKELEHGGRIIRFSYDGIFLEILESL-GEMPLPPYIKER----LEDPDRY 165

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL ++   G+K+ ++TLHVG GTF PV V++  DH M
Sbjct: 166 QTVYAKENGSAAAPTAGLHFTPELLKKIADKGVKLVYLTLHVGLGTFRPVSVDNIADHEM 225

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           HSE   +    A  LN V++ GG+IV+VGTTS+R LET  T+ DG I   SG+T+IFITP
Sbjct: 226 HSEFYRLTEEAAAQLNDVRANGGKIVAVGTTSIRTLETIGTKFDGDIKADSGWTSIFITP 285

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           GY+F+ V    +NFHLPKSTL+MLVSAF G + T + YQHAI   YRF+S+GD   L
Sbjct: 286 GYQFKVVQAFSTNFHLPKSTLVMLVSAFAGRDLTLEAYQHAIDERYRFFSFGDAMFL 342


>gi|301794456|emb|CBW36890.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae INV104]
          Length = 342

 Score =  268 bits (685), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 154/358 (43%), Positives = 210/358 (58%), Gaps = 17/358 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +FDF LP   IA  P+  RD+++L++V+        + D     +   L   DA+V
Sbjct: 1   MNTADFDFHLPEELIAQTPLEKRDASKLLIVNRETGE---MQDKHFHSIINMLEPGDALV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+V+ A+L G +          +   L    S + W V A+P+K +K G  + F   
Sbjct: 58  MNDTRVLPARLYGQKV----ETGGHVELLLLKNTSGDEWEVLAKPAKRLKVGTRISF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL A V ++   G  ++ F   GI LE   SL G +PLPPYI  K  +D R+   Y
Sbjct: 111 -GDGRLSAVVTEELTHGGRIVRFEYQGIFLEVLESL-GEMPLPPYIHEK--LDDRE--RY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL+ + + G+ + ++TLHVG GTF PV V++ D+H M
Sbjct: 165 QTVYAKESGSAAAPTAGLHFTKELLAEIQAKGVHLVYLTLHVGLGTFRPVSVDNLDEHEM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           HSE   +    A  L SVK  GGR+++VGTTS+R LET  ++ DG I   SG+TNIFI P
Sbjct: 225 HSEFYQLSEEAAATLRSVKENGGRVIAVGTTSIRTLETIGSKFDGQIQADSGWTNIFIKP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           GY ++ VD   +NFHLPKSTL+MLVSAF G E     Y HAI   YRF+S+GD+  ++
Sbjct: 285 GYEWKVVDAFSTNFHLPKSTLVMLVSAFAGRELVLDAYHHAIQEHYRFFSFGDSMFIY 342


>gi|291519050|emb|CBK74271.1| S-adenosylmethionine--tRNA ribosyltransferase-isomerase
           [Butyrivibrio fibrisolvens 16/4]
          Length = 345

 Score =  268 bits (685), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 146/356 (41%), Positives = 205/356 (57%), Gaps = 16/356 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M+VK+FD++LP   IA  P+  R ++RLMV+  +      I+     D+  +L   D +V
Sbjct: 1   MLVKDFDYELPEELIAQDPLEKRSNSRLMVLDKHTG---EIAHRHFYDIKEYLRPGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NNT+VI A+L G R     +    +   L  R+S N W    +P K  + G  + F   
Sbjct: 58  INNTRVIPARLYGARVGSGGK----VEILLLKRISDNQWECLVKPGKKARPGMEISF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G   L   ++D  + G  ++ F+  GI  E  +  +G +PLPPYI  K     +D   Y
Sbjct: 111 -GDGLLIGKIVDIVDEGNRIIEFTYEGI-FEEILDKLGEMPLPPYITHK----LQDRDRY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL  + ++G+++  VTLHVG GTF PVK ++  DH M
Sbjct: 165 QTVYAKFDGSAAAPTAGLHFTPELLEEVKAMGVRIAEVTLHVGLGTFRPVKEDEVLDHHM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   I       +N  K+ GGR++SVGTTS R LE+A      ++P SG+T IFI PG
Sbjct: 225 HSEYYEITQEACDIINETKANGGRVISVGTTSTRTLESAAEAGKPLSPKSGWTQIFIYPG 284

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           Y F+ +D L++NFHLP+STL+MLVSA  G E     Y+ A+   YRF+S+GD  ++
Sbjct: 285 YEFKVIDCLITNFHLPQSTLIMLVSALAGREHVLAAYKKAVEEKYRFFSFGDAMMI 340


>gi|255101975|ref|ZP_05330952.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           difficile QCD-63q42]
 gi|255307843|ref|ZP_05352014.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           difficile ATCC 43255]
          Length = 341

 Score =  268 bits (685), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 146/356 (41%), Positives = 201/356 (56%), Gaps = 16/356 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +F FDLP   IA  P+  R S+RLMV+         I   +  D+  +LN  D +V
Sbjct: 1   MKTSDFKFDLPQELIAQVPIEDRASSRLMVLDKETGN---IEHKVFRDIIEYLNPGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NNT+VI A+L G +         +I   L  R   ++W    +P K  K G    F   
Sbjct: 58  LNNTRVIPARLIGEKL----ETGGKIEFLLLKRTEEDTWQALVKPGKRAKVGTKFSF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  +L   V+D  + G  ++ F   GI  E  +  +G +PLPPYI  +  +D ++   Y
Sbjct: 111 -GNGKLIGEVVDLSDEGSRIIKFHYDGI-FEEILDELGNMPLPPYITAR--LDEKER--Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT Y+K  GS AAPTAGLHFT  LL+++   G+ + FVTLHVG GTF PVKVED  +H M
Sbjct: 165 QTVYSKHNGSAAAPTAGLHFTEELLNKIKEKGVDIAFVTLHVGLGTFRPVKVEDVLNHKM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   +    A  +N  K  G  ++ VGTTS R +E+A  EDG +   SG+T IFI PG
Sbjct: 225 HSEYYMVSQEAADKINRAKENGKNVICVGTTSCRTIESACNEDGKMKETSGWTEIFIYPG 284

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           Y+F+ +D L++NFHLP+STL+MLVSA CG +     Y  A+   YRF+S+GD  ++
Sbjct: 285 YKFKVLDKLITNFHLPESTLIMLVSAICGKDNVLNAYNEAVKERYRFFSFGDAMII 340


>gi|254976399|ref|ZP_05272871.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           difficile QCD-66c26]
 gi|255093785|ref|ZP_05323263.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           difficile CIP 107932]
 gi|255315536|ref|ZP_05357119.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           difficile QCD-76w55]
 gi|255518199|ref|ZP_05385875.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           difficile QCD-97b34]
 gi|255651315|ref|ZP_05398217.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           difficile QCD-37x79]
 gi|260684379|ref|YP_003215664.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           difficile CD196]
 gi|260688038|ref|YP_003219172.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           difficile R20291]
 gi|306521147|ref|ZP_07407494.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           difficile QCD-32g58]
 gi|260210542|emb|CBA65071.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           difficile CD196]
 gi|260214055|emb|CBE06218.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           difficile R20291]
          Length = 341

 Score =  268 bits (685), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 146/356 (41%), Positives = 201/356 (56%), Gaps = 16/356 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +F FDLP   IA  P+  R S+RLMV+         I   +  D+  +LN  D +V
Sbjct: 1   MKTSDFKFDLPQELIAQVPIEDRASSRLMVLDKETGN---IEHKVFRDIIEYLNPGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NNT+VI A+L G +         +I   L  R   ++W    +P K  K G    F   
Sbjct: 58  LNNTRVIPARLIGEKL----ETGGKIEFLLLKRTEEDTWQALVKPGKRAKVGTKFSF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  +L   V+D  + G  ++ F   GI  E  +  +G +PLPPYI  +  +D ++   Y
Sbjct: 111 -GNGKLIGEVVDLSDEGSRIIKFLYDGI-FEEILDELGNMPLPPYITAR--LDEKER--Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT Y+K  GS AAPTAGLHFT  LL+++   G+ + FVTLHVG GTF PVKVED  +H M
Sbjct: 165 QTVYSKHNGSAAAPTAGLHFTEELLNKIKEKGVDIAFVTLHVGLGTFRPVKVEDVLNHKM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   +    A  +N  K  G  ++ VGTTS R +E+A  EDG +   SG+T IFI PG
Sbjct: 225 HSEYYMVSQEAADKINRAKENGNNVICVGTTSCRTIESACNEDGKMKETSGWTEIFIYPG 284

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           Y+F+ +D L++NFHLP+STL+MLVSA CG +     Y  A+   YRF+S+GD  ++
Sbjct: 285 YKFKVLDKLITNFHLPESTLIMLVSAICGKDNVLNAYNEAVKERYRFFSFGDAMII 340


>gi|255283315|ref|ZP_05347870.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bryantella
           formatexigens DSM 14469]
 gi|255266169|gb|EET59374.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bryantella
           formatexigens DSM 14469]
          Length = 341

 Score =  268 bits (685), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 149/356 (41%), Positives = 205/356 (57%), Gaps = 16/356 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +F FDLP   IA  P+  R S+RL+V+         +  H+  ++  +LN  D +V
Sbjct: 1   MKTSDFYFDLPQELIAQDPLEDRSSSRLLVLDRRTGQ---MEHHIFKEIVHYLNPGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+TKVI A+L G +       + +I   L  R   + W    +P K  K G  + F   
Sbjct: 58  INDTKVIPARLFGSKVG----TDAKIEILLLKRREGDVWETLVKPGKKAKPGTQISF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G   L   V++    G  L+ F+  GI  E  +  +G +PLPPYI  +     +D   Y
Sbjct: 111 -GDGILMGEVLEVAEDGNRLIRFTYEGI-FEEILDRLGQMPLPPYITHQ----LKDKNRY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL  +   G+ +  VTLHVG GTF PVKVE+   H M
Sbjct: 165 QTVYAKHDGSAAAPTAGLHFTPELLQEIRDKGVNIAHVTLHVGLGTFRPVKVEEVTQHHM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   ++   A+ +N  K+ GG+I+ VGTTS R +E+A  E+GI++  SG+T+IFI PG
Sbjct: 225 HSEFYMVEEEQAELINRTKANGGKIICVGTTSCRTIESAADENGILHAGSGWTDIFIYPG 284

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           YRF+ +D L++NFHLP+STLLMLVSA  G E  +K Y  A+   YRF+S+GD  L+
Sbjct: 285 YRFKILDELITNFHLPESTLLMLVSALAGKENIEKAYAEAVKERYRFFSFGDAMLI 340


>gi|257081115|ref|ZP_05575476.1| queuosine biosynthesis protein [Enterococcus faecalis E1Sol]
 gi|257415434|ref|ZP_05592428.1| queuosine biosynthesis protein [Enterococcus faecalis AR01/DG]
 gi|256989145|gb|EEU76447.1| queuosine biosynthesis protein [Enterococcus faecalis E1Sol]
 gi|257157262|gb|EEU87222.1| queuosine biosynthesis protein [Enterococcus faecalis ARO1/DG]
          Length = 343

 Score =  268 bits (684), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 155/353 (43%), Positives = 210/353 (59%), Gaps = 17/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           +  ++FDFDLP   IA  P+  R S+RL+VV+        + D    D+   L   DA+V
Sbjct: 2   LSTEDFDFDLPEELIAQTPLKDRASSRLLVVNKETGA---MEDKHFHDILDELQPGDALV 58

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NNT+V+ A+L G +          +   L      ++W    +P+K  K G  + F   
Sbjct: 59  MNNTRVLPARLYGEK----PETGGHLEVLLLTNTEGDTWETLIKPAKRAKVGTEIQF--- 111

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL+A V ++   G  ++ F   GI LE   SL G +PLPPYI  K  +D  D   Y
Sbjct: 112 -GDGRLKAVVKEELEHGGRIIEFKYDGIFLEILESL-GEMPLPPYI--KERLDDPDR--Y 165

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YA+  GS AAPTAGLHFT  LL  + + G+ + ++TLHVG GTF PV V++ ++H M
Sbjct: 166 QTVYAEENGSAAAPTAGLHFTKELLEEIKAKGVHLVYLTLHVGLGTFRPVSVDNIEEHHM 225

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           HSE   +    A+ LN V+  GGRIV+VGTTS+R LET  T+ +G I   SG+T+IFITP
Sbjct: 226 HSEFYRLTEEAAKQLNEVRQAGGRIVAVGTTSIRTLETIGTKFNGEIQADSGWTDIFITP 285

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           GY+F+ V+   +NFHLPKSTL+MLVSAF G + T   YQHAI   YRF+S+GD
Sbjct: 286 GYQFKVVEAFSTNFHLPKSTLVMLVSAFAGKDLTLAAYQHAIEEKYRFFSFGD 338


>gi|149011658|ref|ZP_01832854.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae SP19-BS75]
 gi|147764089|gb|EDK71021.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae SP19-BS75]
          Length = 342

 Score =  268 bits (684), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 155/358 (43%), Positives = 211/358 (58%), Gaps = 17/358 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +FDF LP   IA  P+  RD+++L++V+           H + D+   L   DA+V
Sbjct: 1   MNTADFDFHLPEELIAQTPLEKRDASKLLIVNRETGEMQDKHFHSIIDM---LEPGDALV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+V+ A+L G +          +   L    S + W V A+P+K +K G  + F   
Sbjct: 58  MNDTRVLPARLYGQKV----ETGGHVELLLLKNTSGDEWEVLAKPAKRLKVGTRISF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL A V ++   G  ++ F   GI LE   SL G +PLPPYI  K  +D R+   Y
Sbjct: 111 -GDGRLSAVVTEELTHGGRIVRFEYQGIFLEVLESL-GEMPLPPYIHEK--LDDRER--Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL+ + + G+ + ++TLHVG GTF PV V++ D+H M
Sbjct: 165 QTVYAKESGSAAAPTAGLHFTKELLAEIQAKGVHLVYLTLHVGLGTFRPVSVDNLDEHEM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           HSE   +    A  L SVK  GGR+++VGTTS+R LET  ++ DG I   SG+TNIFI P
Sbjct: 225 HSEFYQLSEEAAATLRSVKKNGGRVIAVGTTSIRTLETIGSKFDGQIQADSGWTNIFIKP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           GY ++ VD   +NFHLPKSTL+MLVSAF G E     Y HAI   YRF+S+GD+  ++
Sbjct: 285 GYEWKVVDAFSTNFHLPKSTLVMLVSAFAGRELVLDAYHHAIQEHYRFFSFGDSMFIY 342


>gi|182684374|ref|YP_001836121.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae CGSP14]
 gi|182629708|gb|ACB90656.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae CGSP14]
          Length = 346

 Score =  268 bits (684), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 155/358 (43%), Positives = 210/358 (58%), Gaps = 17/358 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +FDF LP   IA  P+  RD+++L++V+           H + D+   L   DA+V
Sbjct: 5   MNTADFDFHLPEELIAQTPLEKRDASKLLIVNRETGEMQDKHFHSIIDM---LEPGDALV 61

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+V+ A+L G +          +   L    S + W V A+P+K +K G  + F   
Sbjct: 62  MNDTRVLPARLYGQKV----ETGGHVELLLLKNTSGDEWEVLAKPAKRLKVGTRISF--- 114

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL A V ++   G  ++ F   GI LE   SL G +PLPPYI  K  +D R+   Y
Sbjct: 115 -GDGRLSAVVTEELTHGGRIVRFEYQGIFLEVLESL-GEMPLPPYIHEK--LDDRE--RY 168

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL+ + + G+ + ++TLHVG GTF PV V++ D+H M
Sbjct: 169 QTVYAKESGSAAAPTAGLHFTKELLAEIQAKGVHLVYLTLHVGLGTFRPVSVDNLDEHEM 228

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           HSE   +    A  L SVK  GGR+++VGTTS+R LET  ++ DG I   SG+TNIFI P
Sbjct: 229 HSEFYQLSEEAAATLRSVKENGGRVIAVGTTSIRTLETIGSKFDGQIQADSGWTNIFIKP 288

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           GY ++ VD   +NFHLPKSTL+MLVSAF G E     Y HAI   YRF+S+GD   ++
Sbjct: 289 GYEWKVVDAFSTNFHLPKSTLVMLVSAFAGRELVLDAYHHAIQEHYRFFSFGDAMFIY 346


>gi|148989540|ref|ZP_01820899.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae SP6-BS73]
 gi|149007314|ref|ZP_01830972.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae SP18-BS74]
 gi|149019372|ref|ZP_01834734.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae SP23-BS72]
 gi|168493320|ref|ZP_02717463.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae CDC3059-06]
 gi|221232156|ref|YP_002511309.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae ATCC 700669]
 gi|303254571|ref|ZP_07340675.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae BS455]
 gi|303259012|ref|ZP_07344991.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae SP-BS293]
 gi|303261696|ref|ZP_07347643.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae SP14-BS292]
 gi|303264365|ref|ZP_07350285.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae BS397]
 gi|303265836|ref|ZP_07351733.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae BS457]
 gi|303268169|ref|ZP_07353968.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae BS458]
 gi|307127015|ref|YP_003879046.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae 670-6B]
 gi|147761118|gb|EDK68086.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae SP18-BS74]
 gi|147925083|gb|EDK76164.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae SP6-BS73]
 gi|147931242|gb|EDK82221.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae SP23-BS72]
 gi|183576547|gb|EDT97075.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae CDC3059-06]
 gi|220674617|emb|CAR69180.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae ATCC 700669]
 gi|301802157|emb|CBW34894.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae INV200]
 gi|302598539|gb|EFL65581.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae BS455]
 gi|302637276|gb|EFL67764.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae SP14-BS292]
 gi|302639955|gb|EFL70411.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae SP-BS293]
 gi|302642248|gb|EFL72596.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae BS458]
 gi|302644571|gb|EFL74821.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae BS457]
 gi|302646177|gb|EFL76404.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae BS397]
 gi|306484077|gb|ADM90946.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae 670-6B]
 gi|332074739|gb|EGI85213.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae GA17545]
          Length = 342

 Score =  268 bits (684), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 155/358 (43%), Positives = 210/358 (58%), Gaps = 17/358 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +FDF LP   IA  P+  RD+++L++V+           H + D+   L   DA+V
Sbjct: 1   MNTADFDFHLPEELIAQTPLEKRDASKLLIVNRETGEMQDKHFHSIIDM---LEPGDALV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+V+ A+L G +          +   L    S + W V A+P+K +K G  + F   
Sbjct: 58  MNDTRVLPARLYGQKV----ETGGHVELLLLKNTSGDEWEVLAKPAKRLKVGTRISF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL A V ++   G  ++ F   GI LE   SL G +PLPPYI  K  +D R+   Y
Sbjct: 111 -GDGRLSAVVTEELTHGGRIVRFEYQGIFLEVLESL-GEMPLPPYIHEK--LDDRER--Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL+ + + G+ + ++TLHVG GTF PV V++ D+H M
Sbjct: 165 QTVYAKESGSAAAPTAGLHFTKELLAEIQAKGVHLVYLTLHVGLGTFRPVSVDNLDEHEM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           HSE   +    A  L SVK  GGR+++VGTTS+R LET  ++ DG I   SG+TNIFI P
Sbjct: 225 HSEFYQLSEEAAATLRSVKENGGRVIAVGTTSIRTLETIGSKFDGQIQADSGWTNIFIKP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           GY ++ VD   +NFHLPKSTL+MLVSAF G E     Y HAI   YRF+S+GD   ++
Sbjct: 285 GYEWKVVDAFSTNFHLPKSTLVMLVSAFAGRELVLDAYHHAIQEHYRFFSFGDAMFIY 342


>gi|251798373|ref|YP_003013104.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Paenibacillus sp. JDR-2]
 gi|247545999|gb|ACT03018.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Paenibacillus sp. JDR-2]
          Length = 348

 Score =  268 bits (684), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 152/360 (42%), Positives = 212/360 (58%), Gaps = 15/360 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  FDF+LP   IA  P+  R ++RL+ ++        I+    +DL  ++N+ D +V
Sbjct: 1   MNVDWFDFELPEHLIAQTPLADRTASRLLALNKETGE---IAHRTFTDLAEYMNAGDVLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NNT+VI A+L GV+         +I   L  ++  + W   A+P+K IK G  L F   
Sbjct: 58  LNNTRVIPARLTGVK----PDTGAKIELLLLKQLEGDRWETLAKPAKRIKVGSELWFGDN 113

Query: 121 -DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVD 179
             G+  L A V D+ + G   + F   GI  +  +  +G +PLPPYI  K  ++ R+   
Sbjct: 114 GSGEPLLRAIVEDEGDMGGRTIRFRYEGI-FQELLDRLGEMPLPPYI--KERLEERER-- 168

Query: 180 YQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHI 239
           YQT YAK +GS AAPTAGLHFT   L +L+  G+K+ ++TLHVG GTF P+ V+  ++H 
Sbjct: 169 YQTVYAKHEGSAAAPTAGLHFTKEFLQQLVDKGVKLAYITLHVGLGTFRPMSVDKVEEHE 228

Query: 240 MHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLET--ATTEDGIINPWSGFTNIFI 297
           MHSE   +D   A  +N  KS G RI++VGTTS R LET  A  E G I   +G+T+IFI
Sbjct: 229 MHSEYYELDEQNAVIINEAKSSGARIIAVGTTSSRTLETVAARFEGGPIEACNGWTDIFI 288

Query: 298 TPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
            PGY F+ VD L++NFHLPKSTL+MLVSA  G E   K Y  A+   YRF+S+GD   ++
Sbjct: 289 FPGYNFKLVDALLTNFHLPKSTLVMLVSALAGREAIMKAYGEAVREEYRFFSFGDAMFIY 348


>gi|260438605|ref|ZP_05792421.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Butyrivibrio crossotus DSM 2876]
 gi|292809196|gb|EFF68401.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Butyrivibrio crossotus DSM 2876]
          Length = 341

 Score =  268 bits (684), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 146/356 (41%), Positives = 206/356 (57%), Gaps = 16/356 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M +K F++DLP   IA  P+  R S+RLMV+H +      I   +  D+  +LN  D +V
Sbjct: 1   MDLKAFNYDLPEELIAQDPLEDRSSSRLMVLHKDTG---RIEHKIFRDIIDYLNPGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+TKVI A+L G++          I   L  R + + W    +P K  + G  + F   
Sbjct: 58  INDTKVIPARLMGIK----EDTGAAIEVLLLKRNADDVWECLVKPGKKARTGARIVF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G+  L   ++D    G  ++ F   GI  E  +  +G +PLPPYI  K     +D   Y
Sbjct: 111 -GEGLLVGEIVDVIEDGNRMIKFHYEGI-FEEILDKLGQMPLPPYITHK----LQDKNRY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK +GS AAPTAGLHFT  LL ++   G+ V  +TLHVG GTF PVKV+  ++H M
Sbjct: 165 QTVYAKNEGSAAAPTAGLHFTKELLEKIKEKGVNVVSITLHVGLGTFRPVKVDKIEEHHM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           H+E   I    A  +N  ++ GGR+++VGTTS R LE+A  +DG I   SG T+IFI PG
Sbjct: 225 HTETFNISKEAADTINRTRAAGGRVIAVGTTSCRTLESAAADDGTIPARSGDTDIFIYPG 284

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           Y+F+A+D L++NFHLP+STL+MLVSA  G +     Y+ A+   YRF+S+GD   +
Sbjct: 285 YKFKAIDCLITNFHLPESTLIMLVSALAGRDNIMNAYETAVKERYRFFSFGDAMFI 340


>gi|292670916|ref|ZP_06604342.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Selenomonas
           noxia ATCC 43541]
 gi|292647537|gb|EFF65509.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Selenomonas
           noxia ATCC 43541]
          Length = 343

 Score =  268 bits (684), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 152/360 (42%), Positives = 216/360 (60%), Gaps = 18/360 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FD+DLP  +IA  P  PRDS+RLMV++P       I  H    L  FL   D ++
Sbjct: 1   MDISDFDYDLPQEQIAQVPAEPRDSSRLMVLNPKERT---IQHHYFYQLEDFLKKGDVLI 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FN+T+VI A+L G R         ++   L  ++  N W V  +P K  + G ++ F  +
Sbjct: 58  FNDTRVIPARLIGER----EHTGGKVEIFLLHQMDKNHWEVLVKPGKKARIGTVISFGEE 113

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
                L   +ID+ + G  ++ F  +G+  E  +  +GT+PLPPYI         D   Y
Sbjct: 114 -----LSCEIIDRTDFGGRIVRFIYNGV-FEEILDRLGTMPLPPYIHET----LEDRERY 163

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT Y +++GS AAPTAGLHFT  L+ RL   G++  F+TLHVG GTF PV V+  +DH+M
Sbjct: 164 QTVYNRVKGSAAAPTAGLHFTEALMERLREKGVQFGFITLHVGLGTFRPVHVDVVEDHVM 223

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           H E   I   TA+ + + K  G R++SVGTTS+R LE A    GII   SG+T+IFI PG
Sbjct: 224 HREFYSIPPETAELVQTAKKEGRRVISVGTTSIRTLEAAVASAGIIAAGSGWTDIFIYPG 283

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLFQKR 360
           Y+F+ VD +++NFHLPKSTL+MLVSAF G + T + Y+ A+   YRF+S+GD +++ Q R
Sbjct: 284 YQFKVVDAVITNFHLPKSTLIMLVSAFAGRDFTLEAYRTAVEERYRFFSFGD-AMMIQMR 342


>gi|315645788|ref|ZP_07898909.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Paenibacillus vortex V453]
 gi|315278549|gb|EFU41863.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Paenibacillus vortex V453]
          Length = 343

 Score =  267 bits (683), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 150/359 (41%), Positives = 213/359 (59%), Gaps = 18/359 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  +DF+LP   IA  P+  R S+RL+ ++        I+    +D+   LN+ D +V
Sbjct: 1   MNVDLYDFELPEQLIAQTPLLDRSSSRLLTLNKESGQ---INHQTFADIIDSLNAGDTLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+TKVI A+L G +     + E      L   +  + W    +P K +KKG+++ F   
Sbjct: 58  LNDTKVIPARLFGEKEDTGAKAE----VLLLKSMGQDRWEALVKPGKKLKKGNVISF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  +L+A + ++   G   L FS  GI  +  +  +G +PLPPYI  K  +D RD   Y
Sbjct: 111 -GDGKLKAVIEEEGEMGARTLSFSYKGI-FQEILDELGQMPLPPYI--KEKLDDRDR--Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK +GS AAPTAGLHFT  LL ++ + G+ + F+TLHVG GTF P+ V+  +DH+M
Sbjct: 165 QTVYAKHEGSAAAPTAGLHFTEALLEQIRAKGVDIAFITLHVGLGTFRPMSVDVVEDHVM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGI-INPWSGFTNIFIT 298
           H E   +   TA  LN  K RGGR+++VGTTS R LET  ++ +G  +   SG+T+IFI 
Sbjct: 225 HEEYYSLSQETADLLNETKRRGGRVIAVGTTSCRTLETVGSQMNGEPLRESSGWTSIFIY 284

Query: 299 PGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           PGY F  VD L++NFHLPKSTL+MLVSA  G E   K Y+ A+   YRF+S+GD   ++
Sbjct: 285 PGYSFTVVDALITNFHLPKSTLVMLVSALAGREHIMKAYKEAVEDKYRFFSFGDAMFIY 343


>gi|194397598|ref|YP_002038064.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae G54]
 gi|226713852|sp|B5E5S4|QUEA_STRP4 RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|194357265|gb|ACF55713.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae G54]
          Length = 342

 Score =  267 bits (683), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 155/358 (43%), Positives = 210/358 (58%), Gaps = 17/358 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +FDF LP   IA  P+  RD+++L++V+           H + D+   L   DA+V
Sbjct: 1   MNTADFDFHLPEELIAQTPLEKRDASKLLIVNRETGEMQDKHFHSIIDM---LEPGDALV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+V+ A+L G +          +   L    S + W V A+P+K +K G  + F   
Sbjct: 58  MNDTRVLPARLYGQKV----ETGGHVELLLLKNTSGDXWEVLAKPAKRLKVGTRISF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL A V ++   G  ++ F   GI LE   SL G +PLPPYI  K  +D R+   Y
Sbjct: 111 -GDGRLSAVVTEELTHGGRIVRFEYQGIFLEVLESL-GEMPLPPYIHEK--LDDRER--Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL+ + + G+ + ++TLHVG GTF PV V++ D+H M
Sbjct: 165 QTVYAKESGSAAAPTAGLHFTKELLAEIQAKGVHLVYLTLHVGLGTFRPVSVDNLDEHEM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           HSE   +    A  L SVK  GGR+++VGTTS+R LET  ++ DG I   SG+TNIFI P
Sbjct: 225 HSEFYQLSEEAAATLRSVKENGGRVIAVGTTSIRTLETIGSKFDGQIQADSGWTNIFIKP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           GY ++ VD   +NFHLPKSTL+MLVSAF G E     Y HAI   YRF+S+GD   ++
Sbjct: 285 GYEWKVVDAFSTNFHLPKSTLVMLVSAFAGRELVLDAYHHAIQEHYRFFSFGDAMFIY 342


>gi|169832445|ref|YP_001694851.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae Hungary19A-6]
 gi|238688427|sp|B1ICL6|QUEA_STRPI RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|168994947|gb|ACA35559.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae Hungary19A-6]
          Length = 342

 Score =  267 bits (683), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 155/358 (43%), Positives = 210/358 (58%), Gaps = 17/358 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +FDF LP   IA  P+  RD+++L++V+           H + D+   L   DA+V
Sbjct: 1   MNTADFDFHLPEELIAQTPLEKRDASKLLIVNRETGEMQDKHFHSIIDM---LEPGDALV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+V+ A+L G +          +   L    S + W V A+P+K +K G  + F   
Sbjct: 58  MNDTRVLPARLYGQKV----ETGGHVELLLLKNTSGDEWEVLAKPAKRLKVGTRISF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL A V ++   G  ++ F   GI LE   SL G +PLPPYI  K  +D R+   Y
Sbjct: 111 -GDGRLSAVVTEELTHGGRIVRFEYQGIFLEVLESL-GEMPLPPYIHEK--LDDRER--Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL+ + + G+ + ++TLHVG GTF PV V++ D+H M
Sbjct: 165 QTVYAKESGSAAAPTAGLHFTKELLAEIQAKGVHLVYLTLHVGLGTFRPVSVDNLDEHEM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           HSE   +    A  L SVK  GGR+++VGTTS+R LET  ++ DG I   SG+TNIFI P
Sbjct: 225 HSEFYQLSEEAAATLRSVKKNGGRVIAVGTTSIRTLETIGSKFDGQIQADSGWTNIFIKP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           GY ++ VD   +NFHLPKSTL+MLVSAF G E     Y HAI   YRF+S+GD   ++
Sbjct: 285 GYEWKVVDAFSTNFHLPKSTLVMLVSAFAGRELVLDAYHHAIQEHYRFFSFGDAMFIY 342


>gi|225859181|ref|YP_002740691.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae 70585]
 gi|225720571|gb|ACO16425.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae 70585]
          Length = 342

 Score =  267 bits (683), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 154/358 (43%), Positives = 209/358 (58%), Gaps = 17/358 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +FDF LP   IA  P+  RD+++L++V+        + D     +   L   DA+V
Sbjct: 1   MNTADFDFHLPEELIAQTPLEKRDASKLLIVNRETGE---MQDKHFHSIINMLEPGDALV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+V+ A+L G +          +   L    S + W V A+P+K +K G  + F   
Sbjct: 58  MNDTRVLPARLYGQKV----ETGGHVELLLLKNTSGDEWEVLAKPAKRLKVGTRISF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL A V ++   G  ++ F   GI LE   SL G +PLPPYI  K  +D R+   Y
Sbjct: 111 -GDGRLSAVVTEELTHGGRIVRFEYQGIFLEVLESL-GEMPLPPYIHEK--LDDRE--RY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL+ + + G+ + ++TLHVG GTF PV V++ D+H M
Sbjct: 165 QTVYAKESGSAAAPTAGLHFTKELLAEIQAKGVHLVYLTLHVGLGTFRPVSVDNLDEHEM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           HSE   +    A  L SVK  GGR+++VGTTS+R LET  ++ DG I   SG+TNIFI P
Sbjct: 225 HSEFYQLSEEAAATLRSVKKNGGRVIAVGTTSIRTLETIGSKFDGQIQADSGWTNIFIKP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           GY ++ VD   +NFHLPKSTL+MLVSAF G E     Y HAI   YRF+S+GD   ++
Sbjct: 285 GYEWKVVDAFSTNFHLPKSTLVMLVSAFAGRELVLDAYHHAIQEHYRFFSFGDAMFIY 342


>gi|253574939|ref|ZP_04852279.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Paenibacillus sp. oral taxon 786 str. D14]
 gi|251845985|gb|EES73993.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Paenibacillus sp. oral taxon 786 str. D14]
          Length = 353

 Score =  267 bits (683), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 151/359 (42%), Positives = 211/359 (58%), Gaps = 19/359 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  +DF+LP   IA  P+  R ++RL+ ++        I  H  SD+  +L   D +V
Sbjct: 12  MNVDLYDFELPEELIAQTPLAERTASRLLTLNKQTG---EIRHHKFSDILDYLQPGDTLV 68

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+VI A+L G++     + E      L   +  + W    +P K +K G ++ F  +
Sbjct: 69  LNDTRVIPARLFGIKEGTGAKAE----VLLLKNLGEDRWEALVKPGKKLKTGSVIVFGDE 124

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
                L ATV  + + GE +L F+  GI     +  +G +PLPPYI  K  +D R+   Y
Sbjct: 125 -----LRATVESEGDMGERVLRFAYEGI-FNEILDRLGQMPLPPYIKEK--LDDRE--RY 174

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT Y+K +GS AAPTAGLHFT  LL ++ + G+ + FVTLHVG GTF P+ V+  +DH+M
Sbjct: 175 QTVYSKHEGSAAAPTAGLHFTEELLEQVRAKGVTIAFVTLHVGLGTFRPMSVDRVEDHVM 234

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATT--EDGIINPWSGFTNIFIT 298
           H E   +   TA  LN  K+RGGR+++VGTTS R LET     E G I   SG+T IFI 
Sbjct: 235 HEEYYVLPQETADVLNETKARGGRVIAVGTTSARTLETVAKQCEGGPIVKSSGWTGIFIY 294

Query: 299 PGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           PGY+F  VD L++NFHLPKSTL+MLVSA  G E   + YQ AI+  YRF+S+GD   ++
Sbjct: 295 PGYQFGLVDALLTNFHLPKSTLVMLVSALAGRERILQAYQEAINLKYRFFSFGDAMFIY 353


>gi|322388742|ref|ZP_08062339.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus infantis ATCC 700779]
 gi|321140361|gb|EFX35869.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus infantis ATCC 700779]
          Length = 345

 Score =  267 bits (683), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 153/354 (43%), Positives = 207/354 (58%), Gaps = 17/354 (4%)

Query: 5   EFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIVFNNT 64
           +FDF LP   IA  P+  RD+++L++V+          D     +   L   DA+V N+T
Sbjct: 8   DFDFHLPEELIAQTPLEKRDASKLLMVNRKTGE---FQDRHFHSIIEMLEPGDALVMNDT 64

Query: 65  KVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQDGQS 124
           +V+ A+L+G +          +   L    + + W V A+P+K +K G  + F    G  
Sbjct: 65  RVLPARLHGQK----EETGGHVELLLLKNTAGDEWEVLAKPAKRLKVGTRVIF----GDG 116

Query: 125 RLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDYQTTY 184
           RL A V ++   G  ++ F   GI LE   SL G +PLPPYI  K  +D R+   YQT Y
Sbjct: 117 RLSAVVTEELTHGGRIVRFEYEGIFLEVLESL-GEMPLPPYIHEK--LDDRER--YQTVY 171

Query: 185 AKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIMHSEI 244
           AK  GS AAPTAGLHFT  LL  +   G+ + ++TLHVG GTF PV V++ D+H MHSE 
Sbjct: 172 AKESGSAAAPTAGLHFTKELLEEIQQKGVHLVYLTLHVGLGTFRPVSVDNLDEHEMHSEF 231

Query: 245 GFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITPGYRF 303
             +    A  L  VK  GGR+++VGTTS+R LET  ++ DG I   SG+TNIFI PGY +
Sbjct: 232 YQLSEEAAATLRQVKENGGRVIAVGTTSIRTLETIGSKFDGQIQADSGWTNIFIKPGYDW 291

Query: 304 RAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           + VD   +NFHLPKSTL+MLVSAF G E   K YQHAI   YRF+S+GD   ++
Sbjct: 292 KVVDAFSTNFHLPKSTLVMLVSAFAGRELVLKAYQHAIDEKYRFFSFGDAMFIY 345


>gi|312110089|ref|YP_003988405.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase [Geobacillus
           sp. Y4.1MC1]
 gi|311215190|gb|ADP73794.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase [Geobacillus
           sp. Y4.1MC1]
          Length = 342

 Score =  267 bits (683), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 156/362 (43%), Positives = 208/362 (57%), Gaps = 27/362 (7%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M +  FDFDLP   IA  P+  RD++RLMV+         I      ++ ++L   D +V
Sbjct: 1   MKIDLFDFDLPEELIAQTPLPNRDASRLMVLDKKTG---EIRHETFRNILSYLREGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKE-----ISCTLHMRVSPNSWSVYARPSKVIKKGDIL 115
            N+T+V+ A+L G         EKE     I   L  ++  + W    +P+K +K G  +
Sbjct: 58  LNDTRVMPARLYG---------EKENTGAHIEVLLLKQLEGDRWETLVKPAKRVKAGTKI 108

Query: 116 HFFSQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDAR 175
            F    G  RL+AT +D    G  +L FS  GI  E  +  +G +PLPPYI  K     R
Sbjct: 109 IF----GDGRLQATCVDTLEHGGRVLQFSYRGIFYE-VLEQLGEMPLPPYIKEKLADPER 163

Query: 176 DYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDT 235
               YQT YA+  GS AAPTAGLHFT  LL  + + G+ + F+TLHVG GTF PV VE+ 
Sbjct: 164 ----YQTVYAREIGSAAAPTAGLHFTEQLLDDIRAKGVHIAFITLHVGLGTFRPVNVENI 219

Query: 236 DDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLET-ATTEDGIINPWSGFTN 294
           ++H MH+E   +   TAQ LN  K +GGRI++VGTTS R LET A   DG     SG+T+
Sbjct: 220 EEHDMHAEFYQMTEATAQLLNETKRQGGRIIAVGTTSTRTLETIAARHDGTFVAESGWTD 279

Query: 295 IFITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTS 354
           IFI PGY F+A+D L++NFHLPKSTL+MLVSA  G E     Y  A+   YRF+S+GD  
Sbjct: 280 IFIYPGYEFKAIDGLVTNFHLPKSTLIMLVSALAGRENILHAYNVAVKERYRFFSFGDAM 339

Query: 355 LL 356
           L+
Sbjct: 340 LI 341


>gi|322389159|ref|ZP_08062720.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus parasanguinis ATCC 903]
 gi|321144064|gb|EFX39481.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus parasanguinis ATCC 903]
          Length = 342

 Score =  267 bits (683), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 156/353 (44%), Positives = 205/353 (58%), Gaps = 17/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +FDFDLP   IA  P+  RD+++L+++           D     +   L   DA+V
Sbjct: 1   MNTNDFDFDLPEELIAQTPLEKRDASKLLILDRKTGQ---FQDRHFDAILDELEPGDALV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NNT+V+ A+L+GV+          +   L      + W V A+P+K +K G  + F   
Sbjct: 58  MNNTRVLPARLHGVK----PETGGHVEFLLLKNTQDDCWEVLAKPAKRLKVGATVSF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL ATV ++   G  ++ F   GI LE   SL G +PLPPYI  K      D   Y
Sbjct: 111 -GDGRLTATVEEELEHGGRIVRFHYQGIFLEVLESL-GEMPLPPYIHEKLA----DRERY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL ++ + G+ + ++TLHVG GTF PV V++ +DH M
Sbjct: 165 QTVYAKENGSAAAPTAGLHFTQELLQKIEAKGVHLVYLTLHVGLGTFRPVSVDNLEDHEM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           HSE   +    A  L  VK+ G RIV+VGTTS+R LET   + DG I   SG+TNIFI P
Sbjct: 225 HSEFYQLSEEAAATLRQVKAAGKRIVAVGTTSIRTLETIGNKFDGDIQADSGWTNIFIKP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           GY ++ VD   +NFHLPKSTL+MLVSAF G E T + Y HAI   YRF+S+GD
Sbjct: 285 GYEWKVVDAFSTNFHLPKSTLVMLVSAFAGRELTLEAYHHAIQERYRFFSFGD 337


>gi|296876827|ref|ZP_06900875.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus parasanguinis ATCC 15912]
 gi|296432329|gb|EFH18128.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus parasanguinis ATCC 15912]
          Length = 342

 Score =  267 bits (683), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 156/353 (44%), Positives = 205/353 (58%), Gaps = 17/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +FDFDLP   IA  P+  RD+++L+++           D     +   L   DA+V
Sbjct: 1   MNTNDFDFDLPEELIAQTPLEKRDASKLLILDRKTGK---FQDRHFDAILDELEPGDALV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NNT+V+ A+L+GV+          +   L      + W V A+P+K +K G  + F   
Sbjct: 58  MNNTRVLPARLHGVK----PETGGHVEFLLLKNTQDDCWEVLAKPAKRLKVGATVSF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL ATV ++   G  ++ F   GI LE   SL G +PLPPYI  K      D   Y
Sbjct: 111 -GDGRLTATVEEELEHGGRIVRFHYQGIFLEVLESL-GEMPLPPYIHEKLA----DRERY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL ++ + G+ + ++TLHVG GTF PV V++ +DH M
Sbjct: 165 QTVYAKENGSAAAPTAGLHFTQELLQKIEAKGVHLVYLTLHVGLGTFRPVSVDNLEDHEM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           HSE   +    A  L  VK+ G RIV+VGTTS+R LET   + DG I   SG+TNIFI P
Sbjct: 225 HSEFYQLSEEAAATLRQVKAAGKRIVAVGTTSIRTLETIGNKFDGDIQADSGWTNIFIKP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           GY ++ VD   +NFHLPKSTL+MLVSAF G E T + Y HAI   YRF+S+GD
Sbjct: 285 GYEWKVVDAFSTNFHLPKSTLVMLVSAFAGRELTLEAYHHAIQERYRFFSFGD 337


>gi|86158966|ref|YP_465751.1| queuosine biosynthesis protein [Anaeromyxobacter dehalogenans
           2CP-C]
 gi|123498575|sp|Q2IKY3|QUEA_ANADE RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|85775477|gb|ABC82314.1| Queuosine biosynthesis protein [Anaeromyxobacter dehalogenans
           2CP-C]
          Length = 345

 Score =  267 bits (683), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 156/359 (43%), Positives = 210/359 (58%), Gaps = 14/359 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FDF LP   +A  PV PRD++RLMV+ P    P   +    +DLP  L   D +V
Sbjct: 1   MRLSDFDFALPEGLVAQAPVTPRDASRLMVLAPGEGAP---AHRGFADLPELLAPGDLLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FN+T+VI A+L G +      + + + C          W    + SK I++G +L F   
Sbjct: 58  FNDTRVIPARLLGHKAS--GGKVELLLCEPLEGGLGRRWRAMGQASKPIREGAVLAF--- 112

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
           DG   LEA V      G   +     G ELE  +   G IPLPPYI  +R  DA D   Y
Sbjct: 113 DG---LEARVDAVEGEGFYRVTLDRQGAELEAALGRAGRIPLPPYI--RRAPDAEDAARY 167

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT +A+  GS AAPTAGLHFT  LL+RL + G++   VTLHVG GTF+P++ +D D H M
Sbjct: 168 QTIWARAPGSAAAPTAGLHFTEPLLARLAARGVRRTAVTLHVGPGTFLPIRGDDLDAHRM 227

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           H E   +    A  L + ++RGGRIV+VGTTS+R LE+A   DG + P  G T +FI PG
Sbjct: 228 HGERYEVSPAAAAELAAARARGGRIVAVGTTSVRTLESA-WRDGEVAPGPGRTELFIRPG 286

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLFQK 359
           + FRAVD +++NFHLP+STLL+LV AF G       Y+ A++  YRF+SYGD  LL ++
Sbjct: 287 HPFRAVDAMVTNFHLPRSTLLVLVCAFGGQGRVLAAYREAVARGYRFFSYGDAMLLLRR 345


>gi|313904205|ref|ZP_07837584.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase [Eubacterium
           cellulosolvens 6]
 gi|313471007|gb|EFR66330.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase [Eubacterium
           cellulosolvens 6]
          Length = 344

 Score =  267 bits (683), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 147/356 (41%), Positives = 206/356 (57%), Gaps = 15/356 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +F++DLP   IA  P+  R ++R+M +         + D + +++   L   D +V
Sbjct: 3   MKTSDFNYDLPVELIAQDPLEDRSASRMMYMDKETG---ELKDEIFTEVIDHLREGDCLV 59

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+TKVI A+L G +          I   L  R   + W    RP K  K G  +  F +
Sbjct: 60  LNDTKVIPARLYGTK----KDTGALIEVLLLTRKQNDVWETLVRPGKKCKIGTEI-VFGE 114

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
           +G   +   VID    G   + FS  GI  E  +  +G +PLPPYI  K     +D   Y
Sbjct: 115 EG--LMTGKVIDVTEDGNRFIQFSYEGI-FEEILDRLGEMPLPPYIKHK----LQDKTMY 167

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
            T YAK  GS AAPTAGLHFT  LL ++ + G+K+  VTLHVG GTF PVKV+D   H M
Sbjct: 168 NTVYAKNDGSAAAPTAGLHFTKELLEKISAKGVKIAHVTLHVGLGTFRPVKVDDVTQHKM 227

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE+  ++   A+ +N  K+ GGR++ VGTTS R LE+AT E+GI+ P S +TNIFI PG
Sbjct: 228 HSELYIVEEDQAKIINDTKAAGGRVICVGTTSCRTLESATDENGILQPGSAWTNIFIYPG 287

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           Y F+ +D L++NFHLP+STL+MLVSAF G ++    Y+ A+   YRF+S+GD  ++
Sbjct: 288 YTFKIMDGLITNFHLPESTLIMLVSAFAGKDKVMHAYETAVEKKYRFFSFGDAMMI 343


>gi|239827856|ref|YP_002950480.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Geobacillus
           sp. WCH70]
 gi|259551452|sp|C5D5E6|QUEA_GEOSW RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|239808149|gb|ACS25214.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase [Geobacillus
           sp. WCH70]
          Length = 342

 Score =  267 bits (683), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 154/362 (42%), Positives = 212/362 (58%), Gaps = 27/362 (7%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M +  FDFDLP   IA  P+  RD++RLMV+         I      ++ ++L+  D +V
Sbjct: 1   MKIDLFDFDLPEELIAQTPLPNRDASRLMVLDKKTG---EIRHETFRNILSYLHEGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKE-----ISCTLHMRVSPNSWSVYARPSKVIKKGDIL 115
            N+T+V+ A+L G         EKE     I   L  ++  + W    +P+K +K G  +
Sbjct: 58  LNDTRVMPARLYG---------EKENTGANIEVLLLKQLEGDRWETLVKPAKRVKVGTEI 108

Query: 116 HFFSQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDAR 175
            F    G  RL+AT +D    G  +L FS  GI  E  +  +G +PLPPYI  K     R
Sbjct: 109 TF----GDGRLKATCVDTLEHGGRILEFSYQGIFYE-VLEQLGEMPLPPYIKEKLDDPER 163

Query: 176 DYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDT 235
               YQT YA+  GS AAPTAGLHFT  LL  + + G+ + F+TLHVG GTF PV VE+ 
Sbjct: 164 ----YQTVYAREVGSAAAPTAGLHFTEQLLDDIRAKGVHIAFITLHVGLGTFRPVSVENI 219

Query: 236 DDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLET-ATTEDGIINPWSGFTN 294
           ++H MH+E   +   TA+ LN V+ +GGRI++VGTTS R LET A+  +G     SG+T+
Sbjct: 220 EEHDMHAEFYQMTEETARLLNEVRQQGGRIIAVGTTSTRTLETIASKHNGAFVAESGWTD 279

Query: 295 IFITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTS 354
           IFI PGY F+A+D L++NFHLPKSTL+MLVSA  G E   + Y  A+   YRF+S+GD  
Sbjct: 280 IFIYPGYEFKAIDGLVTNFHLPKSTLIMLVSALAGRENILRAYNAAVKERYRFFSFGDAM 339

Query: 355 LL 356
           L+
Sbjct: 340 LI 341


>gi|312867272|ref|ZP_07727482.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus parasanguinis F0405]
 gi|311097401|gb|EFQ55635.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus parasanguinis F0405]
          Length = 342

 Score =  267 bits (682), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 156/357 (43%), Positives = 206/357 (57%), Gaps = 17/357 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +FDFDLP   IA  P+  RD+++L+++           D     +   L   DA+V
Sbjct: 1   MNTNDFDFDLPEELIAQTPLEKRDASKLLILDRKTGQ---FQDRHFDAILDELEPGDALV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NNT+V+ A+L+GV+          +   L      + W V A+P+K +K G  + F   
Sbjct: 58  MNNTRVLPARLHGVK----PETGGHVEFLLLKNTQDDCWEVLAKPAKRLKVGATVSF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL ATV ++   G  ++ F   GI LE   SL G +PLPPYI  K     R    Y
Sbjct: 111 -GDGRLTATVEEELEHGGRIVHFHYQGIFLEVLESL-GEMPLPPYIHEKLADRER----Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL ++ + G+ + ++TLHVG GTF PV V++ +DH M
Sbjct: 165 QTVYAKENGSAAAPTAGLHFTQELLQKIEAKGVHLVYLTLHVGLGTFRPVSVDNLEDHEM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           HSE   +    A  L  VK+ G RIV+VGTTS+R LET   + DG I   SG+TNIFI P
Sbjct: 225 HSEFYQLSEEAAATLRQVKAAGKRIVAVGTTSIRTLETIGNKFDGDIQADSGWTNIFIKP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           GY ++ VD   +NFHLPKSTL+MLVSAF G E T + Y HAI   YRF+S+GD   +
Sbjct: 285 GYEWKVVDAFSTNFHLPKSTLVMLVSAFAGRELTLEAYHHAIQERYRFFSFGDAMFI 341


>gi|295399351|ref|ZP_06809333.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|294978817|gb|EFG54413.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase [Geobacillus
           thermoglucosidasius C56-YS93]
          Length = 342

 Score =  267 bits (682), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 153/357 (42%), Positives = 206/357 (57%), Gaps = 17/357 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M +  FDFDLP   IA  P+  RD++RLMV+         I      ++ ++L   D +V
Sbjct: 1   MKIDLFDFDLPEELIAQTPLPNRDASRLMVLDKKTG---EIHHETFRNILSYLREGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+V+ A+L G +          I   L  ++  + W    +P+K +K G  + F   
Sbjct: 58  LNDTRVMPARLYGEK----ENTGAHIEVLLLKQLEGDRWETLVKPAKRVKAGTKIIF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL+AT +D    G  +L FS  GI  E  +  +G +PLPPYI  K     R    Y
Sbjct: 111 -GDGRLQATCVDTLEHGGRVLQFSYRGIFYE-VLEQLGEMPLPPYIKEKLADPER----Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YA+  GS AAPTAGLHFT  LL  + + G+ + F+TLHVG GTF PV VE+ ++H M
Sbjct: 165 QTVYAREIGSAAAPTAGLHFTEQLLDDIRAKGVHIAFITLHVGLGTFRPVNVENIEEHDM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLET-ATTEDGIINPWSGFTNIFITP 299
           H+E   +   TAQ LN  K +GGRI++VGTTS R LET A   DG     SG+T+IFI P
Sbjct: 225 HAEFYQMTEATAQLLNETKRQGGRIIAVGTTSTRTLETIAARHDGTFVAESGWTDIFIYP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           GY F+A+D L++NFHLPKSTL+MLVSA  G E     Y  A+   YRF+S+GD  L+
Sbjct: 285 GYEFKAIDGLVTNFHLPKSTLIMLVSALAGRENILHAYNVAVKERYRFFSFGDAMLI 341


>gi|238650431|ref|YP_002916283.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Rickettsia
           peacockii str. Rustic]
 gi|259551484|sp|C4K0Y4|QUEA_RICPU RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|238624529|gb|ACR47235.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Rickettsia
           peacockii str. Rustic]
          Length = 365

 Score =  267 bits (682), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 148/387 (38%), Positives = 227/387 (58%), Gaps = 50/387 (12%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FDFDLP   IA  P   RD++ L++       PL+ +     ++  +L   D +V
Sbjct: 1   MKLSDFDFDLPSELIAQYPSSERDNSDLLIA----VTPLIKTK--FYNIIDYLKEGDLLV 54

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FNN+KVI A+LN           K I+  L+ ++S +SWS +A+P++ +   D  +F + 
Sbjct: 55  FNNSKVIKAKLN---------LGKNITINLNQKLSDDSWSAFAKPARKLHVNDEFYFDNH 105

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPI-------- 172
                 +  + +K   GEI + F ++ I +   ++  G +PLP YI R   +        
Sbjct: 106 ------KVIITEKLAMGEIKVKFELNDISVFEFLNKYGEMPLPVYIRRSHSLCHPVATTT 159

Query: 173 DARDYVD--------------------YQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIG 212
            ++ Y++                    YQT Y++I+GSVAAPTAGLHFT ++L +L + G
Sbjct: 160 GSKTYLNNDWIPWSNHGMTNTQNDNDRYQTVYSQIEGSVAAPTAGLHFTKDILDKLKAEG 219

Query: 213 IKVYFVTLHVGAGTFMPVKVEDTDDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTS 272
           I+  F+TLHVGAGTF+PVK E+  +H MH+E   I   TA+ +N  K  G RI++VGTT+
Sbjct: 220 IQATFLTLHVGAGTFLPVKTENIHEHKMHTEYCSITPDTAEIINKAKQEGKRIIAVGTTT 279

Query: 273 LRLLETATTEDGIINPWSGFTNIFITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEE 332
           LR LE++   +GI+   S  T+IFITPG++F+  D+L++NFH PKSTL ML+ AF G +E
Sbjct: 280 LRTLESSCN-NGIVKAGSFKTDIFITPGFKFQTADMLLTNFHFPKSTLFMLICAFAGFKE 338

Query: 333 TKKMYQHAISHAYRFYSYGDTSLLFQK 359
             ++Y++AI  A RF+SYGD +LL +K
Sbjct: 339 MHELYKYAIKEAMRFFSYGDATLLCRK 365


>gi|253578958|ref|ZP_04856229.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39B_FAA]
 gi|251849901|gb|EES77860.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39BFAA]
          Length = 341

 Score =  267 bits (682), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 150/356 (42%), Positives = 203/356 (57%), Gaps = 16/356 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +F +DLP   IA  P+  R S+RLM  H +L    +   H  +D+  ++   D +V
Sbjct: 1   MKTSDFYYDLPQELIAQDPLEDRSSSRLM--HLSLKDGSIEHRHF-TDVLDYMEEGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+TKVI A+L G    H       I   L  R   + W    +P K  + G  + F   
Sbjct: 58  INDTKVIPARLYG----HKEETGALIEILLLKRRENDIWECLVKPGKKARPGAKITF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G   L+  +ID  + G  L+ F   GI  E  +  +G +PLPPYI  K     +D   Y
Sbjct: 111 -GNGILKGKIIDVVDEGNRLIQFHYEGI-FEEILDQLGEMPLPPYITHK----LKDKNRY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK +GS AAPTAGLHFT  LL ++   G+ +  VTLHVG GTF PVKV+D + H M
Sbjct: 165 QTVYAKNEGSAAAPTAGLHFTKELLEKVKEKGVNIAHVTLHVGLGTFRPVKVDDVESHHM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   ++   A+ +N  K  G R+++VGTTS R LE+AT EDGI+   SG+T IFI PG
Sbjct: 225 HSEFYIVEEDQAKLINDTKKAGKRVIAVGTTSCRTLESATGEDGILKAGSGWTEIFIYPG 284

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           Y F+ +D L++NFHLP+STL+MLVSA  G E     Y+ A+   YRF+S+GD  +L
Sbjct: 285 YHFKMIDALITNFHLPESTLVMLVSALAGKENIMHAYEVAVQEKYRFFSFGDAMIL 340


>gi|239637555|ref|ZP_04678527.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus warneri L37603]
 gi|239596773|gb|EEQ79298.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus warneri L37603]
          Length = 341

 Score =  267 bits (682), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 149/357 (41%), Positives = 215/357 (60%), Gaps = 18/357 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHL-VSDLPAFLNSNDAI 59
           M +++FD+DLP S IA  P+  RD +RL+V++ N        +HL   D+  + N  D +
Sbjct: 1   MNIEDFDYDLPESLIAQTPLKNRDQSRLLVLNRNNGN----MEHLHFKDVINYFNPGDTL 56

Query: 60  VFNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFS 119
           V N+T+V+ A+L G++         ++   +  ++  N W V  +P+K IK G+ L+F  
Sbjct: 57  VLNDTRVMPARLFGLK----EETGAKVEMLMLTQIEGNDWEVLLKPAKRIKVGNQLNF-- 110

Query: 120 QDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVD 179
             G  ++ A  I++ + G  ++     GI L+ ++  +G +PLPPYI  K  +D  D   
Sbjct: 111 --GDGKIIAECIEELDQGGRIMRLHYEGI-LQERLDELGEMPLPPYI--KERLDDPDR-- 163

Query: 180 YQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHI 239
           YQT YAK  GS AAPTAGLHFT  LL  + + G+ + F+TLHVG GTF PV V++ DDH 
Sbjct: 164 YQTVYAKESGSAAAPTAGLHFTDELLESIKAKGVNIAFITLHVGLGTFRPVSVDNIDDHE 223

Query: 240 MHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITP 299
           MHSE   +   TA  LN  + +G RI+SVGTTS R LET   +       SG+T+IFI P
Sbjct: 224 MHSEYYQMTQETADLLNETRKKGHRIISVGTTSTRTLETIRRDHSEFVEKSGWTDIFIYP 283

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           G+ ++A+D L++NFHLPKSTL+MLVSAF   E     YQ A+   YRF+S+GD  L+
Sbjct: 284 GFEYKAIDGLITNFHLPKSTLVMLVSAFSSREYILNAYQKAVEMEYRFFSFGDAMLI 340


>gi|319939489|ref|ZP_08013849.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus anginosus 1_2_62CV]
 gi|319811475|gb|EFW07770.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus anginosus 1_2_62CV]
          Length = 342

 Score =  267 bits (682), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 154/353 (43%), Positives = 211/353 (59%), Gaps = 17/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +FDF LP   IA  P+  RD++RL+VV+        + D     +   L+  DA+V
Sbjct: 1   MNTADFDFHLPEELIAQTPLEKRDASRLLVVNHETGQ---MEDTHFDAIIDQLHPGDALV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+V+ A+L+G +          +   L   ++ + W V A+P+K +K G  + F   
Sbjct: 58  MNDTRVLPARLHGEK----PETGGHVELLLLKNIAGDDWEVLAKPAKRLKVGAAISF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL ATV+++   G  ++ F   GI LE   SL G +PLPPYI  K     +D   Y
Sbjct: 111 -GDGRLTATVLEELEHGGRIVRFHYQGIFLEVLESL-GEMPLPPYIHEK----LKDRERY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL+++ + G+K+ ++TLHVG GTF PV V++ D+H M
Sbjct: 165 QTVYAKENGSAAAPTAGLHFTKELLAQIEAKGVKLVYLTLHVGLGTFRPVSVDNVDEHEM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           HSE   +    A  L  VK+ G  +V+VGTTS+R LET  ++ +G I   SG+TNIFI P
Sbjct: 225 HSEFYTLSEEAANTLRQVKASGHHVVAVGTTSIRTLETIGSKFNGEIKADSGWTNIFIKP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           GY ++ VD   +NFHLPKSTL+MLVSAF G E     YQHAI   YRF+S+GD
Sbjct: 285 GYDWKVVDAFSTNFHLPKSTLVMLVSAFAGRELVLSAYQHAIDEKYRFFSFGD 337


>gi|307705266|ref|ZP_07642132.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus mitis SK597]
 gi|307621179|gb|EFO00250.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus mitis SK597]
          Length = 342

 Score =  267 bits (682), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 154/358 (43%), Positives = 210/358 (58%), Gaps = 17/358 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +FDF LP   IA  P+  RD+++L++V+           H + D+   L   DA+V
Sbjct: 1   MNTADFDFHLPEELIAQTPLEKRDASKLLIVNRETGEMQDKHFHSIIDM---LEPGDALV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+V+ A+L G +          +   L    + + W V A+P+K +K G  + F   
Sbjct: 58  MNDTRVLPARLYGQK----EETGGHVELLLLKNTAGDEWEVLAKPAKRLKVGTRVSF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL A V ++   G  ++ F   GI LE   SL G +PLPPYI  K  +D R+   Y
Sbjct: 111 -GDGRLSAVVTEELTHGGRIVRFEYQGIFLEVLESL-GEMPLPPYIHEK--LDDRER--Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL+ + + G+ + ++TLHVG GTF PV V++ D+H M
Sbjct: 165 QTVYAKESGSAAAPTAGLHFTKELLAEIQAKGVHLVYLTLHVGLGTFRPVSVDNLDEHEM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           HSE   +    A  L SVK  GGR+++VGTTS+R LET  ++ DG I   SG+TNIFI P
Sbjct: 225 HSEFYQLSEEAAVTLRSVKENGGRVIAVGTTSIRTLETIGSKFDGQIQADSGWTNIFIKP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           GY ++ VD   +NFHLPKSTL+MLVSAF G E     Y HAI   YRF+S+GD   ++
Sbjct: 285 GYEWKVVDAFSTNFHLPKSTLVMLVSAFAGRELVLDAYHHAIQEHYRFFSFGDAMFIY 342


>gi|261365393|ref|ZP_05978276.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Neisseria
           mucosa ATCC 25996]
 gi|288566193|gb|EFC87753.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Neisseria
           mucosa ATCC 25996]
          Length = 347

 Score =  267 bits (682), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 151/357 (42%), Positives = 213/357 (59%), Gaps = 20/357 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FDF LP   IA  P   R S+RL+V  P++     + D    +LP ++ + D +V
Sbjct: 1   MDISDFDFTLPDQLIAQHPPEVRGSSRLLVALPDMP----LQDRAFGNLPDYIEAGDVLV 56

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FNNTKV+ A+L G +         +I   +   +  ++   + R SK  K G  L F   
Sbjct: 57  FNNTKVMKARLFGQK-----ESGGKIEALIERVLDNHTALAHIRSSKSPKPGTKLIF--- 108

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIE-LERQISLVGTIPLPPYIARKRPIDARDYVD 179
             +  + A ++++ +    L      G + +   +   G +PLPPYI  +R   A D   
Sbjct: 109 --EGDICAVMVERADE---LFCLRFEGEQTVYELLEQNGHLPLPPYI--ERAAGADDDKR 161

Query: 180 YQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHI 239
           YQT YAK QG+VAAPTAGLHFT  LL RL + G++   VTLHVGAGTF PV+V+  ++H 
Sbjct: 162 YQTVYAKHQGAVAAPTAGLHFTDELLGRLKTKGVETAEVTLHVGAGTFQPVRVDKIEEHK 221

Query: 240 MHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITP 299
           MHSE   +   T  A+ +  +RG ++ +VGTTS+R LE+A  E G +    G T+IFITP
Sbjct: 222 MHSEWFDVPPETVAAIEAAHARGNKVWAVGTTSMRALESAARETGRLKAGQGDTDIFITP 281

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           GYRFR +D L++NFHLPKSTLLMLVSAF G+E  + +Y+HA+ H YRF+SYGD  +L
Sbjct: 282 GYRFRVIDRLITNFHLPKSTLLMLVSAFSGMEHIRTVYRHAVEHEYRFFSYGDAMVL 338


>gi|28211815|ref|NP_782759.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           tetani E88]
 gi|28204257|gb|AAO36696.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           tetani E88]
          Length = 344

 Score =  267 bits (682), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 147/352 (41%), Positives = 200/352 (56%), Gaps = 16/352 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M  K+FD+ LP   IA  P+  RD  RLMV+         +   +  D+  +LN  D +V
Sbjct: 4   MKAKDFDYYLPEELIAQHPLEKRDECRLMVLDKETGH---VEHKVFKDILDYLNKGDCLV 60

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+V+ A+L G +       + ++   L  R   ++W    +P K  K G    F   
Sbjct: 61  LNDTRVMPARLIGEK----EETKGKMEFLLLKRTDKDTWETLVKPGKRAKIGSRFIF--- 113

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            GQ  L+A VI     G  ++ F   GI  E  +  +G +PLPPYI  K      D   Y
Sbjct: 114 -GQGELKAEVIGMAEEGSRIVKFEYDGI-FEEVLDRLGQMPLPPYITEK----LEDKEKY 167

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT Y+K  GS AAPTAGLHFT  LL+++   GIK+ F+TLHVG GTF PVK  + ++HIM
Sbjct: 168 QTVYSKESGSAAAPTAGLHFTEELLNKIKEKGIKIVFLTLHVGLGTFRPVKEGEIENHIM 227

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   I   TA  +N+ K  GGR+++VGTTS R LET  ++ G I   SG+TNIF+ PG
Sbjct: 228 HSEYYCISKETADIINTTKEAGGRVIAVGTTSCRTLETLGSKHGKIIEDSGWTNIFMYPG 287

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           Y F+  D L++NFHLP+STL+MLVSA    E     Y+ A+   YRF+S+GD
Sbjct: 288 YEFKVTDALITNFHLPQSTLIMLVSALSERERVLNAYEIAVREKYRFFSFGD 339


>gi|229146989|ref|ZP_04275351.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           cereus BDRD-ST24]
 gi|228636486|gb|EEK92954.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           cereus BDRD-ST24]
          Length = 350

 Score =  267 bits (682), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 151/353 (42%), Positives = 209/353 (59%), Gaps = 17/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M +  FDF LP   IA  P+  R+++RLMV+         I     +D+ ++L+  D +V
Sbjct: 1   MDINLFDFHLPEELIAQVPLEDRETSRLMVLDRETGD---IEHKHFTDILSYLHEGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N TKV+ A+L+GV+          I   L  +   + W    +P+K +K+G ++ F   
Sbjct: 58  LNETKVMPARLHGVK----EDTGAHIEVLLLKQEEGDKWETLVKPAKRVKEGTVISF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G+ +L+AT     + G   L FS  GI  E  +  +G +PLPPYI  K  ++ RD   Y
Sbjct: 111 -GEGKLKATCTGTADQGGRQLEFSYDGIFYE-ILDELGEMPLPPYI--KETLEDRDR--Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL +L   G+++ F+TLHVG GTF PV  +  ++H M
Sbjct: 165 QTVYAKEIGSAAAPTAGLHFTEELLEKLKQKGVQLAFITLHVGLGTFRPVSADTIEEHHM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLET-ATTEDGIINPWSGFTNIFITP 299
           H+E   +   TA  LN VK  GGRI++VGTTS R LET AT  DG +   SG+T+IF+ P
Sbjct: 225 HAEYYHMSEETADLLNRVKENGGRIITVGTTSTRTLETIATDHDGKLCAASGWTDIFMYP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           GY F+A+D L++NFHLPKSTL+MLVSAF   +     Y  A+   YRF+S+GD
Sbjct: 285 GYEFKAIDGLITNFHLPKSTLIMLVSAFANRDNVLHAYNEAVKEKYRFFSFGD 337


>gi|327439542|dbj|BAK15907.1| S-adenosylmethionine:tRNA-ribosyltransferase-isomerase
           [Solibacillus silvestris StLB046]
          Length = 345

 Score =  266 bits (681), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 151/353 (42%), Positives = 205/353 (58%), Gaps = 17/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V++FDF LP   IA  P+  R ++RLMVV+PN    L +  H    +   LN+ D +V
Sbjct: 1   MKVEDFDFYLPEELIAQTPLLDRTASRLMVVNPN---SLEVEHHTFGHILDELNAGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+V+ A+L GV+          I   L  + + + W    +P+K +K G ++ F   
Sbjct: 58  LNDTRVLPARLMGVK----ADTGANIELLLLKQTNDDEWETLVKPAKRVKTGTVVTF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G   L AT   + + G     F+  GI  E  +  +G +PLPPYI  K      D   Y
Sbjct: 111 -GDGLLTATCTGELDHGGRTFKFTYDGIFYE-ILDQLGEMPLPPYIREK----LEDQDRY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK +GS AAPTAGLHFT  LL  + + G++V F+TLHVG GTF PV V+  +DH M
Sbjct: 165 QTVYAKERGSAAAPTAGLHFTQPLLEAIKAKGVEVVFITLHVGLGTFRPVSVDSIEDHDM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLET-ATTEDGIINPWSGFTNIFITP 299
           HSE   +    A  +  VK  GG+++SVGTTS R LET A+  DG I    G+TNIFI P
Sbjct: 225 HSEFYSVSEEAAAVIERVKQAGGKVISVGTTSTRTLETVASKNDGKIVASHGWTNIFIYP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           GY ++A+D L++NFHLPKSTL+MLVSA    E     Y+ A+   YRF+S+GD
Sbjct: 285 GYEYKAIDGLITNFHLPKSTLVMLVSALASKETIMNAYEQAVKEKYRFFSFGD 337


>gi|65321784|ref|ZP_00394743.1| COG0809: S-adenosylmethionine:tRNA-ribosyltransferase-isomerase
           (queuine synthetase) [Bacillus anthracis str. A2012]
          Length = 354

 Score =  266 bits (681), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 151/353 (42%), Positives = 209/353 (59%), Gaps = 17/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M +  FDF LP   IA  P+  R+++RLMV+         I     +D+ ++L+  D +V
Sbjct: 5   MDINLFDFHLPEELIAQVPLEERETSRLMVLDRETGD---IEHKHFTDILSYLHEGDCLV 61

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N TKV+ A+L+GV+          I   L  +   + W    +P+K +K+G ++ F   
Sbjct: 62  LNETKVMPARLHGVK----EDTGAHIEVLLLKQEEGDKWETLVKPAKRVKEGTVISF--- 114

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G+ +L+AT     + G   L FS  GI  E  +  +G +PLPPYI  K  ++ RD   Y
Sbjct: 115 -GEGKLKATCTGTADQGGRQLEFSYDGIFYE-ILDELGEMPLPPYI--KETLEDRDR--Y 168

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL +L   G+++ F+TLHVG GTF PV  +  ++H M
Sbjct: 169 QTVYAKEIGSAAAPTAGLHFTEELLEKLKQKGVELAFITLHVGLGTFRPVSADTIEEHHM 228

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLET-ATTEDGIINPWSGFTNIFITP 299
           H+E   +   TA  LN VK  GGRI++VGTTS R LET AT  DG +   SG+T+IF+ P
Sbjct: 229 HAEYYHMSEETAALLNRVKENGGRIITVGTTSTRTLETIATDHDGKLCAASGWTDIFMYP 288

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           GY F+A+D L++NFHLPKSTL+MLVSAF   +     Y  A+   YRF+S+GD
Sbjct: 289 GYEFKAIDGLITNFHLPKSTLIMLVSAFANRDNVLHAYNEAVKEKYRFFSFGD 341


>gi|253999982|ref|YP_003052045.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Methylovorus sp. SIP3-4]
 gi|253986661|gb|ACT51518.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Methylovorus sp. SIP3-4]
          Length = 351

 Score =  266 bits (681), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 153/359 (42%), Positives = 213/359 (59%), Gaps = 18/359 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M  ++FDF LP   IA  P   RD +RL+ +  N      I+DH   +LP FLN+ D ++
Sbjct: 1   MRTEDFDFFLPEELIAQFPAAERDGSRLLRLDGNSGA---IADHQFRELPQFLNAGDVLI 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FN+T+VI A+L G +          I   +   +  +    + R S+  K G     F  
Sbjct: 58  FNDTRVIKARLQGHK-----ESGGSIELLIERPLDTHRALAHIRASRSPKPGS--RIFIG 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
           DG   + A VI++ +  ++ L+       L   +   G +PLPPYI      DA D   Y
Sbjct: 111 DG---IPARVIERQD--DLFLIEVEHVTPLLDLLDQYGALPLPPYITHA--ADAEDDERY 163

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YA+  G+VAAPTAGLHF   +L RL + GI++ +VTLHVGAGTF PV+V+D  +H M
Sbjct: 164 QTIYARTPGAVAAPTAGLHFNQVMLDRLQAAGIQIAYVTLHVGAGTFQPVRVDDISEHRM 223

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSEI  +   T   +N+ ++ G +I +VGTT+LR LE+A    G +   SG T+IFITPG
Sbjct: 224 HSEIYTVPPATVDLINTARAAGHKITAVGTTALRALESA-ARSGALVAGSGETDIFITPG 282

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLFQK 359
           YRF+ V+ L++NFHLPKSTL+MLVSAF G+E  +  Y HAI+  YRF+SYGD  LL ++
Sbjct: 283 YRFQVVERLLTNFHLPKSTLMMLVSAFAGVEHIRAAYAHAIASRYRFFSYGDAMLLERR 341


>gi|46577020|sp|Q891Z9|QUEA_CLOTE RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
          Length = 341

 Score =  266 bits (681), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 147/352 (41%), Positives = 200/352 (56%), Gaps = 16/352 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M  K+FD+ LP   IA  P+  RD  RLMV+         +   +  D+  +LN  D +V
Sbjct: 1   MKAKDFDYYLPEELIAQHPLEKRDECRLMVLDKETGH---VEHKVFKDILDYLNKGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+V+ A+L G +       + ++   L  R   ++W    +P K  K G    F   
Sbjct: 58  LNDTRVMPARLIGEK----EETKGKMEFLLLKRTDKDTWETLVKPGKRAKIGSRFIF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            GQ  L+A VI     G  ++ F   GI  E  +  +G +PLPPYI  K      D   Y
Sbjct: 111 -GQGELKAEVIGMAEEGSRIVKFEYDGI-FEEVLDRLGQMPLPPYITEK----LEDKEKY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT Y+K  GS AAPTAGLHFT  LL+++   GIK+ F+TLHVG GTF PVK  + ++HIM
Sbjct: 165 QTVYSKESGSAAAPTAGLHFTEELLNKIKEKGIKIVFLTLHVGLGTFRPVKEGEIENHIM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   I   TA  +N+ K  GGR+++VGTTS R LET  ++ G I   SG+TNIF+ PG
Sbjct: 225 HSEYYCISKETADIINTTKEAGGRVIAVGTTSCRTLETLGSKHGKIIEDSGWTNIFMYPG 284

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           Y F+  D L++NFHLP+STL+MLVSA    E     Y+ A+   YRF+S+GD
Sbjct: 285 YEFKVTDALITNFHLPQSTLIMLVSALSERERVLNAYEIAVREKYRFFSFGD 336


>gi|168491320|ref|ZP_02715463.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae CDC0288-04]
 gi|183574488|gb|EDT95016.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae CDC0288-04]
          Length = 342

 Score =  266 bits (681), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 154/358 (43%), Positives = 210/358 (58%), Gaps = 17/358 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +FDF LP   IA  P+  RD+++L++V+           H + D+   L   DA+V
Sbjct: 1   MNTADFDFHLPEELIAQTPLEKRDASKLLIVNRETGEMQDKHFHSIIDM---LEPGDALV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+V+ A+L G +          +   L    S + W V A+P+K +K G  + F   
Sbjct: 58  MNDTRVLPARLYGQKV----ETGGHVELLLLKNTSGDEWEVLAKPAKRLKVGTRISF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL A V ++   G  ++ F   GI LE   SL G +PLPPYI  K  +D R+   Y
Sbjct: 111 -GDGRLSAVVTEELTHGGRIVRFEYQGIFLEVLESL-GEMPLPPYIHEK--LDDRER--Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL+ + + G+ + ++TLHVG GTF PV V++ D+H M
Sbjct: 165 QTVYAKESGSAAAPTAGLHFTKELLAEIQAKGVHLVYLTLHVGLGTFRPVSVDNLDEHEM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           HSE   +    A  L SVK  GGR+++VGTTS+R LET  ++ DG I   SG+TNIFI P
Sbjct: 225 HSEFYQLSEEAAATLRSVKENGGRVIAVGTTSIRTLETIGSKFDGQIQADSGWTNIFIKP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           GY ++ VD   +NFHLPKSTL+MLVSAF G E     Y H+I   YRF+S+GD   ++
Sbjct: 285 GYEWKVVDAFSTNFHLPKSTLVMLVSAFAGRELVLDAYHHSIQEHYRFFSFGDAMFIY 342


>gi|325266040|ref|ZP_08132726.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Kingella
           denitrificans ATCC 33394]
 gi|324982678|gb|EGC18304.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Kingella
           denitrificans ATCC 33394]
          Length = 340

 Score =  266 bits (681), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 157/356 (44%), Positives = 208/356 (58%), Gaps = 19/356 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + EFDF LP   IA  P   R S+RL+V   N      I D    DLP ++ + D +V
Sbjct: 1   MHISEFDFHLPEHLIAQNPPAVRGSSRLLVAQHNQP----IEDRHFPDLPNYIATGDVLV 56

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FNNTKV+ A+L G +         +I   +   +  ++   + R SK  K G  L F   
Sbjct: 57  FNNTKVMKARLFGQKAT-----GGKIEALIERVLDEHTALAHIRSSKSPKAGTELIF--- 108

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
             +  L AT+ ++   GE+  +       +   +   G +PLPPYI R  P D  D   Y
Sbjct: 109 --EGSLHATMTER--VGELFKLQFHHRHNVYTLLEEYGALPLPPYIVR--PADDNDDARY 162

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK QG+VAAPTAGLHFT  +LS L   G++   VTLHVGAGTF PV+V++  +H M
Sbjct: 163 QTVYAKYQGAVAAPTAGLHFTHEILSALQQKGVEFAEVTLHVGAGTFQPVRVDNIAEHKM 222

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   +   T   + + K+RG R+ SVGTTSLR +E+A    G ++   G T+IFITPG
Sbjct: 223 HSEWFDVPEATVAKIQAAKARGNRVWSVGTTSLRAIESA-ARSGSLHAGQGDTDIFITPG 281

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           Y FR +D L++NFHLPKSTLLMLVSAF G E  +++Y+HAI   YRF+SYGD  LL
Sbjct: 282 YTFRVIDGLITNFHLPKSTLLMLVSAFAGSERIREIYRHAIEQEYRFFSYGDAMLL 337


>gi|228941586|ref|ZP_04104134.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           thuringiensis serovar berliner ATCC 10792]
 gi|228974515|ref|ZP_04135082.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           thuringiensis serovar thuringiensis str. T01001]
 gi|228785232|gb|EEM33244.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           thuringiensis serovar thuringiensis str. T01001]
 gi|228818093|gb|EEM64170.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           thuringiensis serovar berliner ATCC 10792]
          Length = 354

 Score =  266 bits (681), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 151/353 (42%), Positives = 209/353 (59%), Gaps = 17/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M +  FDF LP   IA  P+  R+++RLMV+         I     +D+ ++L+  D +V
Sbjct: 5   MDINLFDFHLPEELIAQVPLEDRETSRLMVLDRETGD---IEHKHFTDILSYLHEGDCLV 61

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N TKV+ A+L+GV+          I   L  +   + W    +P+K +K+G ++ F   
Sbjct: 62  LNETKVMPARLHGVK----EDTGAHIEVLLLKQEEGDKWETLVKPAKRVKEGTVISF--- 114

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G+ +L+AT     + G   L FS  GI  E  +  +G +PLPPYI  K  ++ RD   Y
Sbjct: 115 -GEGKLKATCTGTADQGGRQLEFSYDGIFYE-ILDELGEMPLPPYI--KETLEDRDR--Y 168

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL +L   G+++ F+TLHVG GTF PV  +  ++H M
Sbjct: 169 QTVYAKEIGSAAAPTAGLHFTEELLEKLKQKGVQLAFITLHVGLGTFRPVSADTIEEHHM 228

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLET-ATTEDGIINPWSGFTNIFITP 299
           H+E   +   TA  LN VK  GGRI++VGTTS R LET AT  DG +   SG+T+IF+ P
Sbjct: 229 HAEYYHMSEETATLLNRVKENGGRIITVGTTSTRTLETIATDHDGKLCAASGWTDIFMYP 288

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           GY F+A+D L++NFHLPKSTL+MLVSAF   +     Y  A+   YRF+S+GD
Sbjct: 289 GYEFKAIDGLITNFHLPKSTLIMLVSAFANRDNVLHAYNEAVKEKYRFFSFGD 341


>gi|30264488|ref|NP_846865.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           anthracis str. Ames]
 gi|42783549|ref|NP_980796.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           cereus ATCC 10987]
 gi|47529946|ref|YP_021295.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           anthracis str. 'Ames Ancestor']
 gi|47566608|ref|ZP_00237430.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           cereus G9241]
 gi|49187308|ref|YP_030560.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           anthracis str. Sterne]
 gi|49481504|ref|YP_038468.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           thuringiensis serovar konkukian str. 97-27]
 gi|165871981|ref|ZP_02216622.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           anthracis str. A0488]
 gi|167640749|ref|ZP_02399009.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           anthracis str. A0193]
 gi|170688656|ref|ZP_02879861.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           anthracis str. A0465]
 gi|177653957|ref|ZP_02935998.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           anthracis str. A0174]
 gi|190566984|ref|ZP_03019900.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           anthracis Tsiankovskii-I]
 gi|196034446|ref|ZP_03101855.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           cereus W]
 gi|196039272|ref|ZP_03106578.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           cereus NVH0597-99]
 gi|206976063|ref|ZP_03236973.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           cereus H3081.97]
 gi|217961909|ref|YP_002340479.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           cereus AH187]
 gi|218905613|ref|YP_002453447.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           cereus AH820]
 gi|227817196|ref|YP_002817205.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           anthracis str. CDC 684]
 gi|228929463|ref|ZP_04092484.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           thuringiensis serovar pondicheriensis BGSC 4BA1]
 gi|228935738|ref|ZP_04098551.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           thuringiensis serovar andalousiensis BGSC 4AW1]
 gi|228948132|ref|ZP_04110416.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           thuringiensis serovar monterrey BGSC 4AJ1]
 gi|228987671|ref|ZP_04147783.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           thuringiensis serovar tochigiensis BGSC 4Y1]
 gi|229123959|ref|ZP_04253151.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           cereus 95/8201]
 gi|229141157|ref|ZP_04269698.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           cereus BDRD-ST26]
 gi|229158033|ref|ZP_04286104.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           cereus ATCC 4342]
 gi|229602726|ref|YP_002868704.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           anthracis str. A0248]
 gi|254684173|ref|ZP_05148033.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           anthracis str. CNEVA-9066]
 gi|254736520|ref|ZP_05194226.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           anthracis str. Western North America USA6153]
 gi|254741558|ref|ZP_05199245.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           anthracis str. Kruger B]
 gi|254751343|ref|ZP_05203380.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           anthracis str. Vollum]
 gi|254757675|ref|ZP_05209702.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           anthracis str. Australia 94]
 gi|301055926|ref|YP_003794137.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           anthracis CI]
 gi|38372450|sp|Q81LH1|QUEA_BACAN RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|81568824|sp|Q730B3|QUEA_BACC1 RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|81613565|sp|Q6HDA8|QUEA_BACHK RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|226736730|sp|B7JQ04|QUEA_BACC0 RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|226736733|sp|B7HQH7|QUEA_BACC7 RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|254764263|sp|C3P9A5|QUEA_BACAA RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|254764264|sp|C3L6U7|QUEA_BACAC RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|30259146|gb|AAP28351.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           anthracis str. Ames]
 gi|42739478|gb|AAS43404.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           cereus ATCC 10987]
 gi|47505094|gb|AAT33770.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           anthracis str. 'Ames Ancestor']
 gi|47556638|gb|EAL14970.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           cereus G9241]
 gi|49181235|gb|AAT56611.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           anthracis str. Sterne]
 gi|49333060|gb|AAT63706.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase (queuosine
           biosynthesis protein queA) [Bacillus thuringiensis
           serovar konkukian str. 97-27]
 gi|164712271|gb|EDR17807.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           anthracis str. A0488]
 gi|167511321|gb|EDR86707.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           anthracis str. A0193]
 gi|170667342|gb|EDT18100.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           anthracis str. A0465]
 gi|172081012|gb|EDT66090.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           anthracis str. A0174]
 gi|190561975|gb|EDV15944.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           anthracis Tsiankovskii-I]
 gi|195992988|gb|EDX56947.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           cereus W]
 gi|196029899|gb|EDX68500.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           cereus NVH0597-99]
 gi|206745815|gb|EDZ57212.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           cereus H3081.97]
 gi|217063781|gb|ACJ78031.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           cereus AH187]
 gi|218540066|gb|ACK92464.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           cereus AH820]
 gi|227005653|gb|ACP15396.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           anthracis str. CDC 684]
 gi|228625486|gb|EEK82242.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           cereus ATCC 4342]
 gi|228642320|gb|EEK98610.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           cereus BDRD-ST26]
 gi|228659261|gb|EEL14909.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           cereus 95/8201]
 gi|228772056|gb|EEM20510.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           thuringiensis serovar tochigiensis BGSC 4Y1]
 gi|228811490|gb|EEM57827.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           thuringiensis serovar monterrey BGSC 4AJ1]
 gi|228823976|gb|EEM69795.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           thuringiensis serovar andalousiensis BGSC 4AW1]
 gi|228830251|gb|EEM75867.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           thuringiensis serovar pondicheriensis BGSC 4BA1]
 gi|229267134|gb|ACQ48771.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           anthracis str. A0248]
 gi|300378095|gb|ADK06999.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           cereus biovar anthracis str. CI]
          Length = 350

 Score =  266 bits (681), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 151/353 (42%), Positives = 209/353 (59%), Gaps = 17/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M +  FDF LP   IA  P+  R+++RLMV+         I     +D+ ++L+  D +V
Sbjct: 1   MDINLFDFHLPEELIAQVPLEERETSRLMVLDRETGD---IEHKHFTDILSYLHEGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N TKV+ A+L+GV+          I   L  +   + W    +P+K +K+G ++ F   
Sbjct: 58  LNETKVMPARLHGVK----EDTGAHIEVLLLKQEEGDKWETLVKPAKRVKEGTVISF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G+ +L+AT     + G   L FS  GI  E  +  +G +PLPPYI  K  ++ RD   Y
Sbjct: 111 -GEGKLKATCTGTADQGGRQLEFSYDGIFYE-ILDELGEMPLPPYI--KETLEDRDR--Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL +L   G+++ F+TLHVG GTF PV  +  ++H M
Sbjct: 165 QTVYAKEIGSAAAPTAGLHFTEELLEKLKQKGVELAFITLHVGLGTFRPVSADTIEEHHM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLET-ATTEDGIINPWSGFTNIFITP 299
           H+E   +   TA  LN VK  GGRI++VGTTS R LET AT  DG +   SG+T+IF+ P
Sbjct: 225 HAEYYHMSEETAALLNRVKENGGRIITVGTTSTRTLETIATDHDGKLCAASGWTDIFMYP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           GY F+A+D L++NFHLPKSTL+MLVSAF   +     Y  A+   YRF+S+GD
Sbjct: 285 GYEFKAIDGLITNFHLPKSTLIMLVSAFANRDNVLHAYNEAVKEKYRFFSFGD 337


>gi|29375455|ref|NP_814609.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecalis V583]
 gi|227520114|ref|ZP_03950163.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecalis TX0104]
 gi|227554979|ref|ZP_03985026.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecalis HH22]
 gi|229546713|ref|ZP_04435438.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecalis TX1322]
 gi|229548806|ref|ZP_04437531.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecalis ATCC 29200]
 gi|255971322|ref|ZP_05421908.1| queuosine biosynthesis protein [Enterococcus faecalis T1]
 gi|255973941|ref|ZP_05424527.1| queuosine biosynthesis protein [Enterococcus faecalis T2]
 gi|256617740|ref|ZP_05474586.1| queuosine biosynthesis protein [Enterococcus faecalis ATCC 4200]
 gi|256761626|ref|ZP_05502206.1| queuosine biosynthesis protein [Enterococcus faecalis T3]
 gi|256854284|ref|ZP_05559648.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecalis T8]
 gi|256957271|ref|ZP_05561442.1| queuosine biosynthesis protein [Enterococcus faecalis DS5]
 gi|256959995|ref|ZP_05564166.1| queuosine biosynthesis protein [Enterococcus faecalis Merz96]
 gi|256964309|ref|ZP_05568480.1| queuosine biosynthesis protein [Enterococcus faecalis HIP11704]
 gi|257077755|ref|ZP_05572116.1| queuosine biosynthesis protein [Enterococcus faecalis JH1]
 gi|257083784|ref|ZP_05578145.1| queuosine biosynthesis protein [Enterococcus faecalis Fly1]
 gi|257086209|ref|ZP_05580570.1| queuosine biosynthesis protein [Enterococcus faecalis D6]
 gi|257089281|ref|ZP_05583642.1| queuosine biosynthesis protein [Enterococcus faecalis CH188]
 gi|257418465|ref|ZP_05595459.1| queuosine biosynthesis protein [Enterococcus faecalis T11]
 gi|257421116|ref|ZP_05598106.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecalis X98]
 gi|293383747|ref|ZP_06629654.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecalis R712]
 gi|293388778|ref|ZP_06633271.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecalis S613]
 gi|294781281|ref|ZP_06746627.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecalis PC1.1]
 gi|307267946|ref|ZP_07549334.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecalis TX4248]
 gi|307271868|ref|ZP_07553136.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecalis TX0855]
 gi|307277297|ref|ZP_07558399.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecalis TX2134]
 gi|307278436|ref|ZP_07559511.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecalis TX0860]
 gi|307286677|ref|ZP_07566763.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecalis TX0109]
 gi|307292452|ref|ZP_07572306.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecalis TX0411]
 gi|312904428|ref|ZP_07763588.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecalis TX0635]
 gi|312907038|ref|ZP_07766034.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecalis DAPTO 512]
 gi|312952863|ref|ZP_07771724.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecalis TX0102]
 gi|312978705|ref|ZP_07790432.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecalis DAPTO 516]
 gi|46576997|sp|Q837H2|QUEA_ENTFA RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|29342915|gb|AAO80679.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecalis V583]
 gi|227072458|gb|EEI10421.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecalis TX0104]
 gi|227175888|gb|EEI56860.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecalis HH22]
 gi|229306035|gb|EEN72031.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecalis ATCC 29200]
 gi|229308173|gb|EEN74160.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecalis TX1322]
 gi|255962340|gb|EET94816.1| queuosine biosynthesis protein [Enterococcus faecalis T1]
 gi|255966813|gb|EET97435.1| queuosine biosynthesis protein [Enterococcus faecalis T2]
 gi|256597267|gb|EEU16443.1| queuosine biosynthesis protein [Enterococcus faecalis ATCC 4200]
 gi|256682877|gb|EEU22572.1| queuosine biosynthesis protein [Enterococcus faecalis T3]
 gi|256709844|gb|EEU24888.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecalis T8]
 gi|256947767|gb|EEU64399.1| queuosine biosynthesis protein [Enterococcus faecalis DS5]
 gi|256950491|gb|EEU67123.1| queuosine biosynthesis protein [Enterococcus faecalis Merz96]
 gi|256954805|gb|EEU71437.1| queuosine biosynthesis protein [Enterococcus faecalis HIP11704]
 gi|256985785|gb|EEU73087.1| queuosine biosynthesis protein [Enterococcus faecalis JH1]
 gi|256991814|gb|EEU79116.1| queuosine biosynthesis protein [Enterococcus faecalis Fly1]
 gi|256994239|gb|EEU81541.1| queuosine biosynthesis protein [Enterococcus faecalis D6]
 gi|256998093|gb|EEU84613.1| queuosine biosynthesis protein [Enterococcus faecalis CH188]
 gi|257160293|gb|EEU90253.1| queuosine biosynthesis protein [Enterococcus faecalis T11]
 gi|257162940|gb|EEU92900.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecalis X98]
 gi|291078823|gb|EFE16187.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecalis R712]
 gi|291081935|gb|EFE18898.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecalis S613]
 gi|294451617|gb|EFG20073.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecalis PC1.1]
 gi|295113928|emb|CBL32565.1| S-adenosylmethionine--tRNA ribosyltransferase-isomerase
           [Enterococcus sp. 7L76]
 gi|306496483|gb|EFM66046.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecalis TX0411]
 gi|306502155|gb|EFM71439.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecalis TX0109]
 gi|306504942|gb|EFM74137.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecalis TX0860]
 gi|306506004|gb|EFM75172.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecalis TX2134]
 gi|306511374|gb|EFM80376.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecalis TX0855]
 gi|306515587|gb|EFM84114.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecalis TX4248]
 gi|310627023|gb|EFQ10306.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecalis DAPTO 512]
 gi|310629166|gb|EFQ12449.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecalis TX0102]
 gi|310632255|gb|EFQ15538.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecalis TX0635]
 gi|311288412|gb|EFQ66968.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecalis DAPTO 516]
 gi|315027055|gb|EFT38987.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecalis TX2137]
 gi|315029030|gb|EFT40962.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecalis TX4000]
 gi|315032349|gb|EFT44281.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecalis TX0017]
 gi|315034393|gb|EFT46325.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecalis TX0027]
 gi|315148027|gb|EFT92043.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecalis TX4244]
 gi|315149629|gb|EFT93645.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecalis TX0012]
 gi|315153155|gb|EFT97171.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecalis TX0031]
 gi|315155173|gb|EFT99189.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecalis TX0043]
 gi|315157708|gb|EFU01725.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecalis TX0312]
 gi|315165057|gb|EFU09074.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecalis TX1302]
 gi|315167869|gb|EFU11886.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecalis TX1341]
 gi|315171772|gb|EFU15789.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecalis TX1342]
 gi|315174888|gb|EFU18905.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecalis TX1346]
 gi|315574093|gb|EFU86284.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecalis TX0309B]
 gi|315577222|gb|EFU89413.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecalis TX0630]
 gi|315581758|gb|EFU93949.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecalis TX0309A]
 gi|323480051|gb|ADX79490.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecalis 62]
 gi|327534451|gb|AEA93285.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecalis OG1RF]
          Length = 343

 Score =  266 bits (680), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 155/353 (43%), Positives = 210/353 (59%), Gaps = 17/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           +  ++FDFDLP   IA  P+  R S+RL+VV+        + D    D+   L   DA+V
Sbjct: 2   LSTEDFDFDLPEELIAQTPLKDRASSRLLVVNKETGD---MEDKHFHDILDELQPGDALV 58

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NNT+V+ A+L G +          +   L      ++W    +P+K  K G  + F   
Sbjct: 59  MNNTRVLPARLYGEK----PETGGHLEVLLLTNTEGDTWETLIKPAKRAKVGTEIQF--- 111

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL+A V ++   G  ++ F   GI LE   SL G +PLPPYI  K  +D  D   Y
Sbjct: 112 -GDGRLKAVVKEELEHGGRIIEFKYDGIFLEILESL-GEMPLPPYI--KERLDDPDR--Y 165

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YA+  GS AAPTAGLHFT  LL  + + G+ + ++TLHVG GTF PV V++ ++H M
Sbjct: 166 QTVYAEENGSAAAPTAGLHFTKELLEEIKAKGVHLVYLTLHVGLGTFRPVSVDNIEEHHM 225

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           HSE   +    A+ LN V+  GGRIV+VGTTS+R LET  T+ +G I   SG+T+IFITP
Sbjct: 226 HSEFYRLTEEAAKQLNEVRQAGGRIVAVGTTSIRTLETIGTKFNGEIQADSGWTDIFITP 285

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           GY+F+ V+   +NFHLPKSTL+MLVSAF G + T   YQHAI   YRF+S+GD
Sbjct: 286 GYQFKVVEAFSTNFHLPKSTLVMLVSAFAGKDLTLAAYQHAIEEKYRFFSFGD 338


>gi|315641796|ref|ZP_07896800.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus italicus DSM 15952]
 gi|315482471|gb|EFU73010.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus italicus DSM 15952]
          Length = 343

 Score =  266 bits (680), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 155/353 (43%), Positives = 210/353 (59%), Gaps = 17/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           +  ++FDFDLP   IA  P+  R S+RL+V+         ++D    ++   LN+ DA+V
Sbjct: 2   LTTEDFDFDLPEELIAQTPLTDRASSRLLVLDRKTKE---MADKHFYEIIDELNAGDALV 58

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NNT+V+ A+L GV+          +   L      ++W    +P+K  K G  + F   
Sbjct: 59  MNNTRVLPARLYGVK----EETGAHLELLLLNNTEGDTWETLIKPAKRAKVGTEITF--- 111

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL+A V ++ + G  ++ F   GI LE   SL G +PLPPYI  +     R    Y
Sbjct: 112 -GDGRLKAIVEEELDHGGRMIRFVYEGIFLEILESL-GEMPLPPYIKERLEDPER----Y 165

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL ++ + G+ + ++TLHVG GTF PV V++  +H M
Sbjct: 166 QTVYAKENGSAAAPTAGLHFTKELLEKIQAKGVHLVYLTLHVGLGTFRPVSVDNIAEHEM 225

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           HSE   +    A  L +V+  GGRIV+VGTTS+R LET  T+ DG I   SG+TNIFI P
Sbjct: 226 HSEFYRLTQEAADELTAVRDAGGRIVAVGTTSIRTLETIGTKFDGAIQADSGWTNIFIKP 285

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           GY+F+ VD   +NFHLPKSTL+MLVSAF G E   + YQHAI   YRF+S+GD
Sbjct: 286 GYQFKLVDAFSTNFHLPKSTLVMLVSAFAGREFVLEAYQHAIDEKYRFFSFGD 338


>gi|218236041|ref|YP_002369227.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           cereus B4264]
 gi|228910254|ref|ZP_04074072.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           thuringiensis IBL 200]
 gi|229048127|ref|ZP_04193698.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           cereus AH676]
 gi|229111890|ref|ZP_04241436.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           cereus Rock1-15]
 gi|296504909|ref|YP_003666609.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           thuringiensis BMB171]
 gi|226736732|sp|B7HE52|QUEA_BACC4 RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|218163998|gb|ACK63990.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           cereus B4264]
 gi|228671646|gb|EEL26944.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           cereus Rock1-15]
 gi|228723230|gb|EEL74604.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           cereus AH676]
 gi|228849418|gb|EEM94254.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           thuringiensis IBL 200]
 gi|296325961|gb|ADH08889.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           thuringiensis BMB171]
          Length = 350

 Score =  266 bits (680), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 151/353 (42%), Positives = 209/353 (59%), Gaps = 17/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M +  FDF LP   IA  P+  R+++RLMV+         I     +D+ ++L+  D +V
Sbjct: 1   MDINLFDFHLPEELIAQVPLEDRETSRLMVLDRETGD---IEHKHFTDILSYLHEGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N TKV+ A+L+GV+          I   L  +   + W    +P+K +K+G ++ F   
Sbjct: 58  LNETKVMPARLHGVK----EDTGAHIEVLLLKQEEGDKWETLVKPAKRVKEGTVISF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G+ +L+AT     + G   L FS  GI  E  +  +G +PLPPYI  K  ++ RD   Y
Sbjct: 111 -GEGKLKATCTGTADQGGRQLEFSYDGIFYE-ILDELGEMPLPPYI--KETLEDRDR--Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL +L   G+++ F+TLHVG GTF PV  +  ++H M
Sbjct: 165 QTVYAKEIGSAAAPTAGLHFTEELLEKLKQKGVQLAFITLHVGLGTFRPVSADTIEEHHM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLET-ATTEDGIINPWSGFTNIFITP 299
           H+E   +   TA  LN VK  GGRI++VGTTS R LET AT  DG +   SG+T+IF+ P
Sbjct: 225 HAEYYHMSEETAALLNRVKENGGRIITVGTTSTRTLETIATDHDGKLCAASGWTDIFMYP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           GY F+A+D L++NFHLPKSTL+MLVSAF   +     Y  A+   YRF+S+GD
Sbjct: 285 GYEFKAIDGLITNFHLPKSTLIMLVSAFANRDNVLHAYNEAVKEKYRFFSFGD 337


>gi|52141088|ref|YP_085741.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           cereus E33L]
 gi|81686089|sp|Q634C6|QUEA_BACCZ RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|51974557|gb|AAU16107.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase (queuosine
           biosynthesis protein queA) [Bacillus cereus E33L]
          Length = 350

 Score =  266 bits (680), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 151/353 (42%), Positives = 208/353 (58%), Gaps = 17/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M +  FDF LP   IA  P+  R+++RLMV+         I     +D+ ++L+  D +V
Sbjct: 1   MDINLFDFHLPEELIAQVPLEERETSRLMVLDRETGD---IEHKHFTDILSYLHEGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N TKV+ A+L GV+          I   L  +   + W    +P+K +K+G ++ F   
Sbjct: 58  LNETKVMPARLQGVK----EDTGAHIEVLLLKQEEGDKWETLVKPAKRVKEGTVISF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G+ +L+AT     + G   L FS  GI  E  +  +G +PLPPYI  K  ++ RD   Y
Sbjct: 111 -GEGKLKATCTGTADQGGRQLEFSYDGIFYE-ILDELGEMPLPPYI--KETLEDRDR--Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL +L   G+++ F+TLHVG GTF PV  +  ++H M
Sbjct: 165 QTVYAKEIGSAAAPTAGLHFTEELLEKLKQKGVELAFITLHVGLGTFRPVSADTIEEHHM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLET-ATTEDGIINPWSGFTNIFITP 299
           H+E   +   TA  LN VK  GGRI++VGTTS R LET AT  DG +   SG+T+IF+ P
Sbjct: 225 HAEYYHMSEETAALLNRVKENGGRIITVGTTSTRTLETIATDHDGKLCAASGWTDIFMYP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           GY F+A+D L++NFHLPKSTL+MLVSAF   +     Y  A+   YRF+S+GD
Sbjct: 285 GYEFKAIDGLITNFHLPKSTLIMLVSAFANRDNVLHAYNEAVKEKYRFFSFGD 337


>gi|30022493|ref|NP_834124.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           cereus ATCC 14579]
 gi|229129698|ref|ZP_04258666.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           cereus BDRD-Cer4]
 gi|38372443|sp|Q817W5|QUEA_BACCR RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|29898051|gb|AAP11325.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           cereus ATCC 14579]
 gi|228653815|gb|EEL09685.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           cereus BDRD-Cer4]
          Length = 350

 Score =  266 bits (680), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 151/353 (42%), Positives = 209/353 (59%), Gaps = 17/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M +  FDF LP   IA  P+  R+++RLMV+         I     +D+ ++L+  D +V
Sbjct: 1   MDINLFDFHLPEELIAQVPLEDRETSRLMVLDRETGD---IEHKHFTDILSYLHEGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N TKV+ A+L+GV+          I   L  +   + W    +P+K +K+G ++ F   
Sbjct: 58  LNETKVMPARLHGVK----EDTGAHIEVLLLKQEEGDKWETLVKPAKRVKEGTVISF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G+ +L+AT     + G   L FS  GI  E  +  +G +PLPPYI  K  ++ RD   Y
Sbjct: 111 -GEGKLKATCTGTADQGGRQLEFSYDGIFYE-ILDELGEMPLPPYI--KETLEDRDR--Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL +L   G+++ F+TLHVG GTF PV  +  ++H M
Sbjct: 165 QTVYAKEIGSAAAPTAGLHFTEELLEKLKQKGVQLAFITLHVGLGTFRPVSADTIEEHHM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLET-ATTEDGIINPWSGFTNIFITP 299
           H+E   +   TA  LN VK  GGRI++VGTTS R LET AT  DG +   SG+T+IF+ P
Sbjct: 225 HAEYYHMSEETAALLNRVKQNGGRIITVGTTSTRTLETIATDHDGKLCAASGWTDIFMYP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           GY F+A+D L++NFHLPKSTL+MLVSAF   +     Y  A+   YRF+S+GD
Sbjct: 285 GYEFKAIDGLITNFHLPKSTLIMLVSAFANRDNVLHAYNEAVKEKYRFFSFGD 337


>gi|309388952|gb|ADO76832.1| S-adenosylmethionine--tRNA ribosyltransferase-isomerase
           [Halanaerobium praevalens DSM 2228]
          Length = 347

 Score =  266 bits (680), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 150/362 (41%), Positives = 213/362 (58%), Gaps = 19/362 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V+EF++ LP   IA +P+  RD +RLMV++P      +I +++  +L  +L+  D I+
Sbjct: 1   MKVEEFNYQLPEELIAQKPLSKRDESRLMVLNPEQQ---IIEENIFKNLKEYLDPGDMII 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NN++VI A+L G +          I   L   +S   W V  RP +  KKG  + F   
Sbjct: 58  MNNSRVIPARLYGAKIPTGTE----IELLLLNELSEGRWEVLVRPGRRAKKGVKIKF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSI--SGIELERQISLVGTIPLPPYIARKRPIDARDYV 178
             Q  LEA V++  + G  ++ FS        E  ++ +G +PLPPYI  K     R   
Sbjct: 111 --QDILEAEVVEYTDFGGRIVEFSWDHKKYNFEEVLNQLGEMPLPPYINEKLDDPER--- 165

Query: 179 DYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDH 238
            YQT Y+K +GS AAPTAGLHFT +LL  L   GI + ++TLHVG GTF PVK E+ ++H
Sbjct: 166 -YQTVYSKKRGSAAAPTAGLHFTDSLLKELEEYGIILDYITLHVGLGTFRPVKSENIEEH 224

Query: 239 IMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFIT 298
            MH E   I A TA  +  VK++G ++V+VGTT  R LE+A   +G ++ + G+T+IFI 
Sbjct: 225 EMHEEYAEISAETAAKIKKVKTQGNKVVAVGTTVTRTLESAAA-NGELSEYQGWTDIFIY 283

Query: 299 PGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLFQ 358
           PGY F+ +D L++NFHLPKSTLLMLVSA  G E     YQ A+   YRF+S GD  L+  
Sbjct: 284 PGYEFKVIDSLITNFHLPKSTLLMLVSALAGKELVLSAYQKAVEKEYRFFSLGDAMLILN 343

Query: 359 KR 360
           ++
Sbjct: 344 RK 345


>gi|148985629|ref|ZP_01818783.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae SP3-BS71]
 gi|148993024|ref|ZP_01822618.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae SP9-BS68]
 gi|168489581|ref|ZP_02713780.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae SP195]
 gi|147922110|gb|EDK73232.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae SP3-BS71]
 gi|147928225|gb|EDK79242.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae SP9-BS68]
 gi|183571952|gb|EDT92480.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae SP195]
 gi|301800281|emb|CBW32901.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae OXC141]
 gi|332073723|gb|EGI84202.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae GA17570]
          Length = 342

 Score =  266 bits (680), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 153/358 (42%), Positives = 209/358 (58%), Gaps = 17/358 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +FDF LP   IA  P+  RD+++L++V+        + D     +   L   DA+V
Sbjct: 1   MNTADFDFHLPEELIAQTPLEKRDASKLLIVNRETGE---MQDKHFHSIINMLEPGDALV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+V+ A+L G +          +   L    S + W V A+P+K +K G  + F   
Sbjct: 58  MNDTRVLPARLYGQKV----ETGGHVELLLLKNTSGDEWEVLAKPAKRLKVGTRISF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL A V ++   G  ++ F   GI LE   SL G +PLPPYI  K  +D R+   Y
Sbjct: 111 -GDGRLSAVVTEELTHGGRIVRFEYQGIFLEVLESL-GEMPLPPYIHEK--LDDRE--RY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL+ + + G+ + ++TLHVG GTF PV V++ D+H M
Sbjct: 165 QTVYAKESGSAAAPTAGLHFTKELLAEIQAKGVHLVYLTLHVGLGTFRPVSVDNLDEHEM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           HSE   +    A  L SVK  GGR+++VGTTS+R LET  ++ DG I   SG+TNIFI P
Sbjct: 225 HSEFYQLSEEAAATLRSVKKNGGRVIAVGTTSIRTLETIGSKFDGQIQADSGWTNIFIKP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           GY ++ VD   +NFHLPKSTL+MLVSAF G E     Y H+I   YRF+S+GD   ++
Sbjct: 285 GYEWKVVDAFSTNFHLPKSTLVMLVSAFAGRELVLDAYHHSIQEHYRFFSFGDAMFIY 342


>gi|228981109|ref|ZP_04141410.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           thuringiensis Bt407]
 gi|228778650|gb|EEM26916.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           thuringiensis Bt407]
 gi|326942199|gb|AEA18095.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           thuringiensis serovar chinensis CT-43]
          Length = 350

 Score =  266 bits (680), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 151/353 (42%), Positives = 209/353 (59%), Gaps = 17/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M +  FDF LP   IA  P+  R+++RLMV+         I     +D+ ++L+  D +V
Sbjct: 1   MDINLFDFHLPEELIAQVPLEDRETSRLMVLDRETGD---IEHKHFTDILSYLHEGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N TKV+ A+L+GV+          I   L  +   + W    +P+K +K+G ++ F   
Sbjct: 58  LNETKVMPARLHGVK----EDTGAHIEVLLLKQEEGDKWETLVKPAKRVKEGTVISF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G+ +L+AT     + G   L FS  GI  E  +  +G +PLPPYI  K  ++ RD   Y
Sbjct: 111 -GEGKLKATCTGTADQGGRQLEFSYDGIFYE-ILDELGEMPLPPYI--KETLEDRDR--Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL +L   G+++ F+TLHVG GTF PV  +  ++H M
Sbjct: 165 QTVYAKEIGSAAAPTAGLHFTEELLEKLKQKGVQLAFITLHVGLGTFRPVSADTIEEHHM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLET-ATTEDGIINPWSGFTNIFITP 299
           H+E   +   TA  LN VK  GGRI++VGTTS R LET AT  DG +   SG+T+IF+ P
Sbjct: 225 HAEYYHMSEETATLLNRVKENGGRIITVGTTSTRTLETIATDHDGKLCAASGWTDIFMYP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           GY F+A+D L++NFHLPKSTL+MLVSAF   +     Y  A+   YRF+S+GD
Sbjct: 285 GYEFKAIDGLITNFHLPKSTLIMLVSAFANRDNVLHAYNEAVKEKYRFFSFGD 337


>gi|257866741|ref|ZP_05646394.1| queuosine biosynthesis protein [Enterococcus casseliflavus EC30]
 gi|257872742|ref|ZP_05652395.1| queuosine biosynthesis protein [Enterococcus casseliflavus EC10]
 gi|257800699|gb|EEV29727.1| queuosine biosynthesis protein [Enterococcus casseliflavus EC30]
 gi|257806906|gb|EEV35728.1| queuosine biosynthesis protein [Enterococcus casseliflavus EC10]
          Length = 343

 Score =  266 bits (680), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 155/357 (43%), Positives = 210/357 (58%), Gaps = 17/357 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           +  ++FDFDLP   IA  P+  R S+RL+VV           D    ++   L   DA+V
Sbjct: 2   LTTEDFDFDLPEELIAQTPLSDRSSSRLLVVDRETGK---FEDKHFYNIIDELAPGDALV 58

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+V+ A++ G +          +   L   +  ++W    +P+K  K G  + F   
Sbjct: 59  MNDTRVLPARIYGEK----QETGAHLEILLLNNIEGDTWETLIKPAKRAKVGTKITF--- 111

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RLEA V ++ + G  ++ F   GI LE   SL G +PLPPYI  +      D   Y
Sbjct: 112 -GDGRLEAVVEEELDHGGRIIRFQYKGIFLEILESL-GEMPLPPYIKER----LEDPDRY 165

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL ++ + G+K+ ++TLHVG GTF PV V++  DH M
Sbjct: 166 QTVYAKENGSAAAPTAGLHFTPELLEQIAAKGVKLVYLTLHVGLGTFRPVSVDNIADHEM 225

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           HSE   +    A  LN V++ GG+IV+VGTTS+R LET  T+ DG I   SG+T+IFITP
Sbjct: 226 HSEFYRLTEEAAAQLNEVRANGGKIVAVGTTSIRTLETIGTKFDGQIKADSGWTSIFITP 285

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           GY+F+ V+   +NFHLPKSTL+MLVSAF G + T   YQHAI   YRF+S+GD   L
Sbjct: 286 GYQFKIVEAFSTNFHLPKSTLVMLVSAFAGRDLTLSAYQHAIDERYRFFSFGDAMFL 342


>gi|15901270|ref|NP_345874.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae TIGR4]
 gi|111658609|ref|ZP_01409266.1| hypothetical protein SpneT_02000284 [Streptococcus pneumoniae
           TIGR4]
 gi|225860804|ref|YP_002742313.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae Taiwan19F-14]
 gi|298229585|ref|ZP_06963266.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae str. Canada MDR_19F]
 gi|298255442|ref|ZP_06979028.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae str. Canada MDR_19A]
 gi|298502633|ref|YP_003724573.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae TCH8431/19A]
 gi|21263901|sp|Q97Q15|QUEA_STRPN RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|14972905|gb|AAK75514.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae TIGR4]
 gi|225726590|gb|ACO22441.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae Taiwan19F-14]
 gi|298238228|gb|ADI69359.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae TCH8431/19A]
          Length = 342

 Score =  266 bits (680), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 154/358 (43%), Positives = 210/358 (58%), Gaps = 17/358 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +FDF LP   IA  P+  RD+++L++V+           H + D+   L   DA+V
Sbjct: 1   MNTADFDFHLPEELIAQTPLEKRDASKLLIVNRETGEMQDKHFHSIIDM---LEPGDALV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+V+ A+L G +          +   L    S + W V A+P+K +K G  + F   
Sbjct: 58  MNDTRVLPARLYGQKV----ETGGHVELLLLKNTSGDEWEVLAKPAKRLKVGTRISF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL A V ++   G  ++ F   GI LE   SL G +PLPPYI  K  +D R+   Y
Sbjct: 111 -GDGRLSAVVTEELTHGGRIVRFEYQGIFLEVLESL-GEMPLPPYIHEK--LDDRER--Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL+ + + G+ + ++TLHVG GTF PV V++ D+H M
Sbjct: 165 QTVYAKESGSAAAPTAGLHFTKELLAEIQAKGVHLVYLTLHVGLGTFRPVSVDNLDEHEM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           HSE   +    A  L SVK  GGR+++VGTTS+R LET  ++ DG I   SG+TNIFI P
Sbjct: 225 HSEFYQLSEEAAATLRSVKKNGGRVIAVGTTSIRTLETIGSKFDGQIQADSGWTNIFIKP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           GY ++ VD   +NFHLPKSTL+MLVSAF G E     Y H+I   YRF+S+GD   ++
Sbjct: 285 GYEWKVVDAFSTNFHLPKSTLVMLVSAFAGRELVLDAYHHSIQEHYRFFSFGDAMFIY 342


>gi|261405411|ref|YP_003241652.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Paenibacillus sp. Y412MC10]
 gi|261281874|gb|ACX63845.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Paenibacillus sp. Y412MC10]
          Length = 343

 Score =  266 bits (680), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 149/359 (41%), Positives = 210/359 (58%), Gaps = 18/359 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  +DF+LP   IA  P+  R S+RL+ ++        IS    +D+   LN  D +V
Sbjct: 1   MNVDLYDFELPEHLIAQTPLLDRSSSRLLTLNKKSGQ---ISHQTFADIIDSLNPGDTLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+TKVI A+L G +     + E      L   +  + W    +P K +KKG+++ F   
Sbjct: 58  LNDTKVIPARLFGEKEDTGAKAE----VLLLKNMGEDRWEALVKPGKKLKKGNVISF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  +L+A + ++   G   L FS  GI  +  +  +G +PLPPYI  K  +D RD   Y
Sbjct: 111 -GDGKLKAVIEEEGEMGARTLSFSYKGI-FQEILDELGQMPLPPYIKEK--LDDRDR--Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK +GS AAPTAGLHFT  LL ++ + G+ + F+TLHVG GTF P+ V+  +DH+M
Sbjct: 165 QTVYAKHEGSAAAPTAGLHFTEALLEQIRAKGVDIAFITLHVGLGTFRPMSVDQVEDHVM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE--DGIINPWSGFTNIFIT 298
           H E   +   TA  LN  K RGGR+++VGTTS R LET  ++     ++  SG+T+IFI 
Sbjct: 225 HEEYYSLSQETADLLNETKRRGGRVIAVGTTSCRTLETVGSQLKGEPLHESSGWTSIFIY 284

Query: 299 PGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           PGY F  VD L++NFHLPKSTL+MLVSA  G E     Y+ A+   YRF+S+GD   ++
Sbjct: 285 PGYSFTVVDALITNFHLPKSTLVMLVSALAGREHIMHAYKEAVDKEYRFFSFGDAMFIY 343


>gi|322385861|ref|ZP_08059504.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus cristatus ATCC 51100]
 gi|321270146|gb|EFX53063.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus cristatus ATCC 51100]
          Length = 342

 Score =  266 bits (680), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 153/353 (43%), Positives = 210/353 (59%), Gaps = 17/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +FDF LP   IA  P+  RDS+RL++V          SD    ++   L   DA+V
Sbjct: 1   MNTADFDFHLPEELIAQTPLEKRDSSRLLIVDRETGQ---FSDQHFDNIIDQLEPGDALV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NNT+V+ A+L G +          +   L      + W V A+P+K ++ G  + F   
Sbjct: 58  MNNTRVLPARLYGTK----PETGGHVELLLLKNTQGDFWEVLAKPAKRLRVGTRVSF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL ATV ++   G  ++ F   GI LE   SL G +PLPPYI  K      D   Y
Sbjct: 111 -GDGRLTATVTEELEHGGRIVRFDYQGIFLEVLESL-GEMPLPPYIHEK----LEDRERY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL ++ + G+K+ ++TLHVG GTF PV V++ ++H M
Sbjct: 165 QTVYAKENGSAAAPTAGLHFTEELLDKIAAKGVKLVYLTLHVGLGTFRPVSVDNLEEHEM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           HSE   +    A+ L  VK+ G RI++VGTTS+R LET  ++ +G I   SG+TNIFI P
Sbjct: 225 HSEFYSLSEEAAETLRQVKASGHRIIAVGTTSIRTLETIGSKFEGQIQADSGWTNIFIKP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           GY+++ VD   +NFHLPKSTL+MLVSAF G + T + Y++AI+  YRF+S+GD
Sbjct: 285 GYQWKIVDAFSTNFHLPKSTLVMLVSAFAGRQLTLEAYEYAIAERYRFFSFGD 337


>gi|114326953|ref|YP_744110.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Granulibacter bethesdensis CGDNIH1]
 gi|114315127|gb|ABI61187.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Granulibacter bethesdensis CGDNIH1]
          Length = 361

 Score =  266 bits (680), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 155/361 (42%), Positives = 212/361 (58%), Gaps = 22/361 (6%)

Query: 3   VKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIVFN 62
           + +F FDLPP RIA  P  PR+SARL+ V         + DH + DLP  L   D +V N
Sbjct: 8   IADFTFDLPPERIAHEPARPRESARLLHVPAGEEG---VHDHHIRDLPDLLRPGDVLVAN 64

Query: 63  NTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQDG 122
           +T+VI AQL   R       +  I  TL+  +   SW V AR ++ ++ GD L F   D 
Sbjct: 65  DTRVIPAQLTAWRG------QARIGLTLNRPLPDGSWHVLARNARRLRAGDRLRFTEHDT 118

Query: 123 QSR-------LEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDAR 175
           QS        L A V+ +   G  +L F     + +  ++  G + LPPYI R +   A+
Sbjct: 119 QSTHTQPTGMLAAEVVARDEDGGAILRFVAE--DFDAALAQYGALALPPYIDRPQGPTAQ 176

Query: 176 DYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDT 235
           D  DYQT +A+ +G+VAAPTAGLHFT  LL RL + GI+   +TLHVGAGTF+P++ +  
Sbjct: 177 DAKDYQTVFARHRGAVAAPTAGLHFTPALLDRLAAKGIERVTITLHVGAGTFLPMRDDTI 236

Query: 236 DDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNI 295
           + H +H+E G I    A  +N+ K    R+++VGTTSLRLLE+A    G + P+   T+I
Sbjct: 237 EAHRLHAERGVITPEAASRINAAK----RVIAVGTTSLRLLESAADAAGGVRPFDAETDI 292

Query: 296 FITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSL 355
           FI PG+RFR    L++NFHLP+STL MLV AF G    +  Y +AI+ AYRFYSYGD  L
Sbjct: 293 FIKPGHRFRTAHALLTNFHLPRSTLFMLVCAFAGTARMRAAYAYAIAEAYRFYSYGDACL 352

Query: 356 L 356
           +
Sbjct: 353 I 353


>gi|15892206|ref|NP_359920.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Rickettsia
           conorii str. Malish 7]
 gi|21263890|sp|Q92IY7|QUEA_RICCN RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|15619340|gb|AAL02821.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Rickettsia
           conorii str. Malish 7]
          Length = 365

 Score =  266 bits (679), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 147/387 (37%), Positives = 228/387 (58%), Gaps = 50/387 (12%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FDFDLP   IA  P   RD++ L++    ++ P+    + + D   +L   D +V
Sbjct: 1   MKLSDFDFDLPSELIAQYPSSERDNSDLLIA---VTPPIKTKFYNIID---YLKEGDLLV 54

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FNN+KVI A+LN           K I+  L+ ++S ++WS +A+P++ +   D  +F + 
Sbjct: 55  FNNSKVIKAKLN---------LGKNITINLNQKLSDDNWSAFAKPARKLHVNDEFYFDNH 105

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPI-------- 172
                 +  + +K   GEI + F ++ I +   ++  G +PLP YI R   +        
Sbjct: 106 ------KVIITEKLAMGEIKVKFELNDISVFEFLNKYGEMPLPVYIRRSHSLCHPVATTT 159

Query: 173 DARDYVD--------------------YQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIG 212
            ++ Y++                    YQT Y++I+GSVAAPTAGLHFT ++L +L + G
Sbjct: 160 GSKTYLNNDWIPWSNHGMTNTQNDNDRYQTVYSQIEGSVAAPTAGLHFTKDILDKLKAEG 219

Query: 213 IKVYFVTLHVGAGTFMPVKVEDTDDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTS 272
           I+  F+TLHVGAGTF+PVK E+  +H MH+E   I   TA+ +N  K  G RI++VGTT+
Sbjct: 220 IQATFLTLHVGAGTFLPVKTENIHEHKMHTEYCSITPDTAEIINKAKQEGKRIIAVGTTT 279

Query: 273 LRLLETATTEDGIINPWSGFTNIFITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEE 332
           LR LE++   +GI+   S  T+IFITPG++F+  D+L++NFH PKSTL ML+ AF G +E
Sbjct: 280 LRTLESSCN-NGIVKAGSFKTDIFITPGFKFQTADMLLTNFHFPKSTLFMLICAFAGFKE 338

Query: 333 TKKMYQHAISHAYRFYSYGDTSLLFQK 359
             ++Y++AI  A RF+SYGD +LL +K
Sbjct: 339 MHELYKYAIKEAMRFFSYGDATLLCRK 365


>gi|269215268|ref|ZP_05988032.2| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Neisseria
           lactamica ATCC 23970]
 gi|269207922|gb|EEZ74377.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Neisseria
           lactamica ATCC 23970]
          Length = 356

 Score =  266 bits (679), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 153/356 (42%), Positives = 209/356 (58%), Gaps = 18/356 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FDF LP   IA  P   R S+RL+V  P++S    + D +  DLP ++ + D +V
Sbjct: 11  MDISDFDFTLPEKLIAQHPPEVRGSSRLLVALPDMS----LQDRVFGDLPDYVEAGDVLV 66

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FNNTKV+ A+L G +          I   +   +  ++   + R SK  K G  L F   
Sbjct: 67  FNNTKVMKARLFGQKDSG-----GRIEALIERVLDNHTALAHIRSSKSPKPGMGLVF--- 118

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
             +  + A ++ +   GE+  +    G  +   +   G +PLPPYI  +R  DA D   Y
Sbjct: 119 --EGGIRAVMVGR--EGELFCLRFEGGQTVYELLEQNGHLPLPPYI--ERAADADDDSRY 172

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK QG+VAAPTAGLHFT  LL RL   G     VTLHVGAGTF PV+VE  ++H M
Sbjct: 173 QTVYAKYQGAVAAPTAGLHFTEELLRRLKDKGAVTAEVTLHVGAGTFQPVRVEKIEEHKM 232

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   + + T  A+ + K+RG ++ +VGTTS+R LE+A    G +    G T+IFITPG
Sbjct: 233 HSEWFEVPSETVTAVEAAKARGNKVWAVGTTSMRALESAARATGRLKAGQGDTDIFITPG 292

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           YRF  VD L++NFHLPKSTLLMLVSAF G+   +  Y++A+   YRF+SYGD  +L
Sbjct: 293 YRFNVVDRLVTNFHLPKSTLLMLVSAFSGMGHIRAAYRYAVEREYRFFSYGDAMIL 348


>gi|229019642|ref|ZP_04176452.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           cereus AH1273]
 gi|229025880|ref|ZP_04182276.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           cereus AH1272]
 gi|228735432|gb|EEL86031.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           cereus AH1272]
 gi|228741645|gb|EEL91835.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           cereus AH1273]
          Length = 350

 Score =  266 bits (679), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 151/353 (42%), Positives = 210/353 (59%), Gaps = 17/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M +  FDF LP   IA  P+  R+++RLMV+         I     +D+ ++L+  D +V
Sbjct: 1   MDINLFDFHLPEELIAQVPLEDRETSRLMVLDRETGD---IEHKHFTDILSYLHEGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N TKV+ A+L+GV+          I   L  +   ++W    +P+K +K+G ++ F   
Sbjct: 58  LNETKVMPARLHGVK----EDTGAHIEVLLLKQEEGDTWETLVKPAKRVKEGTVISF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G+ +L+AT     + G   L FS  GI  E  +  +G +PLPPYI  K  ++ RD   Y
Sbjct: 111 -GEGKLKATCTGTADQGGRQLEFSYDGIFYE-ILDELGEMPLPPYI--KETLEDRDR--Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL +L   G+++ F+TLHVG GTF PV  +  ++H M
Sbjct: 165 QTVYAKEIGSAAAPTAGLHFTEELLEKLKQKGVQLAFITLHVGLGTFRPVSADTIEEHHM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLET-ATTEDGIINPWSGFTNIFITP 299
           H+E   +   TA  LN VK  GGRI++VGTTS R LET AT  DG +   SG+T+IF+ P
Sbjct: 225 HAEYYHMSEETAVLLNRVKENGGRIITVGTTSTRTLETIATDHDGKLCAASGWTDIFMYP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           GY F+A+D L++NFHLPKSTL+MLVSAF   +     Y  A+   YRF+S+GD
Sbjct: 285 GYEFKAIDGLITNFHLPKSTLIMLVSAFSNRDNVLHAYNEAVKEKYRFFSFGD 337


>gi|228475167|ref|ZP_04059893.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus hominis SK119]
 gi|314936247|ref|ZP_07843594.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus hominis subsp. hominis C80]
 gi|228270778|gb|EEK12180.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus hominis SK119]
 gi|313654866|gb|EFS18611.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus hominis subsp. hominis C80]
          Length = 341

 Score =  266 bits (679), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 150/356 (42%), Positives = 208/356 (58%), Gaps = 16/356 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V+EFD+ LP S IA  P+  RD +RL+V+         I+    +D+  +  + D +V
Sbjct: 1   MNVEEFDYHLPESLIAQTPLKNRDQSRLLVLGRKTGN---IAHKHFTDIMDYFETGDTLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+V+ A+L G++         ++   +  R+  N W V  +P+K IK G+ L F   
Sbjct: 58  LNDTRVMPARLFGLK----EETGAKVEMLMLTRIEDNDWEVLLKPAKRIKVGNTLSF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  ++ A  I +   G  ++     GI LE ++  +G +PLPPYI  K  +D  D   Y
Sbjct: 111 -GNGKIIAECIKELEQGGRIMRLHFEGI-LEERLDELGEMPLPPYI--KERLDDPDR--Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL ++   G+ + F+TLHVG GTF PV VED +DH M
Sbjct: 165 QTVYAKENGSAAAPTAGLHFTDELLQKIKDKGVNIAFITLHVGLGTFRPVSVEDINDHEM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   +   TA  LN  K  G RI+SVGTTS R LET   +       SG+T+IFI PG
Sbjct: 225 HSEYYQMTKETADILNKTKENGHRIISVGTTSTRTLETIRRDHEQFVATSGWTDIFIYPG 284

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           + ++A+D L++NFHLPKSTL+MLVSAF   E     Y+ A+   YRF+S+GD  L+
Sbjct: 285 FEYKAIDGLITNFHLPKSTLVMLVSAFSSREYILNAYKEAVKLKYRFFSFGDAMLI 340


>gi|34580774|ref|ZP_00142254.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Rickettsia
           sibirica 246]
 gi|28262159|gb|EAA25663.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Rickettsia
           sibirica 246]
          Length = 365

 Score =  266 bits (679), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 148/387 (38%), Positives = 227/387 (58%), Gaps = 50/387 (12%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FDFDLP   IA  P   RD++ L++    ++ P+    + + D   +L   D +V
Sbjct: 1   MKLSDFDFDLPSELIAQYPSSERDNSDLLIA---VTPPIKTKFYNIID---YLKEGDLLV 54

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FNN+KVI A+LN           K I+  L+ ++S +SWS +A+P++ +   D  +F + 
Sbjct: 55  FNNSKVIKAKLN---------LGKNITINLNQKLSDDSWSAFAKPARKLHVNDEFYFDNH 105

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPI-------- 172
                 +  + +K   GEI + F ++ I +   ++  G +PLP YI R   +        
Sbjct: 106 ------KVIITEKLAMGEIKVKFELNDISVFEFLNKYGEMPLPVYIRRSHSLCHPVATTT 159

Query: 173 DARDYVD--------------------YQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIG 212
            ++ Y++                    YQT Y++I+GSVAAPTAGLHFT ++L +L + G
Sbjct: 160 GSKAYLNNDWIPWSNHGMTNTQNDNDRYQTVYSQIEGSVAAPTAGLHFTKDILDKLKAEG 219

Query: 213 IKVYFVTLHVGAGTFMPVKVEDTDDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTS 272
           I+  F+TLHVGAGTF+PVK E+  +H MH+E   I   TA  +N  K  G RI++VGTT+
Sbjct: 220 IQATFLTLHVGAGTFLPVKTENIHEHKMHTEYCSITPDTADIINKAKQEGKRIIAVGTTT 279

Query: 273 LRLLETATTEDGIINPWSGFTNIFITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEE 332
           LR LE++   +GI+   S  T+IFITPG++F+  D+L++NFH PKSTL ML+ AF G +E
Sbjct: 280 LRTLESSCN-NGIVKAGSFKTDIFITPGFKFQTADMLLTNFHFPKSTLFMLICAFAGFKE 338

Query: 333 TKKMYQHAISHAYRFYSYGDTSLLFQK 359
             ++Y++AI  A RF+SYGD +LL +K
Sbjct: 339 MHELYKYAIKEAMRFFSYGDATLLCRK 365


>gi|307706877|ref|ZP_07643679.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus mitis SK321]
 gi|307617750|gb|EFN96915.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus mitis SK321]
          Length = 342

 Score =  266 bits (679), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 154/358 (43%), Positives = 212/358 (59%), Gaps = 17/358 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +FDF LP   IA  P+  RD+++L++V  N     +  +H  S +   L   DA+V
Sbjct: 1   MNTADFDFHLPEELIAQTPLEKRDASKLLIV--NRETGEMQDNHFHS-IIDMLEPGDALV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+V+ A+L G +          +   L    + + W V A+P+K +K G  + F   
Sbjct: 58  MNDTRVLPARLYGQK----EETGGHVELLLLKNTAGDEWEVLAKPAKRLKVGTRVSF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL A V ++   G  ++ F   GI LE   SL G +PLPPYI  K  +D R+   Y
Sbjct: 111 -GDGRLSAVVTEELTHGGRIVRFEYQGIFLEVLESL-GEMPLPPYIHEK--LDDRER--Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL+ + + G+ + ++TLHVG GTF PV V++ D+H M
Sbjct: 165 QTVYAKESGSAAAPTAGLHFTKELLAEIQAKGVHLVYLTLHVGLGTFRPVSVDNLDEHEM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           HSE   +    A  L SVK  G R+++VGTTS+R LET  ++ DG I   SG+TNIFI P
Sbjct: 225 HSEFYQLSEEAAATLRSVKENGSRVIAVGTTSIRTLETIGSKFDGQIQADSGWTNIFIKP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           GY ++ VD   +NFHLPKSTL+MLVSAF G +     YQHAI+  YRF+S+GD   ++
Sbjct: 285 GYEWKVVDAFSTNFHLPKSTLVMLVSAFAGRDLVLDAYQHAINERYRFFSFGDAMFIY 342


>gi|297584755|ref|YP_003700535.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase [Bacillus
           selenitireducens MLS10]
 gi|297143212|gb|ADH99969.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase [Bacillus
           selenitireducens MLS10]
          Length = 351

 Score =  266 bits (679), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 150/356 (42%), Positives = 210/356 (58%), Gaps = 16/356 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  FD++LP   IA  P+  R+ +RL+V+         +S    S +   LN  DA+V
Sbjct: 1   MDVSAFDYELPEELIAQTPLKNREESRLLVMERTTGD---LSHQTFSSVIDHLNPGDALV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+TKVI A+L G++         +I   L      + W    +P+K +KKG ++ F   
Sbjct: 58  LNDTKVIPARLFGIK----KETGAKIEVLLLKEQDDHVWEALVKPAKRLKKGTVISF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G+  L+A    +   G  LL FS  G+  ER +  +G +PLPPYI  +  +D +D   Y
Sbjct: 111 -GEGVLQAECTGELPEGRRLLRFSFDGVFHER-LDDLGEMPLPPYIQEQ--LDEKDR--Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YA  +GS AAPTAGLHFT +LL ++ + GI+  F+TLHVG GTF PV V+  +DH M
Sbjct: 165 QTVYAANRGSAAAPTAGLHFTPDLLEKIRAKGIRTVFLTLHVGLGTFRPVSVDTVEDHTM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           H+E       +A+AL   ++RGGRI++VGTTS R LET   +       SG+T+IFI PG
Sbjct: 225 HAEFYQFSEASARALRETRARGGRIIAVGTTSARTLETIVRDHDDFAAASGWTDIFIYPG 284

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           YRF+ +D L++NFHLPKSTL+MLVSAF   E     Y+ A+   YRF+S+GD  L+
Sbjct: 285 YRFQGIDGLLTNFHLPKSTLVMLVSAFSKREFVLDAYREAVRERYRFFSFGDAMLI 340


>gi|73662428|ref|YP_301209.1| S-adenosylmethionine tRNA ribosyltransferase [Staphylococcus
           saprophyticus subsp. saprophyticus ATCC 15305]
 gi|91207328|sp|Q49Y78|QUEA_STAS1 RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|72494943|dbj|BAE18264.1| S-adenosylmethionine tRNA ribosyltransferase [Staphylococcus
           saprophyticus subsp. saprophyticus ATCC 15305]
          Length = 341

 Score =  266 bits (679), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 147/356 (41%), Positives = 211/356 (59%), Gaps = 16/356 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M ++ FD+ LP + IA  P+  RD +RL+++         I      D+  +LN  D +V
Sbjct: 1   MDIEAFDYHLPEALIAQTPLKNRDESRLLILGRQSGY---IEHKHFKDVTDYLNEGDTLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+V+ A+L G++         ++   +  ++  N W V  +P+K IK G+ L F   
Sbjct: 58  LNDTRVMPARLFGMK----EETGAKVEMLMLTQIEGNDWEVLLKPAKRIKVGNKLTF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G+ ++ A  I++ + G  ++     GI L+ ++  +G +PLPPYI  K  +D  D   Y
Sbjct: 111 -GEGKIIAECIEELDQGGRIMRLHYDGI-LQERLDELGEMPLPPYI--KERLD--DQERY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL R+ + G+ + F+TLHVG GTF PV V++ DDH M
Sbjct: 165 QTVYAKASGSAAAPTAGLHFTDELLERIKAQGVNIAFITLHVGLGTFRPVSVDNIDDHEM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   +D  TA  LNS +  G RI+SVGTTS R LET           SG+T+IFI PG
Sbjct: 225 HSEYYQMDEATANLLNSTRDNGNRIISVGTTSTRTLETIMQSSDRFVAKSGWTDIFIFPG 284

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           + F+A+D L++NFHLPKSTL+MLVSAF   +     Y  A++  YRF+S+GD  L+
Sbjct: 285 FNFKAIDGLITNFHLPKSTLVMLVSAFSSRDYIINAYNQAVASEYRFFSFGDAMLI 340


>gi|229071926|ref|ZP_04205137.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           cereus F65185]
 gi|228711222|gb|EEL63186.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           cereus F65185]
          Length = 350

 Score =  266 bits (679), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 151/353 (42%), Positives = 209/353 (59%), Gaps = 17/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M +  FDF LP   IA  P+  R+++RLMV+         I     +D+ ++L+  D +V
Sbjct: 1   MDINLFDFHLPEELIAQVPLEERETSRLMVLDRETGD---IEHKHFTDILSYLHEGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N TKV+ A+L+GV+          I   L  +   + W    +P+K +K+G ++ F   
Sbjct: 58  LNETKVMPARLHGVK----EDTGAHIEVLLLKQEEGDKWETLVKPAKRVKEGTVISF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G+ +L+AT     + G   L FS  GI  E  +  +G +PLPPYI  K  ++ RD   Y
Sbjct: 111 -GEGKLKATCTGTADQGGRQLEFSYDGIFYE-ILDELGEMPLPPYI--KETLEDRDR--Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL +L   G+++ F+TLHVG GTF PV  +  ++H M
Sbjct: 165 QTVYAKEIGSAAAPTAGLHFTEELLEKLKQKGVQLAFITLHVGLGTFRPVSADTIEEHHM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLET-ATTEDGIINPWSGFTNIFITP 299
           H+E   +   TA  LN VK  GGRI++VGTTS R LET AT  DG +   SG+T+IF+ P
Sbjct: 225 HAEYYHMSEETAALLNRVKENGGRIITVGTTSTRTLETIATDHDGKLCAASGWTDIFMYP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           GY F+A+D L++NFHLPKSTL+MLVSAF   +     Y  A+   YRF+S+GD
Sbjct: 285 GYEFKAIDGLITNFHLPKSTLIMLVSAFANRDNVLHAYNAAVKEKYRFFSFGD 337


>gi|300859629|ref|ZP_07105717.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecalis TUSoD Ef11]
 gi|300850447|gb|EFK78196.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecalis TUSoD Ef11]
 gi|315145163|gb|EFT89179.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecalis TX2141]
 gi|315163072|gb|EFU07089.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecalis TX0645]
          Length = 343

 Score =  266 bits (679), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 155/353 (43%), Positives = 209/353 (59%), Gaps = 17/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           +  ++FDFDLP   IA  P+  R S+RL+VV+          D    D+   L   DA+V
Sbjct: 2   LSTEDFDFDLPEELIAQTPLKDRASSRLLVVNKETGD---TEDKHFHDILDELQPGDALV 58

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NNT+V+ A+L G +          +   L      ++W    +P+K  K G  + F   
Sbjct: 59  MNNTRVLPARLYGEK----PETGGHLEVLLLTNTEGDTWETLIKPAKRAKVGTEIQF--- 111

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL+A V ++   G  ++ F   GI LE   SL G +PLPPYI  K  +D  D   Y
Sbjct: 112 -GDGRLKAVVKEELEHGGRIIEFKYDGIFLEILESL-GEMPLPPYI--KERLDDPDR--Y 165

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YA+  GS AAPTAGLHFT  LL  + + G+ + ++TLHVG GTF PV V++ ++H M
Sbjct: 166 QTVYAEENGSAAAPTAGLHFTKELLEEIKAKGVHLVYLTLHVGLGTFRPVSVDNIEEHHM 225

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           HSE   +    A+ LN V+  GGRIV+VGTTS+R LET  T+ +G I   SG+T+IFITP
Sbjct: 226 HSEFYRLTEEAAKQLNEVRQAGGRIVAVGTTSIRTLETIGTKFNGEIQADSGWTDIFITP 285

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           GY+F+ V+   +NFHLPKSTL+MLVSAF G + T   YQHAI   YRF+S+GD
Sbjct: 286 GYQFKVVEAFSTNFHLPKSTLVMLVSAFAGKDLTLAAYQHAIEEKYRFFSFGD 338


>gi|220916512|ref|YP_002491816.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Anaeromyxobacter dehalogenans 2CP-1]
 gi|254764262|sp|B8JH48|QUEA_ANAD2 RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|219954366|gb|ACL64750.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 345

 Score =  266 bits (679), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 156/359 (43%), Positives = 209/359 (58%), Gaps = 14/359 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FDF LP   +A  PV PRD++RLMV+ P    P   +    +DLP  L   D +V
Sbjct: 1   MRLSDFDFALPEGLVAQAPVTPRDASRLMVLAPEEGSP---AHRGFADLPELLAPGDLLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FN+T+VI A+L G +      + + + C          W    + SK I++G +L F   
Sbjct: 58  FNDTRVIPARLLGHKAS--GGKVELLLCEPLEGGLGRRWRAMGQASKPIREGAVLTF--- 112

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
           DG   LEA V D    G   +     G ELE  +   G IPLPPYI  +R  DA D   Y
Sbjct: 113 DG---LEARVDDVEGEGFYRVTLDRQGPELEAALGRAGRIPLPPYI--RRAPDAEDAARY 167

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT +A+  GS AAPTAGLHFT  LL+RL + GI+   VTLHVG GTF+P++ +D D H M
Sbjct: 168 QTIWARAPGSAAAPTAGLHFTEPLLARLAARGIRRTAVTLHVGPGTFLPIRGDDLDLHRM 227

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           H E   +    A  L + ++RGGRIV+VGTTS+R LE+A   DG +    G T +FI PG
Sbjct: 228 HGERYEVSPAAAAELAATRARGGRIVAVGTTSVRTLESA-WRDGAVAAGPGRTELFIRPG 286

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLFQK 359
           + F AVD +++NFHLP+STLL+LV AF G       Y+ A++  YRF+SYGD  LL ++
Sbjct: 287 HPFHAVDAMVTNFHLPRSTLLVLVCAFGGQGRVLAAYREAVARGYRFFSYGDAMLLLRR 345


>gi|295109865|emb|CBL23818.1| S-adenosylmethionine--tRNA ribosyltransferase-isomerase
           [Ruminococcus obeum A2-162]
          Length = 341

 Score =  266 bits (679), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 149/357 (41%), Positives = 204/357 (57%), Gaps = 16/357 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +F +DLP   IA  P+  R S+RL+  H ++        H  +D+  +L   D +V
Sbjct: 1   MKTSDFYYDLPKELIAQDPLEDRSSSRLL--HLSMEDGSFEHRHF-TDILDYLKEGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+VI A+L G    H       I   L  R   + W    +P K  + G  + F   
Sbjct: 58  INDTRVIPARLYG----HKEETGALIEILLLKRKENDIWECLVKPGKKARPGAKITF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G   L   +ID  + G  L+ F   GI  E  +  +G +PLPPYI  K     +D   Y
Sbjct: 111 -GDGILTGEIIDIVDEGNRLIQFHYDGI-FEEILDQLGEMPLPPYITHK----LKDKNRY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  L+ ++   G+K+  VTLHVG GTF PVKV++ + H M
Sbjct: 165 QTVYAKNDGSAAAPTAGLHFTKELMKQVEEKGVKIAHVTLHVGLGTFRPVKVDNVESHHM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   ++   A+ +N  K  GGR++SVGTTS R LE+AT E+GI++  SG+T IFI PG
Sbjct: 225 HSEFYMVEEDQAKLINDTKKNGGRVISVGTTSCRTLESATDENGILHAGSGWTEIFIYPG 284

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           Y+F+ +D L++NFHLP+STLLMLVSA  G E     Y+ A+   YRF+S+GD  L+ 
Sbjct: 285 YKFKMIDGLITNFHLPESTLLMLVSALAGKEHIMAAYEEAVKERYRFFSFGDAMLIL 341


>gi|210622017|ref|ZP_03292960.1| hypothetical protein CLOHIR_00906 [Clostridium hiranonis DSM 13275]
 gi|210154462|gb|EEA85468.1| hypothetical protein CLOHIR_00906 [Clostridium hiranonis DSM 13275]
          Length = 350

 Score =  266 bits (679), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 145/352 (41%), Positives = 198/352 (56%), Gaps = 16/352 (4%)

Query: 5   EFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIVFNNT 64
           +F+FDLP   IA  P+  R ++RLMV+         I   +  D+  +L   D +V N+T
Sbjct: 14  DFNFDLPQELIAQTPIEDRSASRLMVLDKETG---EIEHKIFRDIKEYLKPGDCLVLNDT 70

Query: 65  KVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQDGQS 124
           +VI A+L G +     +    I   L  R + ++W    +P K  K G    F    G  
Sbjct: 71  RVIPARLIGEKVDTGGK----IEFLLLKRNTDDTWESLVKPGKRAKIGTKFSF----GGG 122

Query: 125 RLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDYQTTY 184
           +L   V+   + G  ++ F   GI  E  +  +G +PLPPYI  K     R    YQT Y
Sbjct: 123 KLIGEVVGMADEGARIIKFHYDGI-FEEILDELGNMPLPPYITEKLEEKER----YQTVY 177

Query: 185 AKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIMHSEI 244
           +K  GS AAPTAGLHFT+ LL  +  +G+ + FVTLHVG GTF PVKV+D  +H MHSE 
Sbjct: 178 SKHNGSAAAPTAGLHFTNELLEEIKEMGVDIAFVTLHVGLGTFRPVKVDDVLNHEMHSEF 237

Query: 245 GFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPGYRFR 304
             +    A  +N  K  G R++ VGTTS R +E+A  EDG +   SG+TNIFI PGY+F+
Sbjct: 238 YMVTQEAADKINKAKENGNRVICVGTTSCRTIESAAEEDGHMTAKSGWTNIFIYPGYKFK 297

Query: 305 AVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
            +D L++NFHLP+STL+MLVSA CG E     Y  AI   YRF+S+GD   +
Sbjct: 298 VLDNLITNFHLPESTLIMLVSALCGREHVLNAYNEAIKERYRFFSFGDAMFI 349


>gi|322377318|ref|ZP_08051809.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus sp. M334]
 gi|321281518|gb|EFX58527.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus sp. M334]
          Length = 342

 Score =  266 bits (679), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 153/358 (42%), Positives = 210/358 (58%), Gaps = 17/358 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +FDF LP   IA  P+  RD+++L++V+           H + D+   L   DA+V
Sbjct: 1   MNTADFDFHLPEELIAQTPLEKRDASKLLIVNRETGKMQDKHFHSIIDM---LEPGDALV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+V+ A+L G +          +   L    + + W V A+P+K +K G  + F   
Sbjct: 58  MNDTRVLPARLYGQK----EETGGHVELLLLKNTAGDEWEVLAKPAKRLKVGTRVSF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL A V ++   G  ++ F   GI LE   SL G +PLPPYI  K  +D R+   Y
Sbjct: 111 -GDGRLSAVVTEELTHGGRIVRFEYQGIFLEVLESL-GEMPLPPYIHEK--LDDRER--Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL+ + + G+ + ++TLHVG GTF PV V++ D+H M
Sbjct: 165 QTVYAKESGSAAAPTAGLHFTKELLAEIQAKGVHLVYLTLHVGLGTFRPVSVDNLDEHEM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           HSE   +    A  L SVK  GGR+++VG+TS+R LET  ++ DG I   SG+TNIFI P
Sbjct: 225 HSEFYQLSEEAAVTLRSVKENGGRVIAVGSTSIRTLETIGSKFDGQIQADSGWTNIFIKP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           GY ++ VD   +NFHLPKSTL+MLVSAF G E     Y HAI   YRF+S+GD   ++
Sbjct: 285 GYEWKVVDAFSTNFHLPKSTLVMLVSAFAGRELVLDAYHHAIQEHYRFFSFGDAMFIY 342


>gi|329926750|ref|ZP_08281158.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Paenibacillus sp. HGF5]
 gi|328938950|gb|EGG35318.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Paenibacillus sp. HGF5]
          Length = 343

 Score =  266 bits (679), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 149/359 (41%), Positives = 209/359 (58%), Gaps = 18/359 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V  +DF+LP   IA  P+  R S+RL+ ++        IS    +D+   LN  D +V
Sbjct: 1   MNVDLYDFELPEHLIAQTPLLDRSSSRLLTLNKESGQ---ISHQTFADIIDSLNPGDTLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+TKVI A+L G +     + E      L   +  + W    +P K +KKG+++ F   
Sbjct: 58  LNDTKVIPARLFGEKEDTGAKAE----VLLLKNMGEDRWEALVKPGKKLKKGNVISF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  +L+A + ++   G   L FS  GI  +  +  +G +PLPPYI  K  +D RD   Y
Sbjct: 111 -GDGKLKAVIEEEGEMGARTLSFSYKGI-FQEILDELGQMPLPPYIKEK--LDDRDR--Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK +GS AAPTAGLHFT  LL ++ + G+ + F+TLHVG GTF P+ V+  +DH+M
Sbjct: 165 QTVYAKHEGSAAAPTAGLHFTEALLEQIRAKGVDIAFITLHVGLGTFRPMSVDQVEDHVM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE--DGIINPWSGFTNIFIT 298
           H E   +   TA  LN  K RGGR+++VGTTS R LET  ++     +   SG+T+IFI 
Sbjct: 225 HEEYYSLSQETADLLNETKRRGGRVIAVGTTSCRTLETVGSQLKGEPLRESSGWTSIFIY 284

Query: 299 PGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           PGY F  VD L++NFHLPKSTL+MLVSA  G E     Y+ A+   YRF+S+GD   ++
Sbjct: 285 PGYSFTVVDALITNFHLPKSTLVMLVSALAGREHIMHAYKEAVDKEYRFFSFGDAMFIY 343


>gi|222097863|ref|YP_002531920.1| s-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           cereus Q1]
 gi|254764266|sp|B9IYZ2|QUEA_BACCQ RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|221241921|gb|ACM14631.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase (queuosine
           biosynthesis protein queA) [Bacillus cereus Q1]
          Length = 350

 Score =  266 bits (679), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 151/353 (42%), Positives = 209/353 (59%), Gaps = 17/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M +  FDF LP   IA  P+  R+++RLMV+         I     +D+ ++L+  D +V
Sbjct: 1   MDINLFDFHLPEELIAQVPLEERETSRLMVLDRETGD---IEHKHFTDILSYLHEGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N TKV+ A+L+GV+          I   L  +   + W    +P+K +K+G ++ F   
Sbjct: 58  LNETKVMPARLHGVK----EDPGAHIEVLLLKQEEGDKWETLVKPAKRVKEGTVISF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G+ +L+AT     + G   L FS  GI  E  +  +G +PLPPYI  K  ++ RD   Y
Sbjct: 111 -GEGKLKATCTGTADQGGRQLEFSYDGIFYE-ILDELGEMPLPPYI--KETLEDRDR--Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL +L   G+++ F+TLHVG GTF PV  +  ++H M
Sbjct: 165 QTVYAKEIGSAAAPTAGLHFTEELLEKLKQKGVELAFITLHVGLGTFRPVSADTIEEHHM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLET-ATTEDGIINPWSGFTNIFITP 299
           H+E   +   TA  LN VK  GGRI++VGTTS R LET AT  DG +   SG+T+IF+ P
Sbjct: 225 HAEYYHMSEETAALLNRVKENGGRIITVGTTSTRTLETIATDHDGKLCAASGWTDIFMYP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           GY F+A+D L++NFHLPKSTL+MLVSAF   +     Y  A+   YRF+S+GD
Sbjct: 285 GYEFKAIDGLITNFHLPKSTLIMLVSAFANRDNVLHAYNEAVKEKYRFFSFGD 337


>gi|160880412|ref|YP_001559380.1| S-adenosylmethionine--tRNA-ribosyltransferase-isomerase
           [Clostridium phytofermentans ISDg]
 gi|189038516|sp|A9KK69|QUEA_CLOPH RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|160429078|gb|ABX42641.1| S-adenosylmethionine--tRNA-ribosyltransferase-isomerase
           [Clostridium phytofermentans ISDg]
          Length = 364

 Score =  265 bits (678), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 148/365 (40%), Positives = 202/365 (55%), Gaps = 21/365 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M  ++F FDLP   IA  P+  R  +RL+V+  N      ++ H+  ++  +L   D +V
Sbjct: 1   MKKQDFYFDLPEELIAQDPLEDRSGSRLLVLDKNTG---KVTHHIFKEIVKYLKKGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCH---------INRREKEISCTLHMRVSPNSWSVYARPSKVIKK 111
            NNTKVI A+L G R              +    I   L  R   + W    RP K  K 
Sbjct: 58  LNNTKVIPARLMGERIIEKTPLAPGHSYGKEGTPIELLLLKRKPDDVWETLVRPGKKAKV 117

Query: 112 GDILHFFSQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRP 171
           G  + F    G  +L   +ID    G  L+ F+  GI  E  +  +G +PLPPYI  +  
Sbjct: 118 GTKISF----GDGKLIGEIIDVVEEGNRLVKFTYQGI-FEEILDELGQMPLPPYITHELA 172

Query: 172 IDARDYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVK 231
              R    YQT YAK +GS AAPTAGLHFT+ LL ++  +G+ +  VTLHVG GTF PVK
Sbjct: 173 DKNR----YQTVYAKHEGSAAAPTAGLHFTNELLKQIEDMGVVIANVTLHVGLGTFRPVK 228

Query: 232 VEDTDDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSG 291
            +D  DH MHSE+  ++   A+ +N  K  GGRI+ VGTTS R +E+A  EDG +   SG
Sbjct: 229 EDDILDHHMHSEVYQVEESEAKKINDAKRAGGRIICVGTTSCRTIESAANEDGFVQAKSG 288

Query: 292 FTNIFITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYG 351
            T IFI PGY+F+ ++ L++NFHLP+STLLMLVSA    E     Y+ A+   YRF+S+G
Sbjct: 289 ATEIFIYPGYKFKVLNCLITNFHLPESTLLMLVSALASREHIIAAYEEAVKERYRFFSFG 348

Query: 352 DTSLL 356
           D   +
Sbjct: 349 DAMFI 353


>gi|313669079|ref|YP_004049363.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Neisseria
           lactamica ST-640]
 gi|313006541|emb|CBN88005.1| putative S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Neisseria lactamica 020-06]
          Length = 346

 Score =  265 bits (678), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 154/356 (43%), Positives = 208/356 (58%), Gaps = 18/356 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FDF LP   IA  P   R S+RL+V  P++  PL   D +  DLP ++   D +V
Sbjct: 1   MDISDFDFTLPEKLIAQHPPEVRGSSRLLVALPDM--PL--QDRVFGDLPDYVGEGDVLV 56

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FNNTKV+ A+L G +          I   +   +  ++   + R SK  K G  L F   
Sbjct: 57  FNNTKVMKARLFGQKDSG-----GRIEALIERVLDNHTALAHIRSSKSPKPGMGLVF--- 108

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
             +  + A ++ +   GE+  +    G  +   +   G +PLPPYI  +R  DA D   Y
Sbjct: 109 --EGGIRAVMVGR--EGELFCLCFEGGQTVYELLEQNGHLPLPPYI--ERAADADDDSRY 162

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK QG+VAAPTAGLHFT  LL RL   G     VTLHVGAGTF PV+VE  ++H M
Sbjct: 163 QTVYAKYQGAVAAPTAGLHFTEELLRRLKDKGAVTAEVTLHVGAGTFQPVRVEKIEEHKM 222

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   + + T  A+ + K+RG ++ +VGTTS+R LE+A    G +    G T+IFITPG
Sbjct: 223 HSEWFEVPSETVAAVEAAKARGNKVWAVGTTSMRALESAARATGRLKAGQGDTDIFITPG 282

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           YRF   D L++NFHLPKSTLLMLVSAF G+   +  Y++A+ H YRF+SYGD  +L
Sbjct: 283 YRFNVADRLVTNFHLPKSTLLMLVSAFSGMGHIRAAYRYAVEHEYRFFSYGDAMIL 338


>gi|194290672|ref|YP_002006579.1| s-adenosylmethionine:tRNA ribosyltransferase-isomerase [Cupriavidus
           taiwanensis LMG 19424]
 gi|238692773|sp|B3R6J3|QUEA_CUPTR RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|193224507|emb|CAQ70518.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Cupriavidus
           taiwanensis LMG 19424]
          Length = 355

 Score =  265 bits (678), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 154/363 (42%), Positives = 214/363 (58%), Gaps = 19/363 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVH---PNLSCPLV-ISDHLVSDLPAFLNSN 56
           + + +FDF LPP  IA   +  R ++RL+VV    P  +   V ++D   SD+  +L  +
Sbjct: 2   LTLSDFDFPLPPELIAQSALPDRSASRLLVVERLAPGDTADAVHMADRAFSDIVDYLRPD 61

Query: 57  DAIVFNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILH 116
           D +VFN+T+VI A     RF        ++   +   +  ++     R SK   +G  LH
Sbjct: 62  DLLVFNDTRVIKA-----RFFGHKPSGGKVEVLVERVLDTHTVLAQVRASKTPVEGSALH 116

Query: 117 FFSQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARD 176
             + D  +      +D++ T    L F    ++L   I   G +PLPPYI      DA D
Sbjct: 117 L-ADDAFAVTVGPRVDQFFT----LRFPEPALDL---IERYGRLPLPPYITHD--PDAYD 166

Query: 177 YVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTD 236
              YQT YA+  G+VAAPTAGLHF   L +RL + G++  F+TLHVGAGTF PV+ E+  
Sbjct: 167 ETRYQTVYARSPGAVAAPTAGLHFDDALFARLDAAGVRRAFLTLHVGAGTFQPVRTENLA 226

Query: 237 DHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIF 296
           +H MHSE   I    AQA+   ++RGGR+++VGTTSLR LE+A   DG +   SG T+IF
Sbjct: 227 EHKMHSEWYAISEDLAQAVRETRARGGRVIAVGTTSLRALESAAQPDGTLAAGSGDTDIF 286

Query: 297 ITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           ITPGYRFR VD L++NFHLPKSTLLMLVSA  G++  +  Y+HA+   YRF+SYGD  LL
Sbjct: 287 ITPGYRFRLVDALITNFHLPKSTLLMLVSALAGVQAIRAAYRHAVEQRYRFFSYGDAMLL 346

Query: 357 FQK 359
            ++
Sbjct: 347 TRQ 349


>gi|325567162|ref|ZP_08143829.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus casseliflavus ATCC 12755]
 gi|325158595|gb|EGC70741.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus casseliflavus ATCC 12755]
          Length = 343

 Score =  265 bits (678), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 154/357 (43%), Positives = 210/357 (58%), Gaps = 17/357 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           +  ++FDF+LP   IA  P+  R S+RL+VV           D    ++   L   DA+V
Sbjct: 2   LTTEDFDFELPEELIAQTPLSDRSSSRLLVVDRETGK---FEDKHFYNIIDELEPGDALV 58

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+V+ A++ G +          +   L   +  ++W    +P+K  K G  + F   
Sbjct: 59  MNDTRVLPARIYGEK----QETGAHLEILLLNNIEGDTWETLIKPAKRAKVGTKITF--- 111

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RLEA V ++ + G  ++ F   GI LE   SL G +PLPPYI  +      D   Y
Sbjct: 112 -GDGRLEAVVEEELDHGGRIIRFQYKGIFLEILESL-GEMPLPPYIKER----LEDPDRY 165

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL ++ + G+K+ ++TLHVG GTF PV V++  DH M
Sbjct: 166 QTVYAKENGSAAAPTAGLHFTPELLEQIAAKGVKLVYLTLHVGLGTFRPVSVDNIADHEM 225

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           HSE   +    A  LN V++ GG+IV+VGTTS+R LET  T+ DG I   SG+T+IFITP
Sbjct: 226 HSEFYRLTEEAAAQLNEVRANGGKIVAVGTTSIRTLETIGTKFDGQIKADSGWTSIFITP 285

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           GY+F+ V+   +NFHLPKSTL+MLVSAF G + T   YQHAI   YRF+S+GD   L
Sbjct: 286 GYQFKIVEAFSTNFHLPKSTLVMLVSAFAGRDLTLSAYQHAIDERYRFFSFGDAMFL 342


>gi|229032069|ref|ZP_04188051.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           cereus AH1271]
 gi|228729261|gb|EEL80256.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           cereus AH1271]
          Length = 350

 Score =  265 bits (678), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 151/353 (42%), Positives = 209/353 (59%), Gaps = 17/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M +  FDF LP   IA  P+  R+++RLMV+         I     +D+ ++L+  D +V
Sbjct: 1   MDINLFDFHLPEELIAQVPLEDRETSRLMVLDRETGD---IEHKHFTDILSYLHEGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N TKV+ A+L+GV+          I   L  +   ++W    +P+K +K+G ++ F   
Sbjct: 58  LNETKVMPARLHGVK----EDTGAHIEVLLLKQEEGDTWETLVKPAKRVKEGTVISF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G+ +L+AT     + G   L FS  GI  E  +  +G +PLPPYI  K  ++ RD   Y
Sbjct: 111 -GEGKLKATCTGTADQGGRQLEFSYDGIFYE-ILDELGEMPLPPYI--KETLEDRDR--Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL +L   G+ + F+TLHVG GTF PV  +  ++H M
Sbjct: 165 QTVYAKEIGSAAAPTAGLHFTEELLEKLKQKGVGLAFITLHVGLGTFRPVSADTIEEHHM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLET-ATTEDGIINPWSGFTNIFITP 299
           H+E   +   TA  LN VK  GGRI++VGTTS R LET AT  DG +   SG+T+IF+ P
Sbjct: 225 HAEYYHMSEETAALLNRVKESGGRIITVGTTSTRTLETIATDHDGKLCAASGWTDIFMYP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           GY F+A+D L++NFHLPKSTL+MLVSAF   +     Y  A+   YRF+S+GD
Sbjct: 285 GYEFKAIDGLITNFHLPKSTLIMLVSAFANRDNVLHAYNEAVKEKYRFFSFGD 337


>gi|331085363|ref|ZP_08334449.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Lachnospiraceae bacterium 9_1_43BFAA]
 gi|330408146|gb|EGG87636.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Lachnospiraceae bacterium 9_1_43BFAA]
          Length = 341

 Score =  265 bits (678), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 147/356 (41%), Positives = 204/356 (57%), Gaps = 16/356 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M  ++F+FDLP   IA  P+  R S+RL+V+            H+  ++  +L   D +V
Sbjct: 1   MRKEDFNFDLPEELIAQDPLEDRSSSRLLVLDKETGK---TEHHVFREIIEYLEEGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+TKVI A+L G +       + +I   L  R   + W    +P K  K G  + F   
Sbjct: 58  INDTKVIPARLIGSKIG----TDAKIEVLLLKRKENDVWETLVKPGKKAKIGTRISF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G   L   V+D    G  L+ F   GI  E  +  +G +PLPPYI  +      D   Y
Sbjct: 111 -GDGLLVGEVVDIVEEGNRLIHFEYEGI-FEEILDRLGQMPLPPYITHQ----LEDKNRY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL ++   G+++  VTLHVG GTF PVKV++  +H M
Sbjct: 165 QTVYAKHSGSAAAPTAGLHFTPELLKKIEEKGVQIARVTLHVGLGTFRPVKVDNILEHHM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   I+   A+ +N+ K+ G R+++VGTTS R +E+A  EDG I P SG+T+IFI PG
Sbjct: 225 HSEFYQIEEEAAEKINTAKANGKRVIAVGTTSCRTIESAVKEDGTIAPVSGWTDIFIYPG 284

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           Y+F+ +D L++NFHLP+STL+MLVSA  G E     Y+ AI   YRF+S+GD   +
Sbjct: 285 YQFKVLDCLITNFHLPESTLVMLVSALAGREHVLNAYEEAIKERYRFFSFGDAMFI 340


>gi|309379474|emb|CBX21840.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 346

 Score =  265 bits (678), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 153/356 (42%), Positives = 208/356 (58%), Gaps = 18/356 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FDF LP   IA  P   R S+RL+V  P++S    + D +  DLP ++   D +V
Sbjct: 1   MDISDFDFTLPEKLIAQHPPEVRGSSRLLVALPDMS----LQDRVFGDLPDYVGEGDVLV 56

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FNNTKV+ A+L G +          I   +   +  ++   + R SK  K G  L F   
Sbjct: 57  FNNTKVMKARLFGQKDSG-----GRIEALIERVLDNHTALAHIRSSKSPKPGMGLVF--- 108

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
             +  + A ++ +   GE+  +    G  +   +   G +PLPPYI  +R  DA D   Y
Sbjct: 109 --EGGIRAVMVGR--EGELFCLRFEGGETVYELLEQNGHLPLPPYI--ERAADADDDSRY 162

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK QG+VAAPTAGLHFT  LL RL   G     VTLHVGAGTF PV+VE  ++H M
Sbjct: 163 QTVYAKYQGAVAAPTAGLHFTEELLRRLKDKGAVTAEVTLHVGAGTFQPVRVEKIEEHKM 222

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   + + T  A+ + K+RG ++ +VGTTS+R LE+A    G +    G T+IFITPG
Sbjct: 223 HSEWFEVPSETVAAVEAAKARGNKVWAVGTTSMRALESAARATGRLKAGQGDTDIFITPG 282

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           YRF  VD L++NFHLPKSTLLMLVSAF G+   +  Y++A+   YRF+SYGD  +L
Sbjct: 283 YRFNVVDRLVTNFHLPKSTLLMLVSAFSGMGHIRAAYRYAVEREYRFFSYGDAMVL 338


>gi|229163366|ref|ZP_04291318.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           cereus R309803]
 gi|228620147|gb|EEK77021.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           cereus R309803]
          Length = 354

 Score =  265 bits (678), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 150/353 (42%), Positives = 209/353 (59%), Gaps = 17/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M +  FDF LP   IA  P+  R+++RLM++         I     +D+ ++L+  D +V
Sbjct: 5   MDINLFDFHLPEELIAQVPLEERETSRLMMLDRETGD---IEHKHFTDILSYLHEGDCLV 61

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N TKV+ A+L+GV+          I   L  +   + W    +P+K +K+G ++ F   
Sbjct: 62  LNETKVMPARLHGVK----EDTGAHIEVLLLKQEEGDKWETLVKPAKRVKEGTVISF--- 114

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G+ +L+AT     + G   L FS  GI  E  +  +G +PLPPYI  K  ++ RD   Y
Sbjct: 115 -GEGKLKATCTGMADQGGRQLEFSYDGIFYE-ILDELGEMPLPPYI--KETLEDRDR--Y 168

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL +L   G+++ F+TLHVG GTF PV  +  ++H M
Sbjct: 169 QTVYAKEIGSAAAPTAGLHFTEELLEKLKQKGVELAFITLHVGLGTFRPVSADTIEEHHM 228

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLET-ATTEDGIINPWSGFTNIFITP 299
           H+E   +   TA  LN VK  GGRI++VGTTS R LET AT  DG +   SG+T+IF+ P
Sbjct: 229 HAEYYHMSEETAALLNRVKENGGRIITVGTTSTRTLETIATDHDGKLCAASGWTDIFMYP 288

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           GY F+A+D L++NFHLPKSTL+MLVSAF   +     Y  A+   YRF+S+GD
Sbjct: 289 GYEFKAIDGLITNFHLPKSTLIMLVSAFANRDNVLHAYNEAVKEKYRFFSFGD 341


>gi|168486111|ref|ZP_02710619.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae CDC1087-00]
 gi|183570814|gb|EDT91342.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae CDC1087-00]
          Length = 342

 Score =  265 bits (678), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 154/358 (43%), Positives = 209/358 (58%), Gaps = 17/358 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +FDF LP   IA  P+  RD+++L++V+           H + D+   L   DA+V
Sbjct: 1   MNTADFDFHLPEELIAQTPLEKRDASKLLIVNRETGEMQDKHFHSIIDM---LEPGDALV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+V+ A+L G +          +   L    S + W V A+P+K +K G  + F   
Sbjct: 58  MNDTRVLPARLYGQKV----ETGSHVELLLLKNTSGDEWEVLAKPAKRLKVGTRISF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL A V ++   G  ++ F   GI LE   SL G +PLPPYI  K  +D R+   Y
Sbjct: 111 -GDGRLSAVVTEELTHGGRIVRFEYQGIFLEVLESL-GEMPLPPYIHEK--LDDRE--RY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL+ + + G+ + ++TLHVG GTF PV V++ D+H M
Sbjct: 165 QTVYAKESGSAAAPTAGLHFTKELLAEIQAKGVHLVYLTLHVGLGTFRPVSVDNLDEHEM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           HSE   +    A  L SVK  GGR+++VGTTS+R LET  ++  G I   SG+TNIFI P
Sbjct: 225 HSEFYQLSEEAAATLRSVKENGGRVIAVGTTSIRTLETIGSKFYGQIQADSGWTNIFIKP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           GY ++ VD   +NFHLPKSTL+MLVSAF G E     Y HAI   YRF+S+GD   ++
Sbjct: 285 GYEWKVVDAFSTNFHLPKSTLVMLVSAFAGCELVLDAYHHAIQEHYRFFSFGDAMFIY 342


>gi|238917266|ref|YP_002930783.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Eubacterium
           eligens ATCC 27750]
 gi|238872626|gb|ACR72336.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Eubacterium
           eligens ATCC 27750]
          Length = 343

 Score =  265 bits (678), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 148/356 (41%), Positives = 205/356 (57%), Gaps = 14/356 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +F +DLP   IA  P+  R S+RLMV+         I   +  D+  +L   D +V
Sbjct: 1   MDLHDFYYDLPEELIAQDPLSDRSSSRLMVLDKETGE---IEHKIFRDIVDYLKPGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+TKVI A+L G +         E+     +    ++W V  +P K  K G  + F   
Sbjct: 58  VNDTKVIPARLIGTKAD--TGATIEVLLLKRLEDRQDTWEVLVKPGKKAKVGAKISF--- 112

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G+ +L   +ID    G  L+ F+  GI  E  +  +G +PLPPYI  K      D   Y
Sbjct: 113 -GEGKLIGEIIDIVEEGNRLIQFTYDGI-FEEILDELGQMPLPPYITHK----LEDKNRY 166

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK +GS AAPTAGLHFT+ LL ++ ++G+ +  VTLHVG GTF PVKVE+  DH M
Sbjct: 167 QTVYAKHEGSAAAPTAGLHFTTELLEKIKAMGVNIARVTLHVGLGTFRPVKVENILDHHM 226

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   +    A  +N+ +  GGR+++VGTTS R LE+   EDG I   SG+T IFI PG
Sbjct: 227 HSEFYVVTQEAADMINNTRKNGGRVIAVGTTSTRTLESVALEDGTIPAKSGWTEIFIYPG 286

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           Y+F+A+D L++NFHLP+STL+MLVSA  G E     Y+ A+   YRF+S+GD   +
Sbjct: 287 YKFKAIDCLITNFHLPESTLVMLVSALAGREHVLHAYEVAVQEKYRFFSFGDAMFI 342


>gi|255658191|ref|ZP_05403600.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Mitsuokella
           multacida DSM 20544]
 gi|260849499|gb|EEX69506.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Mitsuokella
           multacida DSM 20544]
          Length = 368

 Score =  265 bits (678), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 146/360 (40%), Positives = 206/360 (57%), Gaps = 17/360 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M++ +FD+DLP  RIA  P+ PR+++RLMV+ P       I      DL  FL   D ++
Sbjct: 1   MLLSDFDYDLPEERIAQVPIEPRNASRLMVLDP---VTKEIEHRHFYDLKEFLEPGDTLI 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FN+T+V+ A+L G    H ++    +   L  R+  N W    +P K  K G+++ F  +
Sbjct: 58  FNDTRVMPARLIG----HRDQTGGRVEVFLLRRLDANHWETLVKPGKKAKPGNVIRFGDE 113

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
                L  TV +  + G  ++ F   GI  E  +  +G  PLPPYI  K      D   Y
Sbjct: 114 -----LSCTVTEHTDFGGRIVEFHYDGI-FEEILDRLGETPLPPYIHEK----LEDKERY 163

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT Y + +GS AAPTAGLHFT   +  L  +G+ + FVTLHVG GTF PV VE+ ++H M
Sbjct: 164 QTVYNREEGSAAAPTAGLHFTKEQMQELREMGVNLGFVTLHVGLGTFRPVNVENIEEHEM 223

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           H E   I   TA+ +   K  G R+++VGTTS+R LE+A T    I   SG+T IFI PG
Sbjct: 224 HKEYYCIPDETAKLIMDTKKAGHRVIAVGTTSIRTLESAATAKNEIAGKSGWTGIFIYPG 283

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLFQKR 360
           Y F+ VD +++NFHLPKSTL+ML+SAF G       Y+ A+   YRF+S+GD   + +K+
Sbjct: 284 YDFKIVDAIITNFHLPKSTLIMLISAFAGRNFVLNAYKTAVEMKYRFFSFGDAMFIRRKQ 343


>gi|229198546|ref|ZP_04325249.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           cereus m1293]
 gi|228584931|gb|EEK43046.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           cereus m1293]
 gi|324328321|gb|ADY23581.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           thuringiensis serovar finitimus YBT-020]
          Length = 350

 Score =  265 bits (677), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 150/353 (42%), Positives = 209/353 (59%), Gaps = 17/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M +  FDF LP   IA  P+  R+++RLMV+         I     +D+ ++L+  D +V
Sbjct: 1   MDINLFDFHLPEELIAQVPLEERETSRLMVLDRETGD---IEHKHFTDILSYLHEGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N TKV+ A+L+GV+          I   L  +   + W    +P+K +K+G ++ F   
Sbjct: 58  LNETKVMPARLHGVK----EDTGAHIEVLLLKQEEGDKWETLVKPAKRVKEGTVISF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G+ +L+AT     + G   L FS  GI  E  +  +G +PLPPYI  K  ++ RD   Y
Sbjct: 111 -GEGKLKATCTGTADQGGRQLEFSYDGIFYE-ILDELGEMPLPPYI--KETLEDRDR--Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL +L   G+++ F+TLHVG GTF PV  +  ++H M
Sbjct: 165 QTVYAKEIGSAAAPTAGLHFTEELLEKLKQKGVELAFITLHVGLGTFRPVSADTIEEHHM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLET-ATTEDGIINPWSGFTNIFITP 299
           H+E   +   TA  LN V+  GGRI++VGTTS R LET AT  DG +   SG+T+IF+ P
Sbjct: 225 HAEYYHMSEETAALLNRVRENGGRIITVGTTSTRTLETIATDHDGKLCAASGWTDIFMYP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           GY F+A+D L++NFHLPKSTL+MLVSAF   +     Y  A+   YRF+S+GD
Sbjct: 285 GYEFKAIDGLITNFHLPKSTLIMLVSAFANRDNVLHAYNEAVKEKYRFFSFGD 337


>gi|325660922|ref|ZP_08149549.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Lachnospiraceae bacterium 4_1_37FAA]
 gi|325472429|gb|EGC75640.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Lachnospiraceae bacterium 4_1_37FAA]
          Length = 341

 Score =  265 bits (677), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 147/356 (41%), Positives = 205/356 (57%), Gaps = 16/356 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M  ++F+FDLP   IA  P+  R S+RL+V+            H+  ++  +L + D +V
Sbjct: 1   MRKEDFNFDLPEELIAQDPLEDRSSSRLLVLDKETGK---TEHHVFREIIDYLEAGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+TKVI A+L G +       + +I   L  R   + W    +P K  K G  + F   
Sbjct: 58  INDTKVIPARLIGSKIG----TDAKIEVLLLKRKENDVWETLVKPGKKAKIGTRISF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G   L   V+D    G  L+ F   GI  E  +  +G +PLPPYI  +      D   Y
Sbjct: 111 -GDGLLVGEVVDIVEEGNRLIHFEYEGI-FEEILDRLGQMPLPPYITHQ----LEDKNRY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL ++   G+++  VTLHVG GTF PVKV++  +H M
Sbjct: 165 QTVYAKHSGSAAAPTAGLHFTPELLKKIEEKGVQIARVTLHVGLGTFRPVKVDNILEHHM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   I+   A+ +N+ K+ G R+++VGTTS R +E+A  EDG I P SG+T+IFI PG
Sbjct: 225 HSEFYQIEEEAAEKINTAKANGKRVIAVGTTSCRTIESAAKEDGTIAPVSGWTDIFIYPG 284

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           Y+F+ +D L++NFHLP+STL+MLVSA  G E     Y+ AI   YRF+S+GD   +
Sbjct: 285 YQFKVLDCLITNFHLPESTLVMLVSALAGREHVLNAYEEAIKERYRFFSFGDAMFI 340


>gi|228917055|ref|ZP_04080614.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           thuringiensis serovar pulsiensis BGSC 4CC1]
 gi|228842583|gb|EEM87672.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           thuringiensis serovar pulsiensis BGSC 4CC1]
          Length = 350

 Score =  265 bits (677), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 150/353 (42%), Positives = 209/353 (59%), Gaps = 17/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M +  FDF LP   IA  P+  R+++RLMV+         I     +D+ ++L+  D +V
Sbjct: 1   MDINLFDFHLPEELIAQVPLEERETSRLMVLDRETGG---IEHKHFTDILSYLHEGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N TKV+ A+L+GV+          I   L  +   + W    +P+K +K+G ++ F   
Sbjct: 58  LNETKVMPARLHGVK----EDTGAHIEVLLLKQEEGDKWETLVKPAKRVKEGTVISF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G+ +L+AT     + G   L FS  GI  E  +  +G +PLPPYI  K  ++ RD   Y
Sbjct: 111 -GEGKLKATCTGTADQGGRQLEFSYEGIFYE-ILDELGEMPLPPYI--KETLEDRDR--Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL +L   G+++ F+TLHVG GTF PV  +  ++H M
Sbjct: 165 QTVYAKEIGSAAAPTAGLHFTEELLEKLKQKGVELAFITLHVGLGTFRPVSADTIEEHHM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLET-ATTEDGIINPWSGFTNIFITP 299
           H+E   +   TA  LN VK  GGRI++VGTTS R LET AT  +G +   SG+T+IF+ P
Sbjct: 225 HAEYYHMSEETAALLNRVKENGGRIITVGTTSTRTLETIATDHNGKLCAASGWTDIFMYP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           GY F+A+D L++NFHLPKSTL+MLVSAF   +     Y  A+   YRF+S+GD
Sbjct: 285 GYEFKAIDGLITNFHLPKSTLIMLVSAFANRDNVLHAYNEAVKEKYRFFSFGD 337


>gi|332074997|gb|EGI85469.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae GA41301]
          Length = 342

 Score =  265 bits (677), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 153/358 (42%), Positives = 210/358 (58%), Gaps = 17/358 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +FDF LP   IA  P+  RD+++L++V+           H + D+   L   DA+V
Sbjct: 1   MNTADFDFHLPEELIAQTPLEKRDASKLLIVNRETGEMQDKHFHSIIDM---LEPGDALV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+V+ A+L G +          +   L    S + W V A+P+K +K G  + F   
Sbjct: 58  MNDTRVLPARLYGQKV----ETGGHVELLLLKNTSGDEWEVLAKPAKRLKVGTRISF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL A V ++   G  ++ F   GI LE   SL G +PLPPYI  K  +D R+   Y
Sbjct: 111 -GDGRLSAVVTEELTHGGRIVRFEYQGIFLEVLESL-GEMPLPPYIHEK--LDDRER--Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL+ + + G+ + ++TLHVG GTF PV V++ D+H M
Sbjct: 165 QTVYAKESGSAAAPTAGLHFTKELLAEIQAKGVHLVYLTLHVGLGTFRPVSVDNLDEHEM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           HSE   +    A  L SVK  GGR+++VGTTS+R LET  ++ DG I   SG+TNIFI P
Sbjct: 225 HSEFYQLSEEAAATLRSVKKNGGRVIAVGTTSIRTLETIGSKFDGQIQADSGWTNIFIKP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           GY ++ VD   +NFHLPKSTL+MLVS+F G E     Y H+I   YRF+S+GD   ++
Sbjct: 285 GYEWKVVDAFSTNFHLPKSTLVMLVSSFAGRELVLDAYHHSIQEHYRFFSFGDAMFIY 342


>gi|149375025|ref|ZP_01892798.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Marinobacter algicola DG893]
 gi|149360914|gb|EDM49365.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Marinobacter algicola DG893]
          Length = 364

 Score =  265 bits (677), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 153/361 (42%), Positives = 221/361 (61%), Gaps = 34/361 (9%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHL-VSDLPAFLNSNDAI 59
           M V +F FDLP   IA  P+  R ++RL+ +   LS  +    HL  +DLP+ L   D +
Sbjct: 1   MNVSDFHFDLPDELIARYPLKERSASRLLSLD-GLSGDI---RHLRFTDLPSLLQPGDLL 56

Query: 60  VFNNTKVITAQLNGVRFCHINRREK--EISCTLHMRVSPNSWSVYARPSKVIKKGDILHF 117
           VFN+T+VI A+L G       R+E   ++   +   +  +    + R SK +K+G  +  
Sbjct: 57  VFNDTRVIPARLFG-------RKETGGQVEVLVERVLGEHDILAHVRASKALKEGQKV-- 107

Query: 118 FSQDG-----QSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPI 172
             +DG       R +A      ++ E +L        LER    +G +PLPPY+   RP 
Sbjct: 108 LLEDGTPLRMSGRDDALFHLHCDSDEPVLDV------LER----IGHMPLPPYV--DRPD 155

Query: 173 DARDYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKV 232
           ++ D   YQT YA+  G+VAAPTAGLHF   +L+ L S+G++  FVTLHVGAGTF PV+V
Sbjct: 156 ESSDRERYQTVYAREAGAVAAPTAGLHFDDRILAELESMGVETAFVTLHVGAGTFQPVRV 215

Query: 233 EDTDDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGF 292
           E  +DH+MHSE+  +   T  A+N+ ++RGGR+V+VGTTS+R LE+A +  G++ P+ G 
Sbjct: 216 EGIEDHVMHSEVAHVPQATVDAVNAARARGGRVVAVGTTSVRSLESA-SRGGVVRPFQGE 274

Query: 293 TNIFITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           T+IFI PGYRF+ VD +++NFHLP+STL+MLVSAF G +     YQ A++  YRF+SYGD
Sbjct: 275 TDIFIYPGYRFQTVDAMVTNFHLPESTLIMLVSAFAGYQNVMSAYQAAVAECYRFFSYGD 334

Query: 353 T 353
            
Sbjct: 335 A 335


>gi|290769980|gb|ADD61747.1| putative protein [uncultured organism]
          Length = 343

 Score =  265 bits (677), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 148/356 (41%), Positives = 205/356 (57%), Gaps = 14/356 (3%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +F +DLP   IA  P+  R S+RLMV+         I   +  D+  +L   D +V
Sbjct: 1   MDLHDFYYDLPEELIAQDPLSDRSSSRLMVLDKETGE---IEHKIFRDIVDYLRPGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+TKVI A+L G +         E+     +    ++W V  +P K  K G  + F   
Sbjct: 58  VNDTKVIPARLIGTKAD--TGATIEVLLLKRLEDRQDTWEVLVKPGKKAKVGAKISF--- 112

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G+ +L   +ID    G  L+ F+  GI  E  +  +G +PLPPYI  K      D   Y
Sbjct: 113 -GEGKLIGEIIDIVEEGNRLIQFTYDGI-FEEILDELGQMPLPPYITHK----LEDKNRY 166

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK +GS AAPTAGLHFT+ LL ++ ++G+ +  VTLHVG GTF PVKVE+  DH M
Sbjct: 167 QTVYAKHEGSAAAPTAGLHFTTELLEKIKAMGVNIARVTLHVGLGTFRPVKVENILDHHM 226

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   +    A  +N+ +  GGR+++VGTTS R LE+   EDG I   SG+T IFI PG
Sbjct: 227 HSEFYVVTQEAADMINNTRKNGGRVIAVGTTSTRTLESVALEDGTIPAKSGWTEIFIYPG 286

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           Y+F+A+D L++NFHLP+STL+MLVSA  G E     Y+ A+   YRF+S+GD   +
Sbjct: 287 YKFKAIDCLITNFHLPESTLVMLVSALAGREHVLHAYEVAVQEKYRFFSFGDAMFI 342


>gi|229586455|ref|YP_002844956.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Rickettsia
           africae ESF-5]
 gi|259551480|sp|C3PMQ3|QUEA_RICAE RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|228021505|gb|ACP53213.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Rickettsia
           africae ESF-5]
          Length = 365

 Score =  265 bits (677), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 147/387 (37%), Positives = 228/387 (58%), Gaps = 50/387 (12%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FDFDLP   IA  P   RD++ L++    ++ P+    + + D   +L   D +V
Sbjct: 1   MKLSDFDFDLPSELIAQYPSRERDNSDLLIA---VTPPIKTKFYNIID---YLKEGDLLV 54

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FNN+KVI A+LN           + I+  L+ ++S +SWS +A+P++ +   D  +F + 
Sbjct: 55  FNNSKVIKAKLN---------LGENITINLNQKLSDDSWSAFAKPARKLHVNDEFYFDNH 105

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPI-------- 172
                 +  + +K   GEI + F ++ I +   ++  G +PLP YI R   +        
Sbjct: 106 ------KVIITEKLAMGEIKVKFELNDISVFEFLNKYGEMPLPVYIRRSHSLCHPVATTT 159

Query: 173 DARDYVD--------------------YQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIG 212
            ++ Y++                    YQT Y++I+GSVAAPTAGLHFT ++L +L + G
Sbjct: 160 GSKTYLNNDWIPWSNHGMTNTQNDNDRYQTVYSQIEGSVAAPTAGLHFTKDILDKLKAEG 219

Query: 213 IKVYFVTLHVGAGTFMPVKVEDTDDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTS 272
           I+  F+TLHVGAGTF+PVK E+  +H MH+E   I   TA+ +N  K  G RI++VGTT+
Sbjct: 220 IQATFLTLHVGAGTFLPVKTENIHEHKMHTEYCSITPDTAKIINKAKQEGKRIIAVGTTT 279

Query: 273 LRLLETATTEDGIINPWSGFTNIFITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEE 332
           LR LE++   +GI+   S  T+IFITPG++F+  D+L++NFH PKSTL ML+ AF G +E
Sbjct: 280 LRTLESSCN-NGIVKAGSFKTDIFITPGFKFQTADMLLTNFHFPKSTLFMLICAFAGFKE 338

Query: 333 TKKMYQHAISHAYRFYSYGDTSLLFQK 359
             ++Y++AI  A RF+SYGD +LL +K
Sbjct: 339 MHELYKYAIKEAMRFFSYGDATLLCRK 365


>gi|117923911|ref|YP_864528.1| queuosine biosynthesis protein [Magnetococcus sp. MC-1]
 gi|259551461|sp|A0L579|QUEA_MAGSM RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|117607667|gb|ABK43122.1| Queuosine biosynthesis protein [Magnetococcus sp. MC-1]
          Length = 363

 Score =  265 bits (677), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 148/356 (41%), Positives = 208/356 (58%), Gaps = 17/356 (4%)

Query: 3   VKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIVFN 62
           +  +D+DLP + IA RP+ PRD ARL+V     S    + D     L   L + D +V N
Sbjct: 14  LSHYDYDLPAAHIAQRPMEPRDHARLLV-----SRAQGVEDSRFDQLVEHLQAGDLLVLN 68

Query: 63  NTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQDG 122
           +TKVI A+L G +    +    EI         P  W    R +K +K G  + F  +D 
Sbjct: 69  DTKVIPARLLGHK---PSGGRVEIFLLKPDPQHPPLWRAMTRSNKPLKVGQRVEF-GED- 123

Query: 123 QSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDAR-DYVDYQ 181
                A ++++   G +L+     G+ L+  +   G +PLPPYI+     DA+ D   YQ
Sbjct: 124 ---FYAELVERQAEGHVLVALHAVGMGLDEAMQHYGQMPLPPYISGS---DAQQDKSRYQ 177

Query: 182 TTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIMH 241
           T +A+  G+VAAPTAGLHFT  L  RL + G+    VTLHVG GTF PV+VED D H MH
Sbjct: 178 TVFARRDGAVAAPTAGLHFTDALFERLAAKGVTWCHVTLHVGLGTFQPVRVEDLDAHPMH 237

Query: 242 SEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPGY 301
            E   ++A     +   K+ GGR+V+VGTT++R LE++  + G++    G T +FI PGY
Sbjct: 238 GEWRQLEADAVAKIQRTKAAGGRVVAVGTTAVRTLESSVDDQGVLQASCGETRLFIRPGY 297

Query: 302 RFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           RF+ VD++++NFHLPKSTLLMLV+AF G    ++ Y HA+   YRFYSYGDT+LL+
Sbjct: 298 RFKVVDLMLTNFHLPKSTLLMLVAAFVGRSRLRRDYAHAMGKNYRFYSYGDTTLLY 353


>gi|228954702|ref|ZP_04116725.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           thuringiensis serovar kurstaki str. T03a001]
 gi|228805029|gb|EEM51625.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           thuringiensis serovar kurstaki str. T03a001]
          Length = 350

 Score =  265 bits (677), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 150/353 (42%), Positives = 209/353 (59%), Gaps = 17/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M +  FDF LP   IA  P+  R+++RLMV+         I     +D+ ++L+  D +V
Sbjct: 1   MDINLFDFHLPEELIAQVPLEERETSRLMVLDRETGD---IEHKHFTDILSYLHEGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N TKV+ A+L+GV+          I   L  +   + W    +P+K +K+G ++ F   
Sbjct: 58  LNETKVMPARLHGVK----EDTGAHIEVLLLKQEEGDKWETLVKPAKRVKEGTVISF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G+ +L+AT     + G   L FS  GI  E  +  +G +PLPPYI  K  ++ RD   Y
Sbjct: 111 -GEGKLKATCTGTADQGGRQLEFSYDGIFYE-ILDELGEMPLPPYI--KETLEDRDR--Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL +L   G+++ F+TLHVG GTF PV  +  ++H M
Sbjct: 165 QTVYAKEIGSAAAPTAGLHFTEELLEKLKQKGVQLAFITLHVGLGTFRPVSADTIEEHHM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLET-ATTEDGIINPWSGFTNIFITP 299
           H+E   +   TA  LN VK  GGRI++VGTTS R LET AT  +G +   SG+T+IF+ P
Sbjct: 225 HAEYYHMSEETAALLNRVKENGGRIITVGTTSTRTLETIATDHEGKLCAASGWTDIFMYP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           GY F+A+D L++NFHLPKSTL+MLVSAF   +     Y  A+   YRF+S+GD
Sbjct: 285 GYEFKAIDGLITNFHLPKSTLIMLVSAFANRDNVLHAYNEAVKEKYRFFSFGD 337


>gi|254724656|ref|ZP_05186439.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           anthracis str. A1055]
          Length = 350

 Score =  265 bits (677), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 150/353 (42%), Positives = 208/353 (58%), Gaps = 17/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M +  FDF LP   IA  P+  R+++RLMV+         I     +D+ ++L+  D +V
Sbjct: 1   MDINLFDFHLPEELIAQVPLEERETSRLMVLDRETGD---IEHKHFTDILSYLHEGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N TKV+ A+L+GV+          I   L  +   + W    +P+K +K+G ++ F   
Sbjct: 58  LNETKVMPARLHGVK----EDTGAHIEVLLLKQEEGDKWETLVKPAKRVKEGTVISF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G+ +L+AT     + G   L FS  GI  E  +  +G +PLPPYI  K  ++ RD   Y
Sbjct: 111 -GEGKLKATCTGTADQGGRQLEFSYDGIFYE-ILDELGEMPLPPYI--KETLEDRDR--Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT Y K  GS AAPTAGLHFT  LL +L   G+++ F+TLHVG GTF PV  +  ++H M
Sbjct: 165 QTVYGKEIGSAAAPTAGLHFTEELLEKLKQKGVELAFITLHVGLGTFRPVSADTIEEHHM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLET-ATTEDGIINPWSGFTNIFITP 299
           H+E   +   TA  LN VK  GGRI++VGTTS R LET AT  DG +   SG+T+IF+ P
Sbjct: 225 HAEYYHMSEETAALLNRVKENGGRIITVGTTSTRTLETIATDHDGKLCAASGWTDIFMYP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           GY F+A+D L++NFHLPKSTL+MLVSAF   +     Y  A+   YRF+S+GD
Sbjct: 285 GYEFKAIDGLITNFHLPKSTLIMLVSAFANRDNVLHAYNEAVKEKYRFFSFGD 337


>gi|295695631|ref|YP_003588869.1| S-adenosylmethionine/ tRNA-ribosyltransferase-isomerase [Bacillus
           tusciae DSM 2912]
 gi|295411233|gb|ADG05725.1| S-adenosylmethionine/ tRNA-ribosyltransferase-isomerase [Bacillus
           tusciae DSM 2912]
          Length = 346

 Score =  265 bits (677), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 153/360 (42%), Positives = 210/360 (58%), Gaps = 22/360 (6%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V++FD+DLPP RIA  P   R ++RL+V++ +      +      DL  +    DA++
Sbjct: 1   MRVEDFDYDLPPDRIAQVPSADRTASRLLVLYRDSGR---MEHRHFRDLVDYAVPGDALI 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNS----WSVYARPSKVIKKGDILH 116
            N+T+VI A+L GV+         ++ C L  R  P      W V  +P + +  G  L 
Sbjct: 58  LNDTRVIPARLLGVKAGGGG----QVECLLLRRDDPEQDPDLWRVLVKPGRRVHPGHRLV 113

Query: 117 FFSQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARD 176
           F    G   LEA V+D    G  L+ F  +G + E  +  +G +PLPPYI  +R    R 
Sbjct: 114 F----GDGALEAEVLDTTEEGGRLVRFRYTG-DWEDLLKRLGEMPLPPYIKERRADSGR- 167

Query: 177 YVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTD 236
              YQT YA++ GSVAAPTAGLHFT  LL +L   G++V  +TLHVG GTF PV+V   +
Sbjct: 168 ---YQTVYARVPGSVAAPTAGLHFTEELLEQLRDRGMEVGTITLHVGLGTFRPVQVARVE 224

Query: 237 DHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIF 296
           +H MH+E   I + TA+ ++ V+ RGGRI +VGTT  R LE+A        P  G+T++F
Sbjct: 225 EHHMHAEYFRIPSETAELVSRVRERGGRIWAVGTTVCRALESAALRG--WGPREGWTDLF 282

Query: 297 ITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           I PG+ FR VD L++NFHLPKSTLLMLVSA  G E+    YQ AI   YRF+S+GD  L+
Sbjct: 283 IYPGFSFRVVDRLITNFHLPKSTLLMLVSALAGREQILGAYQEAIEKGYRFFSFGDAMLI 342


>gi|229081682|ref|ZP_04214177.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           cereus Rock4-2]
 gi|229152621|ref|ZP_04280810.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           cereus m1550]
 gi|228630882|gb|EEK87522.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           cereus m1550]
 gi|228701686|gb|EEL54177.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           cereus Rock4-2]
          Length = 354

 Score =  265 bits (677), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 150/353 (42%), Positives = 209/353 (59%), Gaps = 17/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M +  FDF LP   IA  P+  R+++RLMV+         I     +D+ ++L+  D +V
Sbjct: 5   MDINLFDFHLPEELIAQVPLEERETSRLMVLDRETGD---IEHKHFTDILSYLHEGDCLV 61

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N TKV+ A+L+GV+          I   L  +   + W    +P+K +K+G ++ F   
Sbjct: 62  LNETKVMPARLHGVK----EDTGAHIEVLLLKQEEGDKWETLVKPAKRVKEGTVISF--- 114

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G+ +L+AT     + G   L FS  GI  E  +  +G +PLPPYI  K  ++ RD   Y
Sbjct: 115 -GEGKLKATCTGTADQGGRQLEFSYDGIFYE-ILDELGEMPLPPYI--KETLEDRDR--Y 168

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL +L   G+++ F+TLHVG GTF PV  +  ++H M
Sbjct: 169 QTVYAKEIGSAAAPTAGLHFTEELLEKLKQKGVQLAFITLHVGLGTFRPVSADTIEEHHM 228

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLET-ATTEDGIINPWSGFTNIFITP 299
           H+E   +   TA  LN VK  GGRI++VGTTS R LET AT  +G +   SG+T+IF+ P
Sbjct: 229 HAEYYHMSEETAALLNRVKENGGRIITVGTTSTRTLETIATDHEGKLCAASGWTDIFMYP 288

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           GY F+A+D L++NFHLPKSTL+MLVSAF   +     Y  A+   YRF+S+GD
Sbjct: 289 GYEFKAIDGLITNFHLPKSTLIMLVSAFANRDNVLHAYNEAVKEKYRFFSFGD 341


>gi|118479574|ref|YP_896725.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           thuringiensis str. Al Hakam]
 gi|118418799|gb|ABK87218.1| S-adenosylmethionine--tRNA ribosyltransferase-isomerase [Bacillus
           thuringiensis str. Al Hakam]
          Length = 354

 Score =  265 bits (676), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 150/353 (42%), Positives = 209/353 (59%), Gaps = 17/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M +  FDF LP   IA  P+  R+++RLMV+         I     +D+ ++L+  D +V
Sbjct: 5   MDINLFDFHLPEELIAQVPLEERETSRLMVLDRETGD---IEHKHFTDILSYLHEGDCLV 61

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N TKV+ A+L+GV+          I   L  +   + W    +P+K +K+G ++ F   
Sbjct: 62  LNETKVMPARLHGVK----EDTGAHIEVLLLKQEEGDKWETLVKPAKRVKEGTVISF--- 114

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G+ +L+AT     + G   L FS  GI  E  +  +G +PLPPYI  K  ++ RD   Y
Sbjct: 115 -GEGKLKATCTGTADQGGRQLEFSYDGIFYE-ILDELGEMPLPPYI--KETLEDRDR--Y 168

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL +L   G+++ F+TLHVG GTF PV  +  ++H M
Sbjct: 169 QTVYAKEIGSAAAPTAGLHFTEELLEKLKQKGVELAFITLHVGLGTFRPVSADTIEEHHM 228

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLET-ATTEDGIINPWSGFTNIFITP 299
           H+E   +   TA  LN VK  GGRI++VGTTS R LET AT  +G +   SG+T+IF+ P
Sbjct: 229 HAEYYHMSEETAALLNRVKENGGRIITVGTTSTRTLETIATDHNGKLCAASGWTDIFMYP 288

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           GY F+A+D L++NFHLPKSTL+MLVSAF   +     Y  A+   YRF+S+GD
Sbjct: 289 GYEFKAIDGLITNFHLPKSTLIMLVSAFANRDNVLHAYNEAVKEKYRFFSFGD 341


>gi|220935237|ref|YP_002514136.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Thioalkalivibrio sp. HL-EbGR7]
 gi|254764288|sp|B8GTQ5|QUEA_THISH RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|219996547|gb|ACL73149.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Thioalkalivibrio sp. HL-EbGR7]
          Length = 364

 Score =  265 bits (676), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 146/356 (41%), Positives = 215/356 (60%), Gaps = 17/356 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +F ++LPP  IA RP+  R ++RL+ +  +      ++D    DLP  LN  D +V
Sbjct: 1   MRLSDFHYELPPELIAQRPLAERSASRLLCLDRDTGA---LADRRFRDLPDLLNPGDLLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FN+T+VI A+L GV+     R E  +   L      +    + R SK   +G +L     
Sbjct: 58  FNDTRVIPARLLGVKRDTGGRVEVLVERVL----DEHRVLAHVRASKSPGEGVVLWL--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
             +  LEA V  +   G++  ++    + +   +   G +PLPPYI  +RP  A D   Y
Sbjct: 111 --EEALEAVV--EGREGDLFCLWFAGDLPVIELLERHGHMPLPPYI--ERPDAAEDRDRY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT +A   G+VAAPTAGLHF +++++R+ + G++   VTLHVGAGTF PV+VED   H+M
Sbjct: 165 QTVFASRPGAVAAPTAGLHFDADIMARMRARGVETAAVTLHVGAGTFQPVRVEDVSRHVM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           H+E   +       + + ++RGGR+V+VGTT++R LE+A   DG + P+SG T +FITPG
Sbjct: 225 HAEWTEVSTQVCDQVAACRARGGRVVAVGTTAVRSLESAAA-DGELKPFSGDTRLFITPG 283

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           Y FR VD L++NFHLP+STLLMLVSAF G E   + Y+HA++  YRF+SYGD   +
Sbjct: 284 YTFRVVDALVTNFHLPESTLLMLVSAFAGYEPVMQAYRHAVAERYRFFSYGDAMFI 339


>gi|228923170|ref|ZP_04086461.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           thuringiensis serovar huazhongensis BGSC 4BD1]
 gi|228836549|gb|EEM81899.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           thuringiensis serovar huazhongensis BGSC 4BD1]
          Length = 350

 Score =  265 bits (676), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 150/353 (42%), Positives = 209/353 (59%), Gaps = 17/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M +  FDF LP   IA  P+  R+++RLMV+         I     +D+ ++L+  D +V
Sbjct: 1   MDINLFDFHLPEELIAQVPLEDRETSRLMVLDRETGD---IEHKHFTDILSYLHEGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N TKV+ A+L+GV+          I   L  +   + W    +P+K +K+G ++ F   
Sbjct: 58  LNETKVMPARLHGVK----EDTGAHIEVLLLKQEEGDKWETLVKPAKRVKEGTVISF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G+ +L+AT     + G   L FS  GI  E  +  +G +PLPPYI  K  ++ RD   Y
Sbjct: 111 -GEGKLKATCTGTADQGGRQLEFSYDGIFYE-ILDELGEMPLPPYI--KETLEDRDR--Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL +L   G+++ F+TLHVG GTF PV  +  ++H M
Sbjct: 165 QTVYAKEIGSAAAPTAGLHFTEELLEKLKQKGVQLAFITLHVGLGTFRPVSADTIEEHHM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLET-ATTEDGIINPWSGFTNIFITP 299
           H+E   +   TA  LN VK  GGRI++VGTTS R LET AT  +G +   SG+T+IF+ P
Sbjct: 225 HAEYYHMSEETAALLNRVKENGGRIITVGTTSTRTLETIATDHEGKLCAASGWTDIFMYP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           GY F+A+D L++NFHLPKSTL+MLVSAF   +     Y  A+   YRF+S+GD
Sbjct: 285 GYEFKAIDGLITNFHLPKSTLIMLVSAFANRDNVLHAYNEAVKEKYRFFSFGD 337


>gi|229175092|ref|ZP_04302609.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           cereus MM3]
 gi|228608388|gb|EEK65693.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           cereus MM3]
          Length = 350

 Score =  265 bits (676), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 151/353 (42%), Positives = 208/353 (58%), Gaps = 17/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M +  FDF LP   IA  P+  R+++RLMV+         I     +D+ ++L+  D +V
Sbjct: 1   MDINLFDFHLPEELIAQVPLEDRETSRLMVLDRETGD---IEHKHFTDILSYLHEGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N TKV+ A+L+GV+          I   L  +   + W    +P+K +K+G ++ F   
Sbjct: 58  LNETKVMPARLHGVK----EDTGAHIEVLLLKQEEGDKWETLVKPAKRVKEGTVISF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G+ +L+AT     + G   L FS  GI  E  +  +G +PLPPYI  K  ++ RD   Y
Sbjct: 111 -GEGKLKATCTGTADQGGRHLEFSYDGIFYE-ILDELGEMPLPPYI--KETLEDRDR--Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL +L   G+ + F+TLHVG GTF PV  +  ++H M
Sbjct: 165 QTVYAKEIGSAAAPTAGLHFTEELLEKLKQKGVGLAFITLHVGLGTFRPVSADTIEEHHM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLET-ATTEDGIINPWSGFTNIFITP 299
           H+E   +   TA  LN VK  GGRI++VGTTS R LET AT  DG +   SG+T+IF+ P
Sbjct: 225 HAEYYHMSEETAALLNRVKENGGRIITVGTTSTRTLETIATDHDGKLCAASGWTDIFMYP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           GY F+A+D L++NFHLPKSTL+MLVSAF   +     Y  A+   YRF+S+GD
Sbjct: 285 GYEFKAIDGLITNFHLPKSTLIMLVSAFANRDNVLHAYNEAVKEKYRFFSFGD 337


>gi|168483957|ref|ZP_02708909.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae CDC1873-00]
 gi|172042767|gb|EDT50813.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae CDC1873-00]
          Length = 342

 Score =  265 bits (676), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 154/358 (43%), Positives = 209/358 (58%), Gaps = 17/358 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +FDF LP   IA  P+  RD+++L++V+           H + D+   L   DA+V
Sbjct: 1   MNTADFDFHLPEGLIAQTPLEKRDASKLLIVNRETGEMQDKHFHSIIDM---LEPGDALV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+V+ A+L G +          +   L    S + W V A+P+K +K G  + F   
Sbjct: 58  MNDTRVLPARLYGQKV----ETGSHVELLLLKNTSGDEWEVLAKPAKRLKVGTRISF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL A V ++   G  ++ F    I LE   SL G +PLPPYI  K  +D R+   Y
Sbjct: 111 -GDGRLSAVVTEELTHGGRIVRFEYQRIFLEVLESL-GEMPLPPYIHEK--LDDRER--Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL+ + + G+ + ++TLHVG GTF PV V++ D+H M
Sbjct: 165 QTVYAKESGSAAAPTAGLHFTKELLAEIQAKGVHLVYLTLHVGLGTFRPVSVDNLDEHEM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           HSE   +    A  L SVK  GGR+++VGTTS+R LET  ++ DG I   SG+TNIFI P
Sbjct: 225 HSEFYQLSEEAAATLRSVKENGGRVIAVGTTSIRTLETIGSKFDGQIQADSGWTNIFIKP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           GY ++ VD   +NFHLPKSTL+MLVSAF G E     Y HAI   YRF+S+GD   ++
Sbjct: 285 GYEWKVVDAFSTNFHLPKSTLVMLVSAFAGRELVLDAYHHAIQEHYRFFSFGDAMFIY 342


>gi|312901590|ref|ZP_07760862.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecalis TX0470]
 gi|311291311|gb|EFQ69867.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecalis TX0470]
          Length = 343

 Score =  265 bits (676), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 154/353 (43%), Positives = 210/353 (59%), Gaps = 17/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           +  ++FDFDLP   IA  P+  R S+RL+VV+        + D    D+   L   DA+V
Sbjct: 2   LSTEDFDFDLPEELIAQTPLKDRASSRLLVVNKETGD---MEDKHFHDILDELQPGDALV 58

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NNT+V+ A+L G +          +   L      ++W    +P+K  K G  + F   
Sbjct: 59  MNNTRVLPARLYGEK----PETGGHLEVLLLTNTEGDTWETLIKPAKRAKVGTEIQF--- 111

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL+A V ++   G  ++ F   GI LE   SL G +PLPPYI  K  +D  D   Y
Sbjct: 112 -GDGRLKAVVKEELEHGGRIIEFKYDGIFLEILESL-GEMPLPPYI--KERLDDPDR--Y 165

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YA+  GS AAPTAGLHFT  LL  + + G+ + ++TLHVG GTF PV V++ ++H M
Sbjct: 166 QTVYAEENGSAAAPTAGLHFTKELLEEIKAKGVHLVYLTLHVGLGTFRPVSVDNIEEHHM 225

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           HSE   +    A+ LN V+  GGRIV+VGTTS+R LET  T+ +G I   SG+T+IFITP
Sbjct: 226 HSEFYRLTEEAAKQLNEVRQAGGRIVAVGTTSIRTLETIGTKFNGEIQADSGWTDIFITP 285

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           GY+F+ V+   +NFHLPKSTL+MLVSAF G + T   Y+HAI   YRF+S+GD
Sbjct: 286 GYQFKVVEAFSTNFHLPKSTLVMLVSAFAGKDLTLAAYKHAIEEKYRFFSFGD 338


>gi|228902946|ref|ZP_04067087.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           thuringiensis IBL 4222]
 gi|228967494|ref|ZP_04128522.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           thuringiensis serovar sotto str. T04001]
 gi|228792209|gb|EEM39783.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           thuringiensis serovar sotto str. T04001]
 gi|228856730|gb|EEN01249.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           thuringiensis IBL 4222]
          Length = 350

 Score =  265 bits (676), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 150/353 (42%), Positives = 209/353 (59%), Gaps = 17/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M +  FDF LP   IA  P+  R+++RLMV+         I     +D+ ++L+  D +V
Sbjct: 1   MDINLFDFHLPEELIAQVPLEERETSRLMVLDRETGD---IEHKHFTDILSYLHEGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N TKV+ A+L+GV+          I   L  +   + W    +P+K +K+G ++ F   
Sbjct: 58  LNETKVMPARLHGVK----EDTGAHIEVLLLKQEEGDKWETLVKPAKRVKEGTVISF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G+ +L+AT     + G   L FS  GI  E  +  +G +PLPPYI  K  ++ RD   Y
Sbjct: 111 -GEGKLKATCTGTADQGGRQLEFSYDGIFYE-ILDELGEMPLPPYI--KETLEDRDR--Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL +L   G+++ F+TLHVG GTF PV  +  ++H M
Sbjct: 165 QTVYAKEIGSAAAPTAGLHFTEELLEKLKQKGVQLAFITLHVGLGTFRPVSADTIEEHHM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLET-ATTEDGIINPWSGFTNIFITP 299
           H+E   +   TA  LN VK  GGRI++VGTTS R LET AT  +G +   SG+T+IF+ P
Sbjct: 225 HAEYYHMSEETAALLNRVKENGGRIITVGTTSTRTLETIATDHNGKLCAASGWTDIFMYP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           GY F+A+D L++NFHLPKSTL+MLVSAF   +     Y  A+   YRF+S+GD
Sbjct: 285 GYEFKAIDGLITNFHLPKSTLIMLVSAFANRDNVLHAYNEAVKEKYRFFSFGD 337


>gi|322375519|ref|ZP_08050032.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus sp. C300]
 gi|321279782|gb|EFX56822.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus sp. C300]
          Length = 342

 Score =  265 bits (676), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 153/358 (42%), Positives = 211/358 (58%), Gaps = 17/358 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +FDF LP   IA  P+  RDS++L++V+           H + D+   L   DA+V
Sbjct: 1   MNTADFDFHLPEELIAQTPLEKRDSSKLLIVNRETGEMQDKHFHSIIDM---LEPGDALV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+V+ A+L G +          +   L    + + W V A+P+K +K G  ++F   
Sbjct: 58  MNDTRVLPARLYGQK----EETGGHVELLLLKNTAGDEWEVLAKPAKRLKVGTRVNF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL A V ++   G  ++ F   GI LE   SL G +PLPPYI  K  +D R+   Y
Sbjct: 111 -GDGRLSAVVTEELTHGGRIVRFEYQGIFLEVLESL-GEMPLPPYIHEK--LDDRER--Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL+ + + G+ + ++TLHVG GTF PV V++ D+H M
Sbjct: 165 QTVYAKESGSAAAPTAGLHFTKELLAEIQAKGVHLVYLTLHVGLGTFRPVSVDNLDEHEM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           HSE   +    A  L SVK  GGR+++VGTTS+R LET  ++ +G I   SG+TNIFI P
Sbjct: 225 HSEFYQLSEEAAATLRSVKENGGRVIAVGTTSIRTLETIGSKFNGQIQSDSGWTNIFIKP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           GY ++ VD   +NFHLPKSTL+MLVSAF G +     Y HAI   YRF+S+GD   ++
Sbjct: 285 GYDWKVVDAFSTNFHLPKSTLVMLVSAFAGRDLVLDAYHHAIQEHYRFFSFGDAMFIY 342


>gi|270292452|ref|ZP_06198663.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus sp. M143]
 gi|270278431|gb|EFA24277.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus sp. M143]
          Length = 342

 Score =  265 bits (676), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 153/358 (42%), Positives = 210/358 (58%), Gaps = 17/358 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +FDF LP   IA  P+  RD+++L++V+           H + D+   L   DA+V
Sbjct: 1   MNTADFDFHLPEELIAQTPLEKRDASKLLIVNRETGEFQDKHFHSIIDM---LEPGDALV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+V+ A+L G +          +   L    + + W V A+P+K +K G  + F   
Sbjct: 58  MNDTRVLPARLYGQK----EETGGHVELLLLKNTAGDEWEVLAKPAKRLKVGTRVSF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL A V ++   G  ++ F   GI LE   SL G +PLPPYI  K  +D R+   Y
Sbjct: 111 -GDGRLSAVVTEELTHGGRIVRFEYQGIFLEVLESL-GEMPLPPYIHEK--LDDRER--Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL+ + + G+ + ++TLHVG GTF PV V++ D+H M
Sbjct: 165 QTVYAKESGSAAAPTAGLHFTKELLAEIQAKGVHLVYLTLHVGLGTFRPVSVDNLDEHEM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           HSE   +    A  L SVK  GGR+++VGTTS+R LET  ++ DG I   SG+TNIFI P
Sbjct: 225 HSEFYQLSDEAAATLRSVKENGGRVIAVGTTSIRTLETIGSKFDGQIQADSGWTNIFIKP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           GY ++ VD   +NFHLPKSTL+MLVSAF G +     Y HAI   YRF+S+GD   ++
Sbjct: 285 GYEWKVVDAFSTNFHLPKSTLVMLVSAFAGRDLVLDAYHHAIQEHYRFFSFGDAMFIY 342


>gi|257876333|ref|ZP_05655986.1| queuosine biosynthesis protein [Enterococcus casseliflavus EC20]
 gi|257810499|gb|EEV39319.1| queuosine biosynthesis protein [Enterococcus casseliflavus EC20]
          Length = 343

 Score =  265 bits (676), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 154/357 (43%), Positives = 210/357 (58%), Gaps = 17/357 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           +  ++FDF+LP   IA  P+  R S+RL+VV           D    ++   L   DA+V
Sbjct: 2   LTTEDFDFELPEELIAQTPLSDRSSSRLLVVDRETGK---FEDKHFYNIIDELAPGDALV 58

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+V+ A++ G +          +   L   +  ++W    +P+K  K G  + F   
Sbjct: 59  MNDTRVLPARIYGEK----QETGAHLEILLLNNIEGDTWETLIKPAKRAKVGTKITF--- 111

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RLEA V ++ + G  ++ F   GI LE   SL G +PLPPYI  +      D   Y
Sbjct: 112 -GDGRLEAVVEEELDHGGRIIRFQYKGIFLEILESL-GEMPLPPYIKER----LEDPDRY 165

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL ++ + G+K+ ++TLHVG GTF PV V++  DH M
Sbjct: 166 QTVYAKENGSAAAPTAGLHFTPELLEQIAAKGVKLVYLTLHVGLGTFRPVSVDNIADHEM 225

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           HSE   +    A  LN V++ GG+IV+VGTTS+R LET  T+ DG I   SG+T+IFITP
Sbjct: 226 HSEFYRLTEEAAAQLNEVRANGGKIVAVGTTSIRTLETIGTKFDGQIKADSGWTSIFITP 285

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           GY+F+ V+   +NFHLPKSTL+MLVSAF G + T   YQHAI   YRF+S+GD   L
Sbjct: 286 GYQFKIVEAFSTNFHLPKSTLVMLVSAFAGRDLTLSAYQHAIDERYRFFSFGDAMFL 342


>gi|196044952|ref|ZP_03112186.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           cereus 03BB108]
 gi|225866399|ref|YP_002751777.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           cereus 03BB102]
 gi|254764265|sp|C1ESW2|QUEA_BACC3 RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|196024440|gb|EDX63113.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           cereus 03BB108]
 gi|225787051|gb|ACO27268.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           cereus 03BB102]
          Length = 350

 Score =  264 bits (675), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 150/353 (42%), Positives = 209/353 (59%), Gaps = 17/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M +  FDF LP   IA  P+  R+++RLMV+         I     +D+ ++L+  D +V
Sbjct: 1   MDINLFDFHLPEELIAQVPLEERETSRLMVLDRETGD---IEHKHFTDILSYLHEGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N TKV+ A+L+GV+          I   L  +   + W    +P+K +K+G ++ F   
Sbjct: 58  LNETKVMPARLHGVK----EDTGAHIEVLLLKQEEGDKWETLVKPAKRVKEGTVISF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G+ +L+AT     + G   L FS  GI  E  +  +G +PLPPYI  K  ++ RD   Y
Sbjct: 111 -GEGKLKATCTGTADQGGRQLEFSYDGIFYE-ILDELGEMPLPPYI--KETLEDRDR--Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL +L   G+++ F+TLHVG GTF PV  +  ++H M
Sbjct: 165 QTVYAKEIGSAAAPTAGLHFTEELLEKLKQKGVELAFITLHVGLGTFRPVSADTIEEHHM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLET-ATTEDGIINPWSGFTNIFITP 299
           H+E   +   TA  LN VK  GGRI++VGTTS R LET AT  +G +   SG+T+IF+ P
Sbjct: 225 HAEYYHMSEETAALLNRVKENGGRIITVGTTSTRTLETIATDHNGKLCAASGWTDIFMYP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           GY F+A+D L++NFHLPKSTL+MLVSAF   +     Y  A+   YRF+S+GD
Sbjct: 285 GYEFKAIDGLITNFHLPKSTLIMLVSAFANRDNVLHAYNEAVKEKYRFFSFGD 337


>gi|257425764|ref|ZP_05602188.1| S-adenosylmethioninetRNA ribosyltransferase-isomerase
           [Staphylococcus aureus subsp. aureus 55/2053]
 gi|257428424|ref|ZP_05604822.1| S-adenosylmethioninetRNA ribosyltransferase-isomerase
           [Staphylococcus aureus subsp. aureus 65-1322]
 gi|257431062|ref|ZP_05607441.1| S-adenosylmethioninetRNA ribosyltransferase-isomerase
           [Staphylococcus aureus subsp. aureus 68-397]
 gi|257433748|ref|ZP_05610106.1| S-adenosylmethioninetRNA ribosyltransferase-isomerase
           [Staphylococcus aureus subsp. aureus E1410]
 gi|257436663|ref|ZP_05612707.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus aureus subsp. aureus M876]
 gi|282914445|ref|ZP_06322231.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus aureus subsp. aureus M899]
 gi|282924791|ref|ZP_06332457.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus aureus subsp. aureus C101]
 gi|293503518|ref|ZP_06667365.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus aureus subsp. aureus 58-424]
 gi|293510537|ref|ZP_06669242.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus aureus subsp. aureus M809]
 gi|293537080|ref|ZP_06671760.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus aureus subsp. aureus M1015]
 gi|257271458|gb|EEV03604.1| S-adenosylmethioninetRNA ribosyltransferase-isomerase
           [Staphylococcus aureus subsp. aureus 55/2053]
 gi|257275265|gb|EEV06752.1| S-adenosylmethioninetRNA ribosyltransferase-isomerase
           [Staphylococcus aureus subsp. aureus 65-1322]
 gi|257278265|gb|EEV08907.1| S-adenosylmethioninetRNA ribosyltransferase-isomerase
           [Staphylococcus aureus subsp. aureus 68-397]
 gi|257281841|gb|EEV11978.1| S-adenosylmethioninetRNA ribosyltransferase-isomerase
           [Staphylococcus aureus subsp. aureus E1410]
 gi|257284014|gb|EEV14137.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus aureus subsp. aureus M876]
 gi|282313157|gb|EFB43553.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus aureus subsp. aureus C101]
 gi|282321626|gb|EFB51951.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus aureus subsp. aureus M899]
 gi|290919925|gb|EFD96993.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus aureus subsp. aureus M1015]
 gi|291095184|gb|EFE25449.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus aureus subsp. aureus 58-424]
 gi|291466428|gb|EFF08949.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus aureus subsp. aureus M809]
          Length = 341

 Score =  264 bits (675), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 151/357 (42%), Positives = 212/357 (59%), Gaps = 18/357 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHL-VSDLPAFLNSNDAI 59
           M ++EFD+DLP S IA  P+  RD +RL+V+            HL   D+  +    D +
Sbjct: 1   MNIEEFDYDLPESLIAQTPLKDRDHSRLLVMDRETGE----MKHLHFKDIIEYFRPGDTL 56

Query: 60  VFNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFS 119
           V N+T+V+ A+L G++         ++   +  ++  N W V  +P+K IK G+ L+F  
Sbjct: 57  VLNDTRVMPARLFGLK----EETGAKVEMLMLTQIEGNDWEVLLKPAKRIKVGNKLNF-- 110

Query: 120 QDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVD 179
             G  ++ A  I + + G  ++     GI L+ ++  +G +PLPPYI  K  +D  D   
Sbjct: 111 --GNGKIIAECIKEMDQGGRIMCLHYEGI-LQERLDELGEMPLPPYI--KERLDDPDR-- 163

Query: 180 YQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHI 239
           YQT YAK  GS AAPTAGLHFT  LL+ + + G+ + FVTLHVG GTF PV V+D +DH 
Sbjct: 164 YQTVYAKESGSAAAPTAGLHFTDELLTEIKNKGVNIAFVTLHVGLGTFRPVSVDDVNDHE 223

Query: 240 MHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITP 299
           MHSE   +   TA  LN  KS+G RI+SVGTTS R LET   +       SG+TNIFI P
Sbjct: 224 MHSEYYQMTQETADLLNDTKSKGHRIISVGTTSTRTLETIRRDHDKFVETSGWTNIFIYP 283

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           G+ F+A+D  ++NFHLPKSTL+MLVSAF   E     Y+ A++  YRF+S+GD  L+
Sbjct: 284 GFDFKAIDGQITNFHLPKSTLVMLVSAFSTRENVLNAYKTAVNLEYRFFSFGDAMLI 340


>gi|86609129|ref|YP_477891.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|86557671|gb|ABD02628.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 392

 Score =  264 bits (675), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 152/371 (40%), Positives = 214/371 (57%), Gaps = 20/371 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           ++   +D+ LPP +IA  PV PRD AR++VV+P+              LP +L   D +V
Sbjct: 27  LLTASYDYTLPPDQIAQTPVEPRDQARMLVVYPDRH-----EHRRFCHLPDYLREGDLLV 81

Query: 61  FNNTKVITAQLNGVRFCHINRREKEI--SCTLHMRVSPN-------SWSVYARPSKVIKK 111
            N+TKVI A+L G +     R E  +   C   +  +         SW V  RP K +K 
Sbjct: 82  LNDTKVIPARLFGAKEPSGARVEVLLLEPCLEGIPAAAQPLPDQAWSWRVLVRPGKRVKV 141

Query: 112 GDILHFFSQDGQ-SRLEATVID-KWNTGEILLVFSISGIE-LERQISLVGTIPLPPYI-A 167
           GD + F+S+ G  S L ATV+     TG  ++ F   G +  E  +  VG IPLPPYI A
Sbjct: 142 GDRIGFWSKQGSPSGLRATVLALDPETGGRVVQFEWEGAQPFEEILEQVGRIPLPPYIKA 201

Query: 168 RKRPIDAR-DYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGT 226
              P   +    DYQT +AK  GSVAAPTAGLHFT  LL RL   GI+  ++TL++G GT
Sbjct: 202 SGSPGSGQVRPEDYQTLWAKHPGSVAAPTAGLHFTQELLERLAQKGIQTAYITLNIGLGT 261

Query: 227 FMPVKVEDTDDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGII 286
           F PV+ E   +H +HSE   + A T  A+   ++RGGR+++VGTT +R LETA    G +
Sbjct: 262 FRPVEAERVTEHRLHSEWLKVPAETVAAIQKAQARGGRVIAVGTTVVRSLETAAA-SGTL 320

Query: 287 NPWSGFTNIFITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYR 346
            PW G +++FI PGY +R +  L++NFHLP+S+L+MLV+A  G +    +Y+ A+   YR
Sbjct: 321 QPWQGKSDLFIYPGYSWRVIQGLVTNFHLPRSSLMMLVAALIGRQRLLDLYREAVDQGYR 380

Query: 347 FYSYGDTSLLF 357
           FYS+GD  L+ 
Sbjct: 381 FYSFGDGMLIL 391


>gi|283470916|emb|CAQ50127.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus aureus subsp. aureus ST398]
          Length = 341

 Score =  264 bits (675), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 151/357 (42%), Positives = 212/357 (59%), Gaps = 18/357 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHL-VSDLPAFLNSNDAI 59
           M ++EFD+DLP S IA  P+  RD +RL+V+            HL   D+  +    D +
Sbjct: 1   MNIEEFDYDLPESLIAQTPLKDRDHSRLLVMDRETGE----MKHLHFKDIIEYFRPGDTL 56

Query: 60  VFNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFS 119
           V N+T+V+ A+L G++         ++   +  ++  N W V  +P+K IK G+ L+F  
Sbjct: 57  VLNDTRVMPARLFGLK----EETGAKVEMLMLTQIEGNDWEVLLKPAKRIKVGNKLNF-- 110

Query: 120 QDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVD 179
             G  ++ A  I + + G  ++     GI L+ ++  +G +PLPPYI  K  +D  D   
Sbjct: 111 --GNGKIIAECIKEMDQGGRIMRLHYEGI-LQERLDELGEMPLPPYI--KERLDDPDR-- 163

Query: 180 YQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHI 239
           YQT YAK  GS AAPTAGLHFT  LL+ + + G+ + FVTLHVG GTF PV V+D +DH 
Sbjct: 164 YQTVYAKESGSAAAPTAGLHFTDELLTEIKNKGVNIAFVTLHVGLGTFRPVSVDDVNDHE 223

Query: 240 MHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITP 299
           MHSE   +   TA  LN  KS+G RI+SVGTTS R LET   +       SG+TNIFI P
Sbjct: 224 MHSEYYQMTQETADLLNDTKSKGHRIISVGTTSTRTLETIRRDHDKFVETSGWTNIFIYP 283

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           G+ F+A+D  ++NFHLPKSTL+MLVSAF   E     Y+ A++  YRF+S+GD  L+
Sbjct: 284 GFDFKAIDGQITNFHLPKSTLVMLVSAFSNRENVLNAYKTAVNLEYRFFSFGDAMLI 340


>gi|229186657|ref|ZP_04313818.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           cereus BGSC 6E1]
 gi|228596916|gb|EEK54575.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           cereus BGSC 6E1]
          Length = 350

 Score =  264 bits (675), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 150/353 (42%), Positives = 209/353 (59%), Gaps = 17/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M +  FDF LP   IA  P+  R+++RLMV+         I     +D+ ++L+  D +V
Sbjct: 1   MDINLFDFHLPEELIAQVPLEERETSRLMVLDRETGD---IEHKHFTDILSYLHEGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N TKV+ A+L+GV+          I   L  +   + W    +P+K +K+G ++ F   
Sbjct: 58  LNETKVMPARLHGVK----EDTGAHIEVLLLKQEEGDKWETLVKPAKRVKEGTVISF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G+ +L+AT     + G   L FS  GI  E  +  +G +PLPPYI  K  ++ RD   Y
Sbjct: 111 -GEGKLKATCTGTADQGGRQLEFSYDGIFYE-ILDELGEMPLPPYI--KETLEDRDR--Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL +L   G+++ F+TLHVG GTF PV  +  ++H M
Sbjct: 165 QTVYAKEIGSAAAPTAGLHFTEELLEKLKQKGVELAFITLHVGLGTFRPVSADTIEEHHM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLET-ATTEDGIINPWSGFTNIFITP 299
           H+E   +   TA  LN VK  GGRI++VGTTS R LET AT  +G +   SG+T+IF+ P
Sbjct: 225 HAEYYHMSEETAALLNRVKENGGRIITVGTTSTRTLETIATDHNGKLCAASGWTDIFMYP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           GY F+A+D L++NFHLPKSTL+MLVSAF   +     Y  A+   YRF+S+GD
Sbjct: 285 GYEFKAIDGLITNFHLPKSTLIMLVSAFANRDNVLHAYNEAVKEKYRFFSFGD 337


>gi|289167559|ref|YP_003445828.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase, (queuosine
           biosynthesis protein) [Streptococcus mitis B6]
 gi|288907126|emb|CBJ21960.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase, (queuosine
           biosynthesis protein) [Streptococcus mitis B6]
          Length = 342

 Score =  264 bits (675), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 152/358 (42%), Positives = 210/358 (58%), Gaps = 17/358 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +FDF LP   IA  P+  RD+++L++V+           H + D+   L   DA+V
Sbjct: 1   MNTADFDFHLPEELIAQTPLEKRDASKLLIVNRETGEMQDKHFHSIIDM---LEPGDALV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+V+ A+L G +          +   L    + + W V A+P+K +K G  + F   
Sbjct: 58  MNDTRVLPARLYGQK----EETGGHVELLLLKNTAGDEWEVLAKPAKRLKVGTRVSF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL A V ++   G  ++ F   GI LE   SL G +PLPPYI  K  +D R+   Y
Sbjct: 111 -GDGRLSAIVTEELTHGGRIVRFEYQGIFLEVLESL-GEMPLPPYIHEK--LDDRER--Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL+ + + G+ + ++TLHVG GTF PV V++ D+H M
Sbjct: 165 QTVYAKESGSAAAPTAGLHFTKELLAEIQAKGVHLVYLTLHVGLGTFRPVSVDNLDEHEM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           HSE   +    A  L SVK  GGR+++VGTTS+R LET  ++ +G I   SG+TNIFI P
Sbjct: 225 HSEFYQLSEEAAATLRSVKENGGRVIAVGTTSIRTLETIGSKFEGQIQADSGWTNIFIKP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           GY ++ VD   +NFHLPKSTL+MLVS+F G E     Y HAI   YRF+S+GD   ++
Sbjct: 285 GYEWKVVDAFSTNFHLPKSTLVMLVSSFAGRELVLDAYHHAIQEHYRFFSFGDAMFIY 342


>gi|270308109|ref|YP_003330167.1| S-adenosylmethionine:tRNAribosyltransferase-isomerase
           [Dehalococcoides sp. VS]
 gi|270154001|gb|ACZ61839.1| S-adenosylmethionine:tRNAribosyltransferase-isomerase
           [Dehalococcoides sp. VS]
          Length = 343

 Score =  264 bits (675), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 144/359 (40%), Positives = 207/359 (57%), Gaps = 18/359 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +FD+ LP   IA +P  PRDS+RL+V++        ++  +  ++  +    D +V
Sbjct: 1   MKTSDFDYKLPQEYIAQKPAEPRDSSRLLVLNRQRG---ELTSRIFGEITEYFKPGDVLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NN++V+ A++ G++         +I   L  R   N W    +P K  K G I+     
Sbjct: 58  MNNSRVLPARIKGIK----RDTAAKIEILLLKRDGDNCWEALLKPGKRTKPGTIIDIHQH 113

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
             ++  +A V+   + G  LL FS      E  +  +G +PLPPYI    P+   +   Y
Sbjct: 114 GEETSTQAEVLADKDDGIKLLRFSD-----ETHLMKLGEVPLPPYI--HTPVSNPER--Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YA   GSVAAPTAGLHFT++LL RL  IG+   +VTLH+G  TF PVK ED  DHI+
Sbjct: 165 QTVYALTNGSVAAPTAGLHFTTDLLKRLSEIGVICTYVTLHIGLDTFRPVKEEDPKDHII 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETAT--TEDGIINPWSGFTNIFIT 298
           H E G + A TA A+   K+ G R+  VGT++ RL+E A+  +++GII P+S + ++FI 
Sbjct: 225 HREYGILSAETAAAICQAKANGKRVFCVGTSATRLVEQASSLSQNGIIEPYSDWADLFIL 284

Query: 299 PGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           PGY+FR VD  ++NFHLP+ST LML +AF G    KK Y+ AI   YRFYS+GD  L+ 
Sbjct: 285 PGYKFRVVDCFITNFHLPRSTPLMLTAAFAGWPFLKKAYEKAIHEHYRFYSFGDAMLVL 343


>gi|218899587|ref|YP_002447998.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           cereus G9842]
 gi|226736731|sp|B7IIT0|QUEA_BACC2 RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|218545497|gb|ACK97891.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           cereus G9842]
          Length = 350

 Score =  264 bits (675), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 150/353 (42%), Positives = 209/353 (59%), Gaps = 17/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M +  FDF LP   IA  P+  R+++RLMV+         I     +D+ ++L+  D +V
Sbjct: 1   MDINLFDFHLPEELIAQVPLEDRETSRLMVLDRETGD---IEHKHFTDILSYLHEGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N TKV+ A+L+GV+          I   L  +   + W    +P+K +K+G ++ F   
Sbjct: 58  LNETKVMPARLHGVK----EDTGAHIEVLLLKQEEGDKWETLVKPAKRVKEGTVISF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G+ +L+AT     + G   L FS  GI  E  +  +G +PLPPYI  K  ++ RD   Y
Sbjct: 111 -GEGKLKATCTGTADQGGRQLEFSYDGIFYE-ILDELGEMPLPPYI--KETLEDRDR--Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL +L   G+++ F+TLHVG GTF PV  +  ++H M
Sbjct: 165 QTVYAKEIGSAAAPTAGLHFTEELLEKLKQKGVQLAFITLHVGLGTFRPVSADTIEEHHM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLET-ATTEDGIINPWSGFTNIFITP 299
           H+E   +   TA  LN VK  GGRI++VGTTS R LET AT  +G +   SG+T+IF+ P
Sbjct: 225 HAEYYHMSEETAALLNRVKENGGRIITVGTTSTRTLETIATDHNGKLCAASGWTDIFMYP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           GY F+A+D L++NFHLPKSTL+MLVSAF   +     Y  A+   YRF+S+GD
Sbjct: 285 GYEFKAIDGLITNFHLPKSTLIMLVSAFANRDNVLHAYNEAVKEKYRFFSFGD 337


>gi|306829783|ref|ZP_07462972.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus mitis ATCC 6249]
 gi|304428134|gb|EFM31225.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus mitis ATCC 6249]
          Length = 342

 Score =  264 bits (675), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 153/358 (42%), Positives = 210/358 (58%), Gaps = 17/358 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +FDF LP   IA  P+  RD+++L++V+           H + D+   L   DA+V
Sbjct: 1   MNTADFDFHLPEELIAQTPLEKRDASKLLIVNRETGEFQDKHFHSIIDM---LEPGDALV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+V+ A+L G +          +   L    + + W V A+P+K +K G  ++F   
Sbjct: 58  MNDTRVLPARLYGQK----EETGGHVELLLLKNTAGDEWEVLAKPAKRLKVGTRVNF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL A V  +   G  ++ F   GI LE   SL G +PLPPYI  K  +D R+   Y
Sbjct: 111 -GDGRLSAVVTQELTHGGRIVRFEYQGIFLEVLESL-GEMPLPPYIHEK--LDDRER--Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL+ + + G+ + ++TLHVG GTF PV V++ D+H M
Sbjct: 165 QTVYAKESGSAAAPTAGLHFTKELLAEIQAKGVHLVYLTLHVGLGTFRPVSVDNLDEHEM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           HSE   +    A  L SVK  GGR+++VGTTS+R LET  ++ DG I   SG+TNIFI P
Sbjct: 225 HSEFYQLSEEAAATLRSVKENGGRVIAVGTTSIRTLETIGSKFDGQIQADSGWTNIFIKP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           GY ++ VD   +NFHLPKSTL+MLVSAF G +     Y HAI   YRF+S+GD   ++
Sbjct: 285 GYEWKFVDAFSTNFHLPKSTLVMLVSAFAGRDLVLDAYHHAIQEHYRFFSFGDAMFIY 342


>gi|319639459|ref|ZP_07994209.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Neisseria
           mucosa C102]
 gi|317399354|gb|EFV80025.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Neisseria
           mucosa C102]
          Length = 342

 Score =  264 bits (675), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 155/357 (43%), Positives = 211/357 (59%), Gaps = 20/357 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FDF+LP   IA  P   R S+RL+V  P L     I D    DLP ++   D +V
Sbjct: 1   MDISDFDFELPEKLIAQHPPEVRGSSRLLVALPTLP----IEDKHFGDLPDYVAPGDVLV 56

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FNNTKV+ A+L G +         +I   +   +  ++   + R SK  K G  L F   
Sbjct: 57  FNNTKVMKARLFGQKASG-----GKIEALIERVLDAHTALAHIRSSKSPKPGTELIF--- 108

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIE-LERQISLVGTIPLPPYIARKRPIDARDYVD 179
             +  + A ++++    E L      G + +   +   G +PLPPYI  +R  D  D   
Sbjct: 109 --EGDIRAVMLER---AEELFYLKFEGAQTVYELLEQNGHLPLPPYI--ERAADDEDDSR 161

Query: 180 YQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHI 239
           YQT YAK QG+VAAPTAGLHFT  LL RL + G++   VTLHVGAGTF PV+V+  ++H 
Sbjct: 162 YQTVYAKYQGAVAAPTAGLHFTDELLGRLKAKGVETAEVTLHVGAGTFQPVRVDKIEEHK 221

Query: 240 MHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITP 299
           MHSE   + A T  A+ + K+RG ++ +VGTTS+R LE+A  E G +    G T+IFITP
Sbjct: 222 MHSEWFDVPAETVAAVEAAKARGNKVWAVGTTSMRALESAACETGRLEAGRGDTDIFITP 281

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           GYRF   D L++NFHLPKSTLLMLVSAF G+E  + +Y+HA+   YRF+SYGD  +L
Sbjct: 282 GYRFNVADRLITNFHLPKSTLLMLVSAFSGMEHIRSVYRHAVEQEYRFFSYGDAMIL 338


>gi|225573604|ref|ZP_03782359.1| hypothetical protein RUMHYD_01798 [Blautia hydrogenotrophica DSM
           10507]
 gi|225039043|gb|EEG49289.1| hypothetical protein RUMHYD_01798 [Blautia hydrogenotrophica DSM
           10507]
          Length = 341

 Score =  264 bits (675), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 153/359 (42%), Positives = 202/359 (56%), Gaps = 22/359 (6%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +F ++LP   IA  P+  R S+RL+ +         IS     D+  +L   D +V
Sbjct: 1   MKTSDFYYELPQELIAQDPLEDRSSSRLLHLDRRTG---EISHGTFQDILTYLKPGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKE---ISCTLHMRVSPNSWSVYARPSKVIKKGDILHF 117
            N+TKVI A+L G       R+E     I   L  R   + W    +P K  K G  L F
Sbjct: 58  INDTKVIPARLFG-------RKEDTGAVIELLLLKRRENDVWETLVKPGKKAKVGTKLIF 110

Query: 118 FSQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDY 177
               G   L   ++D    G  L+ F   GI  E  +  +G +PLPPYI  K     +D 
Sbjct: 111 ----GDGILCGEILDVVEEGNRLIQFQYEGI-FEEILDQLGEMPLPPYITHK----LKDK 161

Query: 178 VDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDD 237
             YQT YAK +GS AAPTAGLHFT  LL R+  +G+K+  VTLHVG GTF PVKVED  +
Sbjct: 162 NRYQTVYAKHEGSAAAPTAGLHFTPELLQRVKEMGVKIAHVTLHVGLGTFRPVKVEDVAE 221

Query: 238 HIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFI 297
           H MHSE   ++   A  +N  K  GGR++ VGTTS R LE+AT E+G +   SG+T IFI
Sbjct: 222 HHMHSEFYVVEQEQAALVNETKRNGGRVICVGTTSCRTLESATDEEGKLQAGSGWTEIFI 281

Query: 298 TPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
            PGY+F+ +D L++NFHLP+STLLMLVSAF G E+    Y+ A+   YRF+S+GD   +
Sbjct: 282 YPGYQFKIMDGLITNFHLPESTLLMLVSAFAGKEKIMAAYKEAVRERYRFFSFGDAMFI 340


>gi|312143982|ref|YP_003995428.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Halanaerobium sp. 'sapolanicus']
 gi|311904633|gb|ADQ15074.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Halanaerobium sp. 'sapolanicus']
          Length = 347

 Score =  264 bits (674), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 149/362 (41%), Positives = 207/362 (57%), Gaps = 19/362 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M V+EFD+ LP   IA +P+  RD +RLMV+ P      +I + L  +L  +L   D ++
Sbjct: 1   MRVEEFDYQLPEELIAQKPLPERDMSRLMVLDPQNK---MIREDLFKNLKRYLEPGDRLI 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NN++VI A+L G +         EI   L   +    W V  +P +  KKG  + F   
Sbjct: 58  LNNSRVIPARLYGEKIPTGT----EIEILLLNELKEGRWEVLVKPGRRAKKGVKIQF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISG--IELERQISLVGTIPLPPYIARKRPIDARDYV 178
             Q+ LEA V++  + G  ++ FS        E  ++ +G +PLPPYI  K     R   
Sbjct: 111 --QNILEAEVLEYTDFGGRIVEFSWDDGCSSFEEILNKLGEMPLPPYINEKLDNPER--- 165

Query: 179 DYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDH 238
            YQT Y+K +GS AAPTAGLHFT  LL  L + G+K+ ++TLHVG GTF PVK E  +DH
Sbjct: 166 -YQTVYSKKRGSAAAPTAGLHFTDQLLRDLENYGVKIDYITLHVGLGTFRPVKSEKIEDH 224

Query: 239 IMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFIT 298
            MH+E   I   T   +   ++ G ++V+VGTT  R LETA  + G I  + G+T+IFI 
Sbjct: 225 KMHAEYAEISPETVARIKKTQANGNKVVAVGTTVTRTLETA-AQSGSIKAFKGWTDIFIY 283

Query: 299 PGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLFQ 358
           PGY F+ +D L++NFHLPKSTLLMLVSA  G E   K Y  A+   YRF+S GD  L+  
Sbjct: 284 PGYEFKVIDSLITNFHLPKSTLLMLVSALAGKELILKAYNQAVEEEYRFFSLGDAMLILN 343

Query: 359 KR 360
           ++
Sbjct: 344 RK 345


>gi|282919414|ref|ZP_06327149.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus aureus subsp. aureus C427]
 gi|282317224|gb|EFB47598.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus aureus subsp. aureus C427]
          Length = 341

 Score =  264 bits (674), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 151/357 (42%), Positives = 212/357 (59%), Gaps = 18/357 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHL-VSDLPAFLNSNDAI 59
           M ++EFD+DLP S IA  P+  RD +RL+V+            HL   D+  +    D +
Sbjct: 1   MNIEEFDYDLPESLIAQTPLKDRDHSRLLVMDRETGE----MKHLHFKDIIEYFRPGDTL 56

Query: 60  VFNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFS 119
           V N+T+V+ A+L G++         ++   +  ++  N W V  +P+K IK G+ L+F  
Sbjct: 57  VLNDTRVMPARLFGLK----EETGAKVEMLMLTQIEGNDWEVLLKPAKRIKVGNKLNF-- 110

Query: 120 QDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVD 179
             G  ++ A  I + + G  ++     GI L+ ++  +G +PLPPYI  K  +D  D   
Sbjct: 111 --GNDKIIAECIKEMDQGGRIMRLHYEGI-LQERLDELGEMPLPPYI--KERLDDPDR-- 163

Query: 180 YQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHI 239
           YQT YAK  GS AAPTAGLHFT  LL+ + + G+ + FVTLHVG GTF PV V+D +DH 
Sbjct: 164 YQTVYAKESGSAAAPTAGLHFTDELLTEIKNKGVNIAFVTLHVGLGTFRPVSVDDVNDHE 223

Query: 240 MHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITP 299
           MHSE   +   TA  LN  KS+G RI+SVGTTS R LET   +       SG+TNIFI P
Sbjct: 224 MHSEYYQMTQETADLLNDTKSKGHRIISVGTTSTRTLETIRRDHDKFVETSGWTNIFIYP 283

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           G+ F+A+D  ++NFHLPKSTL+MLVSAF   E     Y+ A++  YRF+S+GD  L+
Sbjct: 284 GFDFKAIDGQITNFHLPKSTLVMLVSAFSTRENVLNAYKTAVNLEYRFFSFGDAMLI 340


>gi|326204477|ref|ZP_08194334.1| LOW QUALITY PROTEIN:
           S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Clostridium papyrosolvens DSM 2782]
 gi|325985270|gb|EGD46109.1| LOW QUALITY PROTEIN:
           S-adenosylmethionine/tRNA-ribosyltransferase-isomerase
           [Clostridium papyrosolvens DSM 2782]
          Length = 340

 Score =  264 bits (674), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 153/361 (42%), Positives = 203/361 (56%), Gaps = 27/361 (7%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FD+ LP   IA  P+  RD +RLMV++        I   L +D+  +L+  D +V
Sbjct: 1   MDLHDFDYYLPEELIAQHPMEKRDMSRLMVLNKETG---EIEHKLFTDIVNYLDEGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKE-----ISCTLHMRVSPNSWSVYARPSKVIKKGDIL 115
            NNT+VI A+L G         EKE     I   L  RV  + W V  RP K  K G   
Sbjct: 58  LNNTRVIPARLLG---------EKEGTGGKIEFVLLKRVEGDKWEVILRPGKKAKPGSRF 108

Query: 116 HFFSQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDAR 175
            F    G   L+A +++  + G  L+ F   G+  E  +  VG +PLPPYI  K     R
Sbjct: 109 VF----GNGELKAEILEVLDEGNRLVRFIYDGV-FEEILDRVGIMPLPPYITEKLENPER 163

Query: 176 DYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDT 235
               YQT YAK+ GS AAPTAGLHFT  LL  L   G+K+ +V LHVG GTF PVKV+D 
Sbjct: 164 ----YQTVYAKVNGSAAAPTAGLHFTKELLDSLTRKGVKIAYVMLHVGLGTFRPVKVDDI 219

Query: 236 DDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNI 295
             H MHSE   I   T   +N  + +G ++V+VGTTS R+LET   + G I P  G+T+I
Sbjct: 220 TQHKMHSEYYSISQETCDIINDTRQKGKKVVAVGTTSCRVLETV-GKSGRIAPCDGWTDI 278

Query: 296 FITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSL 355
           FI PGYRF+ VD L++NFHLP+STL+MLVS+  G +     Y  A+   YRF+S+GD   
Sbjct: 279 FIYPGYRFKVVDRLITNFHLPESTLIMLVSSLAGRDNVMHAYNVAVEEKYRFFSFGDAMF 338

Query: 356 L 356
           +
Sbjct: 339 I 339


>gi|330998873|ref|ZP_08322600.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Parasutterella excrementihominis YIT 11859]
 gi|329576087|gb|EGG57606.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Parasutterella excrementihominis YIT 11859]
          Length = 354

 Score =  264 bits (674), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 153/361 (42%), Positives = 210/361 (58%), Gaps = 21/361 (5%)

Query: 3   VKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIVFN 62
           + +FDF+LP S IA  P+  R ++RL+ V P+ S    + D    D+   L   D +VFN
Sbjct: 8   LSDFDFELPESLIAQYPLKDRAASRLLHVKPDGS----VEDLHFRDILNLLKPGDLLVFN 63

Query: 63  NTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSV-YARPSKVIKKGDILHFFSQD 121
           NTKVI A+LNG       +    +   +  RV+    ++   R SK  K G IL+F   +
Sbjct: 64  NTKVIKARLNG------KKETGGVFEAMTERVTGTYEAISMMRASKAAKPGTILYFDHPE 117

Query: 122 GQSRLEATVIDKWNTGEIL-LVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
           G+    A V+ +   GE   L F    +E+   +   G +PLPPYI  +   +  D   Y
Sbjct: 118 GKEPARAEVLGR--EGEFFRLKFDHPVLEV---LDEYGKVPLPPYI--QHAAEKSDESRY 170

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  G+VAAPTAGLHFT  LL ++   G +  FVTLHVGAGTF PV+VE+  +H+M
Sbjct: 171 QTVYAKYPGAVAAPTAGLHFTDELLQQIRDKGCEEVFVTLHVGAGTFQPVRVENLSEHVM 230

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE--DGIINPWSGFTNIFIT 298
           HSE   I    A+ +N  K+ G R+V VGTTSLR +E + ++  +G +   S  T +FI 
Sbjct: 231 HSEWYSISPEAAEKINKAKAEGRRVVCVGTTSLRTVEASASQNPEGKVRAESADTRLFIK 290

Query: 299 PGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLFQ 358
           PGY F+  D +++NFHLPKSTL+MLVSA CG +E    Y+HA+   YRF+SYGD   L Q
Sbjct: 291 PGYEFKVCDAMVTNFHLPKSTLVMLVSALCGRDEILAAYKHAVDEKYRFFSYGDACFLEQ 350

Query: 359 K 359
           K
Sbjct: 351 K 351


>gi|315613447|ref|ZP_07888355.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus sanguinis ATCC 49296]
 gi|315314443|gb|EFU62487.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus sanguinis ATCC 49296]
          Length = 342

 Score =  264 bits (674), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 153/358 (42%), Positives = 210/358 (58%), Gaps = 17/358 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +FDF LP   IA  P+  RD+++L++V+           H + D+   L   DA+V
Sbjct: 1   MNTADFDFHLPEELIAQTPLEKRDASKLLIVNRETGEMQDKHFHSIIDM---LEPGDALV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+V+ A+L G +          +   L    + + W V A+P+K +K G  + F   
Sbjct: 58  MNDTRVLPARLYGQK----EETGGHVELLLLKNTAGDEWEVLAKPAKRLKVGTRVSF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL A V ++   G  ++ F   GI LE   SL G +PLPPYI  K  +D R+   Y
Sbjct: 111 -GDGRLSAVVTEELTHGGRIVRFEYQGIFLEVLESL-GEMPLPPYIHEK--LDDRER--Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL+ + S G+ + ++TLHVG GTF PV V++ D+H M
Sbjct: 165 QTVYAKESGSAAAPTAGLHFTKELLAEIQSKGVHLVYLTLHVGLGTFRPVSVDNLDEHEM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           HSE   +    A  L SVK  GGR+++VGTTS+R LET  ++ +G I   SG+TNIFI P
Sbjct: 225 HSEFYQLSEEAAATLRSVKENGGRVIAVGTTSIRTLETIGSKFNGQIQADSGWTNIFIKP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           GY ++ VD   +NFHLPKSTL+MLVSAF G +     Y HAI   YRF+S+GD   ++
Sbjct: 285 GYDWKVVDAFSTNFHLPKSTLVMLVSAFAGRDLVLDAYHHAIQEHYRFFSFGDAMFIY 342


>gi|325915107|ref|ZP_08177433.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Xanthomonas
           vesicatoria ATCC 35937]
 gi|325538629|gb|EGD10299.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Xanthomonas
           vesicatoria ATCC 35937]
          Length = 356

 Score =  264 bits (674), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 155/372 (41%), Positives = 217/372 (58%), Gaps = 38/372 (10%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +F++ LP   IA  P+  R ++RL+VV P    P   SD  V DLP  L   D ++
Sbjct: 1   MKKSDFNYALPEELIAQAPLAERAASRLLVVSP---APAAFSDRQVRDLPELLQPGDLLI 57

Query: 61  FNNTKVITAQLNGVRFCH------INR--REKEISCTLHMRVSPNSWSVYARPSKVIKKG 112
           FN+T+VI A+L G +         I R   E+E    +    SP + S+ A     +  G
Sbjct: 58  FNDTRVIPARLFGQKASGGRVEILIERLLGEREARVQIGASKSPKAGSLIA-----LDAG 112

Query: 113 DILHFFSQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPI 172
                  +DG+                LL F I  + LE+ +   G +PLPPYI R+  +
Sbjct: 113 GQAEVLGRDGEF--------------YLLRFEIP-LPLEQWLPEAGRLPLPPYIRREPGL 157

Query: 173 DARDYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKV 232
           + R+   YQT +A+  G+VAAPTAGLHF  +LL+RL   GI+   VTLHVGAGTF PV+V
Sbjct: 158 EDRER--YQTVFAREVGAVAAPTAGLHFDEDLLARLRERGIEFGHVTLHVGAGTFQPVRV 215

Query: 233 EDTDDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETA--TTE---DGIIN 287
           +  D H+MH E   + A   + +   ++RGGR+++VGTT +R LE+A  TTE   +G + 
Sbjct: 216 DALDQHVMHKEWLNVGAALVEQVRRTRARGGRVIAVGTTVVRSLESAWRTTEAAPEGELL 275

Query: 288 PWSGFTNIFITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRF 347
           P++G T IFI PGYR R+VD +++NFHLP+STLLM+VSAF G E   + YQHAI+  YRF
Sbjct: 276 PFAGETQIFILPGYRIRSVDAMVTNFHLPESTLLMMVSAFAGRERIFEAYQHAIAQRYRF 335

Query: 348 YSYGDTSLLFQK 359
           +SYGD  LL+ +
Sbjct: 336 FSYGDAMLLWGR 347


>gi|241664129|ref|YP_002982489.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Ralstonia
           pickettii 12D]
 gi|240866156|gb|ACS63817.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase [Ralstonia
           pickettii 12D]
          Length = 356

 Score =  264 bits (674), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 154/356 (43%), Positives = 211/356 (59%), Gaps = 17/356 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           + + +FDFDLPP  IA   +  R ++RL+ V       +   D   +DL  +L   D +V
Sbjct: 2   LTLSDFDFDLPPELIAQTALPDRTASRLLAVR-RAGDAVHFEDRQFADLVDYLRPGDLLV 60

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FN+T+VI A     RF        ++   +   +  ++     R SK   +G  L     
Sbjct: 61  FNDTRVIKA-----RFFGQKASGGKVEVLVERLLDEHTVLAQIRSSKSPVEGTTLRL--- 112

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
                 + TV  +       L F    ++L   I   G +PLPPYI  +   D+ D   Y
Sbjct: 113 --ADAFDVTVGPRAEPF-FTLRFPQPALDL---IEQYGRLPLPPYI--EHDPDSFDETRY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YA+  G+VAAPTAGLHF   L ++L ++GI+  F+TLHVGAGTF PV+VE+  +H M
Sbjct: 165 QTVYARNPGAVAAPTAGLHFDDALFAKLDAMGIQRGFLTLHVGAGTFQPVRVENIAEHRM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   I A  A+A+ + ++ GGRI++VGTTS+R LE+A   DG +N  SG T+IFITPG
Sbjct: 225 HSEWYEITAELAEAIRATRAAGGRIIAVGTTSMRALESAAQPDGTLNACSGETDIFITPG 284

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           YRFRAVD+L++NFHLPKSTLLMLVSAF G+   ++ YQHAI+  YRF+SYGD  LL
Sbjct: 285 YRFRAVDLLVTNFHLPKSTLLMLVSAFAGMSAIREAYQHAIAQRYRFFSYGDAMLL 340


>gi|15924630|ref|NP_372164.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus aureus subsp. aureus Mu50]
 gi|15927220|ref|NP_374753.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus aureus subsp. aureus N315]
 gi|21283319|ref|NP_646407.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus aureus subsp. aureus MW2]
 gi|49483884|ref|YP_041108.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus aureus subsp. aureus MRSA252]
 gi|49486473|ref|YP_043694.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus aureus subsp. aureus MSSA476]
 gi|148268120|ref|YP_001247063.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus aureus subsp. aureus JH9]
 gi|150394188|ref|YP_001316863.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus aureus subsp. aureus JH1]
 gi|156979958|ref|YP_001442217.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus aureus subsp. aureus Mu3]
 gi|253317209|ref|ZP_04840422.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus aureus subsp. aureus str. CF-Marseille]
 gi|255006425|ref|ZP_05145026.2| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus aureus subsp. aureus Mu50-omega]
 gi|258438213|ref|ZP_05689497.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus aureus A9299]
 gi|258443676|ref|ZP_05692015.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus aureus A8115]
 gi|258446883|ref|ZP_05695037.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus aureus A6300]
 gi|258448797|ref|ZP_05696909.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus aureus A6224]
 gi|258453753|ref|ZP_05701728.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus aureus A5937]
 gi|269203265|ref|YP_003282534.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus aureus subsp. aureus ED98]
 gi|282893144|ref|ZP_06301378.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus aureus A8117]
 gi|282904220|ref|ZP_06312108.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus aureus subsp. aureus C160]
 gi|282906046|ref|ZP_06313901.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus aureus subsp. aureus Btn1260]
 gi|282916908|ref|ZP_06324666.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus aureus subsp. aureus D139]
 gi|282928275|ref|ZP_06335880.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus aureus A10102]
 gi|283958400|ref|ZP_06375851.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus aureus subsp. aureus A017934/97]
 gi|295406761|ref|ZP_06816566.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus aureus A8819]
 gi|295428215|ref|ZP_06820847.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus aureus subsp. aureus EMRSA16]
 gi|296275925|ref|ZP_06858432.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus aureus subsp. aureus MR1]
 gi|297245656|ref|ZP_06929521.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus aureus A8796]
 gi|54038976|sp|P65951|QUEA_STAAN RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|54038977|sp|P65952|QUEA_STAAW RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|54041780|sp|P65950|QUEA_STAAM RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|56749512|sp|Q6G8S9|QUEA_STAAS RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|56749559|sp|Q6GG64|QUEA_STAAR RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|91207405|sp|Q2YT90|QUEA_STAAB RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|166218744|sp|A7X356|QUEA_STAA1 RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|189038882|sp|A6U2A8|QUEA_STAA2 RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|189038883|sp|A5ITG4|QUEA_STAA9 RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|13701438|dbj|BAB42732.1| S-adenosylmethionine tRNA ribosyltransferase [Staphylococcus aureus
           subsp. aureus N315]
 gi|14247412|dbj|BAB57802.1| S-adenosylmethionine tRNA ribosyltransferase [Staphylococcus aureus
           subsp. aureus Mu50]
 gi|21204759|dbj|BAB95455.1| S-adenosylmethionine tRNA ribosyltransferase [Staphylococcus aureus
           subsp. aureus MW2]
 gi|49242013|emb|CAG40711.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus aureus subsp. aureus MRSA252]
 gi|49244916|emb|CAG43377.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus aureus subsp. aureus MSSA476]
 gi|147741189|gb|ABQ49487.1| S-adenosylmethionine--tRNA-ribosyltransferase-isomerase
           [Staphylococcus aureus subsp. aureus JH9]
 gi|149946640|gb|ABR52576.1| S-adenosylmethionine--tRNA-ribosyltransferase-isomerase
           [Staphylococcus aureus subsp. aureus JH1]
 gi|156722093|dbj|BAF78510.1| S-adenosylmethionine tRNA ribosyltransferase [Staphylococcus aureus
           subsp. aureus Mu3]
 gi|257848257|gb|EEV72248.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus aureus A9299]
 gi|257851082|gb|EEV75025.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus aureus A8115]
 gi|257854458|gb|EEV77407.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus aureus A6300]
 gi|257858075|gb|EEV80964.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus aureus A6224]
 gi|257864073|gb|EEV86826.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus aureus A5937]
 gi|262075555|gb|ACY11528.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus aureus subsp. aureus ED98]
 gi|282319395|gb|EFB49747.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus aureus subsp. aureus D139]
 gi|282331338|gb|EFB60852.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus aureus subsp. aureus Btn1260]
 gi|282590082|gb|EFB95164.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus aureus A10102]
 gi|282595838|gb|EFC00802.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus aureus subsp. aureus C160]
 gi|282764462|gb|EFC04588.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus aureus A8117]
 gi|283790549|gb|EFC29366.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus aureus subsp. aureus A017934/97]
 gi|285817322|gb|ADC37809.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus aureus 04-02981]
 gi|294968508|gb|EFG44532.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus aureus A8819]
 gi|295128573|gb|EFG58207.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus aureus subsp. aureus EMRSA16]
 gi|297177307|gb|EFH36559.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus aureus A8796]
 gi|302333313|gb|ADL23506.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus aureus subsp. aureus JKD6159]
 gi|312830026|emb|CBX34868.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus aureus subsp. aureus ECT-R 2]
 gi|315129925|gb|EFT85915.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus aureus subsp. aureus CGS03]
 gi|315195543|gb|EFU25930.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus aureus subsp. aureus CGS00]
 gi|329727664|gb|EGG64120.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus aureus subsp. aureus 21172]
 gi|329733065|gb|EGG69402.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus aureus subsp. aureus 21193]
          Length = 341

 Score =  264 bits (674), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 151/357 (42%), Positives = 212/357 (59%), Gaps = 18/357 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHL-VSDLPAFLNSNDAI 59
           M ++EFD+DLP S IA  P+  RD +RL+V+            HL   D+  +    D +
Sbjct: 1   MNIEEFDYDLPESLIAQTPLKDRDHSRLLVMDRETGE----MKHLHFKDIIEYFRPGDTL 56

Query: 60  VFNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFS 119
           V N+T+V+ A+L G++         ++   +  ++  N W V  +P+K IK G+ L+F  
Sbjct: 57  VLNDTRVMPARLFGLK----EETGAKVEMLMLTQIEGNDWEVLLKPAKRIKVGNKLNF-- 110

Query: 120 QDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVD 179
             G  ++ A  I + + G  ++     GI L+ ++  +G +PLPPYI  K  +D  D   
Sbjct: 111 --GNGKIIAECIKEMDQGGRIMRLHYEGI-LQERLDELGEMPLPPYI--KERLDDPDR-- 163

Query: 180 YQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHI 239
           YQT YAK  GS AAPTAGLHFT  LL+ + + G+ + FVTLHVG GTF PV V+D +DH 
Sbjct: 164 YQTVYAKESGSAAAPTAGLHFTDELLTEIKNKGVNIAFVTLHVGLGTFRPVSVDDVNDHE 223

Query: 240 MHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITP 299
           MHSE   +   TA  LN  KS+G RI+SVGTTS R LET   +       SG+TNIFI P
Sbjct: 224 MHSEYYQMTQETADLLNDTKSKGHRIISVGTTSTRTLETIRRDHDKFVETSGWTNIFIYP 283

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           G+ F+A+D  ++NFHLPKSTL+MLVSAF   E     Y+ A++  YRF+S+GD  L+
Sbjct: 284 GFDFKAIDGQITNFHLPKSTLVMLVSAFSTRENVLNAYKTAVNLEYRFFSFGDAMLI 340


>gi|313608657|gb|EFR84503.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Listeria
           monocytogenes FSL F2-208]
          Length = 314

 Score =  263 bits (673), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 139/313 (44%), Positives = 200/313 (63%), Gaps = 14/313 (4%)

Query: 41  ISDHLVSDLPAFLNSNDAIVFNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWS 100
           I D   +++ ++LN  DA+V N+T+V+ A+L+G++    +     I   L  +   N+W 
Sbjct: 10  IKDQHFTEIISYLNEGDALVLNDTRVLPARLHGIK----DETGAHIEVLLLKQKEGNAWE 65

Query: 101 VYARPSKVIKKGDILHFFSQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTI 160
              +P+K I+KG  + F    G   L+AT +++   G  +L FS  GI  E  +  +G +
Sbjct: 66  TLVKPAKRIRKGATITF----GDGALKATCLEELEHGGRILEFSYEGIFYE-VLEQLGEM 120

Query: 161 PLPPYIARKRPIDARDYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTL 220
           PLPPYI  +     R    YQT YAK  GS AAPTAGLHFT +LL+++ + G+++ FVTL
Sbjct: 121 PLPPYIKEQLADQDR----YQTVYAKENGSAAAPTAGLHFTKDLLAKISAKGVEIIFVTL 176

Query: 221 HVGAGTFMPVKVEDTDDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLET-A 279
           HVG GTF PV VEDT +H MHSE   +   +A+ +N +K++GG++V+VGTTS+R LET A
Sbjct: 177 HVGLGTFRPVDVEDTANHKMHSEFYRLTEESAERINKIKAQGGKVVAVGTTSIRTLETIA 236

Query: 280 TTEDGIINPWSGFTNIFITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQH 339
           +  DG +   SG+T IFI+PGY F+AVD L++NFHLPKSTL+MLVSA     +    Y H
Sbjct: 237 SRHDGKLVAESGWTEIFISPGYTFQAVDALITNFHLPKSTLIMLVSALSDRTKILAAYNH 296

Query: 340 AISHAYRFYSYGD 352
           A+   YRF+S+GD
Sbjct: 297 AVEEQYRFFSFGD 309


>gi|69249043|ref|ZP_00604858.1| Queuosine biosynthesis protein [Enterococcus faecium DO]
 gi|257878859|ref|ZP_05658512.1| queuosine biosynthesis protein [Enterococcus faecium 1,230,933]
 gi|257881495|ref|ZP_05661148.1| queuosine biosynthesis protein [Enterococcus faecium 1,231,502]
 gi|257885767|ref|ZP_05665420.1| queuosine biosynthesis protein [Enterococcus faecium 1,231,501]
 gi|257890717|ref|ZP_05670370.1| queuosine biosynthesis protein [Enterococcus faecium 1,231,410]
 gi|260558424|ref|ZP_05830620.1| queuosine biosynthesis protein [Enterococcus faecium C68]
 gi|261207140|ref|ZP_05921829.1| queuosine biosynthesis protein [Enterococcus faecium TC 6]
 gi|289565261|ref|ZP_06445712.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecium D344SRF]
 gi|293556909|ref|ZP_06675470.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecium E1039]
 gi|293560279|ref|ZP_06676776.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecium E1162]
 gi|294615101|ref|ZP_06694987.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecium E1636]
 gi|294618443|ref|ZP_06698013.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecium E1679]
 gi|294620892|ref|ZP_06700093.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecium U0317]
 gi|314943499|ref|ZP_07850266.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecium TX0133C]
 gi|314991571|ref|ZP_07857047.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecium TX0133B]
 gi|314994904|ref|ZP_07860031.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecium TX0133a01]
 gi|68194302|gb|EAN08818.1| Queuosine biosynthesis protein [Enterococcus faecium DO]
 gi|257813087|gb|EEV41845.1| queuosine biosynthesis protein [Enterococcus faecium 1,230,933]
 gi|257817153|gb|EEV44481.1| queuosine biosynthesis protein [Enterococcus faecium 1,231,502]
 gi|257821623|gb|EEV48753.1| queuosine biosynthesis protein [Enterococcus faecium 1,231,501]
 gi|257827077|gb|EEV53703.1| queuosine biosynthesis protein [Enterococcus faecium 1,231,410]
 gi|260075598|gb|EEW63904.1| queuosine biosynthesis protein [Enterococcus faecium C68]
 gi|260078768|gb|EEW66470.1| queuosine biosynthesis protein [Enterococcus faecium TC 6]
 gi|289162917|gb|EFD10766.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecium D344SRF]
 gi|291592043|gb|EFF23666.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecium E1636]
 gi|291595284|gb|EFF26607.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecium E1679]
 gi|291599503|gb|EFF30519.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecium U0317]
 gi|291600993|gb|EFF31284.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecium E1039]
 gi|291605729|gb|EFF35166.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecium E1162]
 gi|313590886|gb|EFR69731.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecium TX0133a01]
 gi|313593855|gb|EFR72700.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecium TX0133B]
 gi|313597871|gb|EFR76716.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecium TX0133C]
          Length = 343

 Score =  263 bits (673), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 153/356 (42%), Positives = 207/356 (58%), Gaps = 23/356 (6%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           +  ++FDFDLP   IA  P+  RD +RL+V+         + D    ++   L   DA+V
Sbjct: 2   LTTEDFDFDLPEELIAQTPLKDRDHSRLLVLDRKTGE---MEDKHFHEIIEELQPGDALV 58

Query: 61  FNNTKVITAQLNGVR---FCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHF 117
            NNT+V+ A+L G +     H+          L      ++W    +P+K  K G  + F
Sbjct: 59  MNNTRVLPARLYGEKPDTGAHLE-------VLLLTNTQGDTWETLIKPAKRAKVGTRISF 111

Query: 118 FSQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDY 177
               G  RL+A V ++   G  ++ F   GI LE   SL G +PLPPYI  +      D 
Sbjct: 112 ----GDGRLQAVVKEELEHGGRIIDFEYEGIFLEILESL-GEMPLPPYIKER----LEDP 162

Query: 178 VDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDD 237
             YQT YAK  GS AAPTAGLHFT  LL  + + G+++ ++TLHVG GTF PV V+  ++
Sbjct: 163 DRYQTVYAKENGSAAAPTAGLHFTKELLDEIEAKGVELVYLTLHVGLGTFRPVSVDKIEE 222

Query: 238 HIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIF 296
           H MHSE   +    A+ LN V+  GG+IV+VGTTS+R LET  T+ +G I   SG+T+IF
Sbjct: 223 HHMHSEFYRLTEEAAERLNQVRKNGGKIVAVGTTSIRTLETIGTKFNGEIKADSGWTDIF 282

Query: 297 ITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           ITPGY F+ V+   +NFHLPKSTL+MLVSAF G E T   YQHAI   YRF+S+GD
Sbjct: 283 ITPGYEFKVVEAFSTNFHLPKSTLVMLVSAFAGRELTLSAYQHAIEERYRFFSFGD 338


>gi|229013635|ref|ZP_04170766.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           mycoides DSM 2048]
 gi|228747694|gb|EEL97566.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           mycoides DSM 2048]
          Length = 354

 Score =  263 bits (673), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 151/353 (42%), Positives = 207/353 (58%), Gaps = 17/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M +  FDF LP   IA  P+  R+++RLMV+         I     +D+ ++L   D +V
Sbjct: 5   MDINLFDFHLPEELIAQIPLEERETSRLMVLDRETGD---IEHKHFTDILSYLQEGDCLV 61

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N TKV+ A+L+GV+          I   L  +   + W    +P+K +K+G ++ F   
Sbjct: 62  LNETKVMPARLHGVK----EDTGAHIEVLLLKQEEGDKWETLIKPAKRVKEGTVISF--- 114

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G+ +L+AT I   + G   L FS  GI  E  +  +G +PLPPYI  K  ++ RD   Y
Sbjct: 115 -GEGKLKATCIGTADQGGRQLEFSYDGIFYE-ILDELGEMPLPPYI--KETLEDRDR--Y 168

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL +L   G+ + F+TLHVG GTF PV  +  ++H M
Sbjct: 169 QTVYAKEIGSAAAPTAGLHFTEELLEKLKQKGVGLAFITLHVGLGTFRPVSADTIEEHHM 228

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLET-ATTEDGIINPWSGFTNIFITP 299
           H+E   +   TA  LN VK  GGRI++VGTTS R LET AT   G +   SG+T+IF+ P
Sbjct: 229 HAEYYHMSEETAALLNRVKENGGRIITVGTTSTRTLETIATDNSGKLCAASGWTDIFMYP 288

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           GY F+A+D L++NFHLPKSTL+MLVSAF   +     Y  A+   YRF+S+GD
Sbjct: 289 GYEFKAIDGLITNFHLPKSTLIMLVSAFSNRDNVLHAYNEAVKEKYRFFSFGD 341


>gi|118580221|ref|YP_901471.1| S-adenosylmethionine--tRNA-ribosyltransferase-isomerase [Pelobacter
           propionicus DSM 2379]
 gi|166216735|sp|A1APZ3|QUEA_PELPD RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|118502931|gb|ABK99413.1| S-adenosylmethionine--tRNA ribosyltransferase-isomerase [Pelobacter
           propionicus DSM 2379]
          Length = 343

 Score =  263 bits (673), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 153/356 (42%), Positives = 199/356 (55%), Gaps = 20/356 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M+VKEFD+ LP   IA  P   RD +RLM+++        I   L  D+   L   D +V
Sbjct: 1   MLVKEFDYHLPEELIARYPAPERDGSRLMLLNRESG---TIGHGLFRDIADHLRPGDLLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+VI A+L G +         EI            WS   R SK ++ G ++     
Sbjct: 58  LNDTRVIPARLFGRK---ATGGRVEIFLVRRQETQAERWSCLMRSSKGMRPGQLITL--- 111

Query: 121 DGQSRLEATVIDKWNTGEILLVFSIS---GIELERQISLVGTIPLPPYIARKRPIDARDY 177
                + A V+++      LL F  +    + LER+    G +PLPPY+  +RP ++ D 
Sbjct: 112 --AGAMTALVVERLEPEGWLLEFQGAEPFSVWLERE----GEMPLPPYL--QRPAESGDQ 163

Query: 178 VDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDD 237
           + YQT +A+  G+VAAPTAGLHFT  LL RL   G+    +TLH G GTF P++VE   D
Sbjct: 164 LRYQTVFARSAGAVAAPTAGLHFTPELLERLAERGVATACLTLHTGPGTFQPLRVERVQD 223

Query: 238 HIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFI 297
           H +HSE   I A T QA+   K RGGR+V+VGTTS R LE A  E G + P SG  +IFI
Sbjct: 224 HRIHSERYHISAETCQAIAETKQRGGRVVAVGTTSARTLEYAADEKGGLCPGSGDADIFI 283

Query: 298 TPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDT 353
            PGYRFR VD L++NFHLP+STL+MLVSAF G E     Y  A    YRFYSYGD 
Sbjct: 284 YPGYRFRVVDALVTNFHLPESTLIMLVSAFAGKEYVFHAYHEAARLGYRFYSYGDA 339


>gi|229062113|ref|ZP_04199438.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           cereus AH603]
 gi|229169161|ref|ZP_04296876.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           cereus AH621]
 gi|228614389|gb|EEK71499.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           cereus AH621]
 gi|228717265|gb|EEL68940.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           cereus AH603]
          Length = 354

 Score =  263 bits (673), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 151/353 (42%), Positives = 207/353 (58%), Gaps = 17/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M +  FDF LP   IA  P+  R+++RLMV+         I     +D+ ++L   D +V
Sbjct: 5   MDINLFDFHLPEELIAQIPLEERETSRLMVLDRETGD---IEHKHFTDILSYLQEGDCLV 61

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N TKV+ A+L+GV+          I   L  +   + W    +P+K +K+G ++ F   
Sbjct: 62  LNETKVMPARLHGVK----EDTGAHIEVLLLKQEEGDKWETLIKPAKRVKEGTVISF--- 114

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G+ +L+AT I   + G   L FS  GI  E  +  +G +PLPPYI  K  ++ RD   Y
Sbjct: 115 -GEGKLKATCIGTADQGGRQLEFSYDGIFYE-ILDELGEMPLPPYI--KETLEDRDR--Y 168

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL +L   G+ + F+TLHVG GTF PV  +  ++H M
Sbjct: 169 QTVYAKEIGSAAAPTAGLHFTEELLEKLKQKGVGLAFITLHVGLGTFRPVSADTIEEHHM 228

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLET-ATTEDGIINPWSGFTNIFITP 299
           H+E   +   TA  LN VK  GGRI++VGTTS R LET AT   G +   SG+T+IF+ P
Sbjct: 229 HAEYYHMSEETAALLNRVKENGGRIITVGTTSTRTLETIATDHSGKLCAASGWTDIFMYP 288

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           GY F+A+D L++NFHLPKSTL+MLVSAF   +     Y  A+   YRF+S+GD
Sbjct: 289 GYEFKAIDGLITNFHLPKSTLIMLVSAFSNRDNVLHAYNEAVKEKYRFFSFGD 341


>gi|116515685|ref|YP_816714.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae D39]
 gi|148997530|ref|ZP_01825135.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae SP11-BS70]
 gi|168575875|ref|ZP_02721790.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae MLV-016]
 gi|46577049|sp|Q8DPA0|QUEA_STRR6 RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|122278400|sp|Q04JT4|QUEA_STRP2 RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|116076261|gb|ABJ53981.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae D39]
 gi|147756585|gb|EDK63626.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae SP11-BS70]
 gi|183578232|gb|EDT98760.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae MLV-016]
          Length = 342

 Score =  263 bits (673), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 153/358 (42%), Positives = 209/358 (58%), Gaps = 17/358 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +FDF LP   IA  P+  RD+++L++V+           H + D+   L   DA+V
Sbjct: 1   MNTADFDFHLPEELIAQTPLEKRDASKLLIVNRETGEMQDKHFHSIIDM---LEPGDALV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+V+ A+L G +          +   L    S + W V A+P+K +K G  + F   
Sbjct: 58  MNDTRVLPARLYGQKV----ETGSHVELLLLKNTSGDEWEVLAKPAKRLKVGTRISF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL A V ++   G  ++ F    I LE   SL G +PLPPYI  K  +D R+   Y
Sbjct: 111 -GDGRLSAVVTEELTHGGRIVRFEYQRIFLEVLESL-GEMPLPPYIHEK--LDDRER--Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL+ + + G+ + ++TLHVG GTF PV V++ D+H M
Sbjct: 165 QTVYAKESGSAAAPTAGLHFTKELLAEIQAKGVHLVYLTLHVGLGTFRPVSVDNLDEHEM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           HSE   +    A  L SVK  GGR+++VGTTS+R LET  ++ DG I   SG+TNIFI P
Sbjct: 225 HSEFYQLSEEAAATLRSVKENGGRVIAVGTTSIRTLETIGSKFDGQIQADSGWTNIFIKP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           GY ++ VD   +NFHLPKSTL+MLVSAF G E     Y H+I   YRF+S+GD   ++
Sbjct: 285 GYEWKVVDAFSTNFHLPKSTLVMLVSAFAGRELVLDAYHHSIQEHYRFFSFGDAMFIY 342


>gi|314938950|ref|ZP_07846215.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecium TX0133a04]
 gi|314948207|ref|ZP_07851601.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecium TX0082]
 gi|314951567|ref|ZP_07854613.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecium TX0133A]
 gi|313596261|gb|EFR75106.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecium TX0133A]
 gi|313641659|gb|EFS06239.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecium TX0133a04]
 gi|313645340|gb|EFS09920.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecium TX0082]
          Length = 347

 Score =  263 bits (673), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 153/356 (42%), Positives = 207/356 (58%), Gaps = 23/356 (6%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           +  ++FDFDLP   IA  P+  RD +RL+V+         + D    ++   L   DA+V
Sbjct: 6   LTTEDFDFDLPEELIAQTPLKDRDHSRLLVLDRKTGE---MEDKHFHEIIEELQPGDALV 62

Query: 61  FNNTKVITAQLNGVR---FCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHF 117
            NNT+V+ A+L G +     H+          L      ++W    +P+K  K G  + F
Sbjct: 63  MNNTRVLPARLYGEKPDTGAHLE-------VLLLTNTQGDTWETLIKPAKRAKVGTRISF 115

Query: 118 FSQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDY 177
               G  RL+A V ++   G  ++ F   GI LE   SL G +PLPPYI  +      D 
Sbjct: 116 ----GDGRLQAVVKEELEHGGRIIDFEYEGIFLEILESL-GEMPLPPYIKER----LEDP 166

Query: 178 VDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDD 237
             YQT YAK  GS AAPTAGLHFT  LL  + + G+++ ++TLHVG GTF PV V+  ++
Sbjct: 167 DRYQTVYAKENGSAAAPTAGLHFTKELLDEIEAKGVELVYLTLHVGLGTFRPVSVDKIEE 226

Query: 238 HIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIF 296
           H MHSE   +    A+ LN V+  GG+IV+VGTTS+R LET  T+ +G I   SG+T+IF
Sbjct: 227 HHMHSEFYRLTEEAAERLNQVRKNGGKIVAVGTTSIRTLETIGTKFNGEIKADSGWTDIF 286

Query: 297 ITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           ITPGY F+ V+   +NFHLPKSTL+MLVSAF G E T   YQHAI   YRF+S+GD
Sbjct: 287 ITPGYEFKVVEAFSTNFHLPKSTLVMLVSAFAGRELTLSAYQHAIEERYRFFSFGD 342


>gi|283770714|ref|ZP_06343606.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus aureus subsp. aureus H19]
 gi|283460861|gb|EFC07951.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus aureus subsp. aureus H19]
          Length = 341

 Score =  263 bits (673), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 149/356 (41%), Positives = 211/356 (59%), Gaps = 16/356 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M ++EFD+DLP S IA  P+  RD +RL+V+         +      D+  +    D +V
Sbjct: 1   MNIEEFDYDLPESLIAQTPLKDRDHSRLLVMDRETGEMKYLH---FKDIIEYFRPGDTLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+V+ A+L G++         ++   +  ++  N W V  +P+K IK G+ L+F   
Sbjct: 58  LNDTRVMPARLFGLK----EETGAKVEMLMLTQIEGNDWEVLLKPAKRIKVGNKLNF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  ++ A  I + + G  ++     GI L+ ++  +G +PLPPYI  K  +D  D   Y
Sbjct: 111 -GNGKIIAECIKEMDQGGRIMRLHYEGI-LQERLDELGEMPLPPYI--KERLDDPDR--Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL+ + + G+ + FVTLHVG GTF PV V+D +DH M
Sbjct: 165 QTVYAKESGSAAAPTAGLHFTDELLTEIKNKGVNIAFVTLHVGLGTFRPVSVDDVNDHEM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPG 300
           HSE   +   TA  LN  KS+G RI+SVGTTS R LET   +       SG+TNIFI PG
Sbjct: 225 HSEYYQMTQETADLLNDTKSKGHRIISVGTTSTRTLETIRRDHDKFVETSGWTNIFIYPG 284

Query: 301 YRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           + F+A+D  ++NFHLPKSTL+MLVSAF   E     Y+ A++  YRF+S+GD  L+
Sbjct: 285 FDFKAIDGQITNFHLPKSTLVMLVSAFSTRENVLNAYKTAVNLEYRFFSFGDAMLI 340


>gi|229543705|ref|ZP_04432765.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase [Bacillus
           coagulans 36D1]
 gi|229328125|gb|EEN93800.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase [Bacillus
           coagulans 36D1]
          Length = 342

 Score =  263 bits (672), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 144/357 (40%), Positives = 213/357 (59%), Gaps = 17/357 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M +  FD++LP   IA  P+  R  +RLMV+         I   +  ++  +L   D +V
Sbjct: 1   MKLDLFDYELPEELIAQTPLKNRSDSRLMVLDKKTG---EIEHSVFKNITQYLRPGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NNTKV+ A+L G++    +    +I   L  ++  + W    +P+K +K G ++ F   
Sbjct: 58  LNNTKVLPARLFGIK----DETGAKIEVLLLKQLEGDRWETLVKPAKRVKTGTVVRF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  +L A   ++ + G  ++ F   GI  E  ++ +G +PLPPYI  K  ++ +D   Y
Sbjct: 111 -GDGQLSAVCAEELDHGGRVMDFQYEGIFYE-VLNELGKMPLPPYI--KEQLEDQD--RY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL  + ++G+K+ ++TLHVG GTF PV  E+ ++H M
Sbjct: 165 QTVYAKEPGSAAAPTAGLHFTEALLKEIEAMGVKIVYITLHVGLGTFRPVNEENIENHDM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLET-ATTEDGIINPWSGFTNIFITP 299
           H+E   +    A+ +  VK  GGR+VSVGTTS R LET A+  DG I   SG+T+IFI P
Sbjct: 225 HAEFYQVSEEAARTITEVKENGGRVVSVGTTSTRTLETVASAHDGKIVASSGWTDIFIYP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           GY+++A+D L++NFHLPKSTL+M+VSA  G E     Y+ A+   YRF+S+GD  L+
Sbjct: 285 GYQYKAIDALITNFHLPKSTLIMMVSALAGRENILHAYETAVKEKYRFFSFGDAMLI 341


>gi|227550874|ref|ZP_03980923.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecium TX1330]
 gi|227179972|gb|EEI60944.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecium TX1330]
          Length = 347

 Score =  263 bits (672), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 152/353 (43%), Positives = 207/353 (58%), Gaps = 17/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           +  ++FDFDLP   IA  P+  RD +RL+V+         + D    ++   L+  DA+V
Sbjct: 6   LTTEDFDFDLPEELIAQTPLKDRDHSRLLVLDRKTGE---MKDKHFHEIIEELHPGDALV 62

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NNT+V+ A+L G +          +   L      ++W    +P+K  K G  + F   
Sbjct: 63  MNNTRVLPARLYGEK----PDTGAHLEVLLLTNTEGDTWETLIKPAKRAKVGTRISF--- 115

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL+A V ++   G  ++ F   GI LE   SL G +PLPPYI  +      D   Y
Sbjct: 116 -GDGRLQAVVKEELEHGGRIIDFEYEGIFLEILESL-GEMPLPPYIKER----LEDPDRY 169

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL  + + G+++ ++TLHVG GTF PV V+  ++H M
Sbjct: 170 QTVYAKENGSAAAPTAGLHFTKELLDEIEAKGVELVYLTLHVGLGTFRPVSVDKIEEHHM 229

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           HSE   +    A+ LN V+  GG+IV+VGTTS+R LET  T+ +G I   SG+T+IFITP
Sbjct: 230 HSEFYRLTEEAAERLNQVRKNGGKIVAVGTTSIRTLETIGTKFNGEIKADSGWTDIFITP 289

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           GY F+ V+   +NFHLPKSTL+MLVSAF G E T   YQHAI   YRF+S+GD
Sbjct: 290 GYEFKVVEAFSTNFHLPKSTLVMLVSAFAGRELTLSAYQHAIDERYRFFSFGD 342


>gi|116333839|ref|YP_795366.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Lactobacillus brevis ATCC 367]
 gi|122269474|sp|Q03R37|QUEA_LACBA RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|116099186|gb|ABJ64335.1| S-adenosylmethionine:tRNA-ribosyltransferase-isomerase (queuine
           synthetase) [Lactobacillus brevis ATCC 367]
          Length = 344

 Score =  263 bits (672), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 146/355 (41%), Positives = 214/355 (60%), Gaps = 17/355 (4%)

Query: 3   VKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIVFN 62
           + +FD+DLP   IA  P+  RD++RL+V+    +    + D    D+   L++ DA+V N
Sbjct: 5   LDDFDYDLPHELIAQTPIKQRDTSRLLVLDHQANT---LEDKHFYDILDELHAGDAVVMN 61

Query: 63  NTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQDG 122
           N++V+ A+L G++          +   L   V  + W    +P+K ++ G  + F    G
Sbjct: 62  NSRVMPARLYGIK----PETGGHVEVLLLHNVEGDVWETLMKPAKRLRVGTTVTF----G 113

Query: 123 QSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDYQT 182
             +L ATV ++   G  L+ F   GI +E  +  +G  PLPPYI  K  +D  D   YQT
Sbjct: 114 DGQLTATVTEEREDGIRLIEFHYDGIFMEI-LEQLGETPLPPYIKEK--LDDPDR--YQT 168

Query: 183 TYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIMHS 242
            YAK  GS AAPTAGLH+T  LL ++ + G+K+ ++TLHVG GTF PV+  + +DH MHS
Sbjct: 169 VYAKENGSAAAPTAGLHWTQELLDQVAAKGVKLVYITLHVGLGTFRPVEEANIEDHKMHS 228

Query: 243 EIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITPGY 301
           E   +D   A  LN V++ GGRI++ GTTS+R LET  T+  G I P SG+T+IFI PGY
Sbjct: 229 EFYRLDEAAAATLNEVRANGGRIIATGTTSIRTLETIGTKFKGEIKPDSGWTDIFIKPGY 288

Query: 302 RFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           +++ V+  ++NFHLPKSTL+MLV+AF G ++    Y HAI   YRF+S+GD   +
Sbjct: 289 QWQVVNAFITNFHLPKSTLVMLVAAFTGRDQILNAYHHAIEEKYRFFSFGDAMFI 343


>gi|163942168|ref|YP_001647052.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           weihenstephanensis KBAB4]
 gi|226713834|sp|A9VIP4|QUEA_BACWK RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|163864365|gb|ABY45424.1| S-adenosylmethionine--tRNA-ribosyltransferase-isomerase [Bacillus
           weihenstephanensis KBAB4]
          Length = 350

 Score =  263 bits (672), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 151/353 (42%), Positives = 207/353 (58%), Gaps = 17/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M +  FDF LP   IA  P+  R+++RLMV+         I     +D+ ++L   D +V
Sbjct: 1   MDINLFDFHLPEELIAQIPLEERETSRLMVLDRETGD---IEHKHFADILSYLQEGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N TKV+ A+L+GV+          I   L  +   + W    +P+K +K+G ++ F   
Sbjct: 58  LNETKVMPARLHGVK----EDTGAHIEVLLLKQEEGDKWETLIKPAKRVKEGTVISF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G+ +L+AT I   + G   L FS  GI  E  +  +G +PLPPYI  K  ++ RD   Y
Sbjct: 111 -GEGKLKATCIGTADQGGRQLEFSYDGIFYE-ILDELGEMPLPPYI--KETLEDRDR--Y 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL +L   G+ + F+TLHVG GTF PV  +  ++H M
Sbjct: 165 QTVYAKEIGSAAAPTAGLHFTEELLEKLKQKGVGLAFITLHVGLGTFRPVSADTIEEHHM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLET-ATTEDGIINPWSGFTNIFITP 299
           H+E   +   TA  LN VK  GGRI++VGTTS R LET AT   G +   SG+T+IF+ P
Sbjct: 225 HAEYYHMSEETAALLNRVKEDGGRIITVGTTSTRTLETIATDHSGKLCAASGWTDIFMYP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           GY F+A+D L++NFHLPKSTL+MLVSAF   +     Y  A+   YRF+S+GD
Sbjct: 285 GYEFKAIDGLITNFHLPKSTLIMLVSAFSNRDNVLHAYNEAVKEKYRFFSFGD 337


>gi|15673557|ref|NP_267731.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Lactococcus
           lactis subsp. lactis Il1403]
 gi|13878678|sp|Q9CFA6|QUEA_LACLA RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|12724579|gb|AAK05673.1|AE006388_4 S-adenosylmethionine tRNA ribosyltransferase [Lactococcus lactis
           subsp. lactis Il1403]
 gi|326407043|gb|ADZ64114.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Lactococcus
           lactis subsp. lactis CV56]
          Length = 345

 Score =  263 bits (672), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 150/361 (41%), Positives = 212/361 (58%), Gaps = 17/361 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FDFDLP   IA  P+  R  +RL+++ P       + D    ++   L + DA+V
Sbjct: 1   MNINDFDFDLPEELIAQTPLEKRSESRLLILDPKTEE---LEDRHFYNIIDELEAGDALV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NNT+V+ A+L+G R          I   L   +  N W   A+P++ +K G+ + F   
Sbjct: 58  LNNTRVLPARLHGER----AETGGHIELLLLKDMGQNRWETLAKPARKMKVGEEVVF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL+A V++  + G  ++ F   GI LE   SL G +PLPPYI  +     +D   Y
Sbjct: 111 -GDGRLKAVVVEVLDHGGRIVEFKYDGIFLEILESL-GEMPLPPYIHEQ----LQDQERY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT +AK  GS AAPTAGLH+T  LL ++   G+K+  +TLHVG GTF PV V++ D+H M
Sbjct: 165 QTVFAKENGSAAAPTAGLHYTPELLEKIADKGVKIVELTLHVGLGTFRPVSVDNVDEHQM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           HSE   +    A  L +VK+ G +IV+ GTTS+R LET  ++ DG I   SG+T+IFI P
Sbjct: 225 HSEFYRLTEEAAAQLRAVKASGHKIVASGTTSIRTLETIGSKFDGDIQADSGWTDIFIKP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLFQK 359
           GY ++ VD   +NFHLPKSTL+MLV+AF G +     YQHAI   YRF+S+GD   +  K
Sbjct: 285 GYEWKVVDAFNTNFHLPKSTLVMLVAAFAGRDFVLDAYQHAIDEKYRFFSFGDAMFVRPK 344

Query: 360 R 360
           +
Sbjct: 345 K 345


>gi|238020815|ref|ZP_04601241.1| hypothetical protein GCWU000324_00705 [Kingella oralis ATCC 51147]
 gi|237867795|gb|EEP68801.1| hypothetical protein GCWU000324_00705 [Kingella oralis ATCC 51147]
          Length = 340

 Score =  263 bits (672), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 156/361 (43%), Positives = 216/361 (59%), Gaps = 29/361 (8%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FDF LP   IA  P   R ++RL+V  P+   P   +D   +DLP+++N+ D +V
Sbjct: 1   MQLSDFDFTLPEHLIAQNPPATRGNSRLLVALPD--APF--TDKQFADLPSYINAGDVLV 56

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
           FNNTKV+ A+L G +         +I   +   +  ++   + R SK  K G  L F   
Sbjct: 57  FNNTKVMRARLFGQKASG-----GKIEALIERVLDAHTALAHIRSSKSPKAGAALIF--- 108

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIE-----LERQISLVGTIPLPPYIARKRPIDAR 175
           DG   + AT++++ +    L     +G E     LER     G +PLPPYI R    DA 
Sbjct: 109 DGD--IHATMLERADE---LFKIQFAGEETVYELLERH----GKLPLPPYIVRA--ADAD 157

Query: 176 DYVDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDT 235
           D   YQT YAK QG+VAAPTAGLHFT  LL  L + G++   VTLHVGAGTF PV+V++ 
Sbjct: 158 DDERYQTVYAKFQGAVAAPTAGLHFTDALLGSLKAKGVEFAEVTLHVGAGTFQPVRVDNI 217

Query: 236 DDHIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNI 295
            +H MHSE   + A T   + + K RG ++ SVGTTSLR +E+A    G +    G T+I
Sbjct: 218 AEHKMHSEWFDVPADTVAKIAAAKQRGSKVWSVGTTSLRAIESA-ARSGSLKAGQGDTDI 276

Query: 296 FITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSL 355
           FITPG+ F+ +D L++NFHLPKSTLLMLVSAF G ++ + +Y+HA+   YRF+SYGD  +
Sbjct: 277 FITPGFSFQVIDRLITNFHLPKSTLLMLVSAFSGCDKIRAVYRHAVEQEYRFFSYGDAMI 336

Query: 356 L 356
           L
Sbjct: 337 L 337


>gi|116493018|ref|YP_804753.1| S-adenosylmethionine:tRNA-ribosyltransferase-isomerase (queuine
           synthetase) [Pediococcus pentosaceus ATCC 25745]
 gi|122265518|sp|Q03ER1|QUEA_PEDPA RecName: Full=S-adenosylmethionine:tRNA
           ribosyltransferase-isomerase; AltName: Full=Queuosine
           biosynthesis protein queA
 gi|116103168|gb|ABJ68311.1| S-adenosylmethionine--tRNA ribosyltransferase-isomerase
           [Pediococcus pentosaceus ATCC 25745]
          Length = 344

 Score =  263 bits (672), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 147/357 (41%), Positives = 208/357 (58%), Gaps = 17/357 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           +  ++F++DLP   IA  P+  RD +RL+V+         + D    D+   LN  DA+V
Sbjct: 3   LTTEDFNYDLPHELIAQTPIKERDESRLLVLDHETGA---MEDKHFYDIIDQLNPGDAVV 59

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NN++V+ A++ G++    ++        L   +  + W    +P+K  K G  + F   
Sbjct: 60  MNNSRVMPARIYGIK----DKTGGHFEVLLLHNIEGDRWETLVKPAKRAKTGTKIIF--- 112

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G   L ATV  +   G   +VF   GI +E  +  +G +PLPPYI  K     R    Y
Sbjct: 113 -GDGALTATVTKELEHGGREIVFDYDGIFME-VLEKLGEMPLPPYIKEKLDDPER----Y 166

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT Y+K  GS AAPTAGLH+T  LL ++   GIK+ ++TLHVG GTF PV  ++ +DH M
Sbjct: 167 QTVYSKEPGSAAAPTAGLHWTKELLEKVEQKGIKLVYLTLHVGLGTFRPVDEDNIEDHKM 226

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           HSE   +   +A ALN VK +GGRIV+ GTTS+R LET  ++ +G I   SG+T+IFI P
Sbjct: 227 HSEFYQLSEESAAALNEVKKQGGRIVATGTTSIRTLETIGSKFNGEIKADSGWTDIFIKP 286

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           GY ++ VD  ++NFHLPKSTL+MLV+AF G E     YQHAI   YRF+S+GD   +
Sbjct: 287 GYEWKVVDAFITNFHLPKSTLVMLVAAFTGRENILNAYQHAIEEKYRFFSFGDAMFI 343


>gi|15903316|ref|NP_358866.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae R6]
 gi|307068069|ref|YP_003877035.1| S-adenosylmethionine:tRNA-ribosyltransferase- isomerase
           [Streptococcus pneumoniae AP200]
 gi|15458913|gb|AAL00077.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Streptococcus pneumoniae R6]
 gi|306409606|gb|ADM85033.1| S-adenosylmethionine:tRNA-ribosyltransferase- isomerase (queuine
           synthetase) [Streptococcus pneumoniae AP200]
          Length = 346

 Score =  263 bits (672), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 153/358 (42%), Positives = 209/358 (58%), Gaps = 17/358 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M   +FDF LP   IA  P+  RD+++L++V+           H + D+   L   DA+V
Sbjct: 5   MNTADFDFHLPEELIAQTPLEKRDASKLLIVNRETGEMQDKHFHSIIDM---LEPGDALV 61

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N+T+V+ A+L G +          +   L    S + W V A+P+K +K G  + F   
Sbjct: 62  MNDTRVLPARLYGQKV----ETGSHVELLLLKNTSGDEWEVLAKPAKRLKVGTRISF--- 114

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL A V ++   G  ++ F    I LE   SL G +PLPPYI  K  +D R+   Y
Sbjct: 115 -GDGRLSAVVTEELTHGGRIVRFEYQRIFLEVLESL-GEMPLPPYIHEK--LDDRE--RY 168

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL+ + + G+ + ++TLHVG GTF PV V++ D+H M
Sbjct: 169 QTVYAKESGSAAAPTAGLHFTKELLAEIQAKGVHLVYLTLHVGLGTFRPVSVDNLDEHEM 228

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           HSE   +    A  L SVK  GGR+++VGTTS+R LET  ++ DG I   SG+TNIFI P
Sbjct: 229 HSEFYQLSEEAAATLRSVKENGGRVIAVGTTSIRTLETIGSKFDGQIQADSGWTNIFIKP 288

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLF 357
           GY ++ VD   +NFHLPKSTL+MLVSAF G E     Y H+I   YRF+S+GD   ++
Sbjct: 289 GYEWKVVDAFSTNFHLPKSTLVMLVSAFAGRELVLDAYHHSIQEHYRFFSFGDAMFIY 346


>gi|293567788|ref|ZP_06679129.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecium E1071]
 gi|291589373|gb|EFF21180.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Enterococcus faecium E1071]
          Length = 343

 Score =  263 bits (672), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 153/356 (42%), Positives = 207/356 (58%), Gaps = 23/356 (6%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           +  ++FDFDLP   IA  P+  RD +RL+V+         + D    ++   L   DA+V
Sbjct: 2   LTTEDFDFDLPEELIAQTPLKDRDHSRLLVLDRKTGE---MEDKHFHEIIEELQPGDALV 58

Query: 61  FNNTKVITAQLNGVR---FCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHF 117
            NNT+V+ A+L G +     H+          L      ++W    +P+K  K G  + F
Sbjct: 59  MNNTRVLPARLYGEKPDTGAHLE-------VLLLTNTQGDTWETLIKPAKRAKVGTRISF 111

Query: 118 FSQDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDY 177
               G  RL+A V ++   G  ++ F   GI LE   SL G +PLPPYI  +      D 
Sbjct: 112 ----GDGRLQAVVKEELEHGGRIIDFEYEGIFLEILESL-GEMPLPPYIKER----LEDP 162

Query: 178 VDYQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDD 237
             YQT YAK  GS AAPTAGLHFT  LL  + + G+++ ++TLHVG GTF PV V+  ++
Sbjct: 163 DRYQTVYAKENGSAAAPTAGLHFTKELLDEIEAKGVELVYLTLHVGLGTFRPVSVDKIEE 222

Query: 238 HIMHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIF 296
           H MHSE   +    A+ LN V+  GG+IV+VGTTS+R LET  T+ +G I   SG+T+IF
Sbjct: 223 HHMHSEFYRLTEEAAERLNQVRKNGGKIVAVGTTSIRTLETIGTKFNGEIRADSGWTDIF 282

Query: 297 ITPGYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           ITPGY F+ V+   +NFHLPKSTL+MLVSAF G E T   YQHAI   YRF+S+GD
Sbjct: 283 ITPGYEFKVVEAFSTNFHLPKSTLVMLVSAFAGRELTLSAYQHAIEERYRFFSFGD 338


>gi|229135242|ref|ZP_04264040.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           cereus BDRD-ST196]
 gi|228648220|gb|EEL04257.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus
           cereus BDRD-ST196]
          Length = 354

 Score =  263 bits (672), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 151/353 (42%), Positives = 208/353 (58%), Gaps = 17/353 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M +  FDF LP   IA  P+  R+++RLMV+         I     +D+ ++L+  D +V
Sbjct: 5   MDINLFDFHLPEELIAQIPLEDRETSRLMVLDRETGD---IEHKHFTDILSYLHEGDCLV 61

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            N TKV+ A+L+GV+          I   L  +   + W    +P+K +K+G ++ F   
Sbjct: 62  LNETKVMPARLHGVK----EDTGAHIEVLLLKQEEGDKWETLIKPAKRVKEGTVISF--- 114

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G+ +L+AT I   + G   L FS  GI  E  +  +G +PLPPYI  K  ++ RD   Y
Sbjct: 115 -GEGKLKATCIGTADQGGRQLEFSYDGIFYE-ILDELGEMPLPPYI--KETLEDRDR--Y 168

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT YAK  GS AAPTAGLHFT  LL +L   G+ + F+TLHVG GTF PV  +  ++H M
Sbjct: 169 QTVYAKEIGSAAAPTAGLHFTEELLEKLKQKGVGLAFITLHVGLGTFRPVSADTIEEHHM 228

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLET-ATTEDGIINPWSGFTNIFITP 299
           H+E   +   TA  LN VK  GGRI++VGTTS R LET AT   G +   SG+T+IF+ P
Sbjct: 229 HAEYYHMSEETAALLNRVKENGGRIITVGTTSTRTLETIATDHSGKLCAASGWTDIFMYP 288

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGD 352
           GY F+A+D L++NFHLPKSTL+MLVSAF   +     Y  A+   YRF+S+GD
Sbjct: 289 GYEFKAIDGLITNFHLPKSTLIMLVSAFSNRDNVLHAYNEAVKEKYRFFSFGD 341


>gi|281492155|ref|YP_003354135.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Lactococcus
           lactis subsp. lactis KF147]
 gi|281375826|gb|ADA65320.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Lactococcus
           lactis subsp. lactis KF147]
          Length = 345

 Score =  263 bits (672), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 150/361 (41%), Positives = 212/361 (58%), Gaps = 17/361 (4%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FDFDLP   IA  P+  R  +RL+++ P       + D    ++   L + DA+V
Sbjct: 1   MNINDFDFDLPEELIAQTPLEKRSESRLLILDPKTEE---LEDRHFYNIIDELETGDALV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQ 120
            NNT+V+ A+L+G R          I   L   +  N W   A+P++ +K G+ + F   
Sbjct: 58  LNNTRVLPARLHGER----AETGGHIELLLLKDMGQNRWETLAKPARKMKVGEEVVF--- 110

Query: 121 DGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDY 180
            G  RL+A V++  + G  ++ F  +GI LE   SL G +PLPPYI  +      D   Y
Sbjct: 111 -GDGRLKAVVVEVLDHGGRIVEFKYNGIFLEILESL-GEMPLPPYIHEQ----LEDQERY 164

Query: 181 QTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIM 240
           QT +AK  GS AAPTAGLH+T  LL ++   G+K+  +TLHVG GTF PV V++ D+H M
Sbjct: 165 QTVFAKENGSAAAPTAGLHYTPELLEKIADKGVKIVELTLHVGLGTFRPVSVDNVDEHQM 224

Query: 241 HSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTE-DGIINPWSGFTNIFITP 299
           HSE   +    A  L +VK+ G +IV+ GTTS+R LET  ++ DG I   SG+T+IFI P
Sbjct: 225 HSEFYRLTEEAAAQLRAVKASGHKIVASGTTSIRTLETIGSKFDGDIQADSGWTDIFIKP 284

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLLFQK 359
           GY ++ VD   +NFHLPKSTL+MLV+AF G +     YQHAI   YRF+S+GD   +  K
Sbjct: 285 GYEWKVVDAFNTNFHLPKSTLVMLVAAFAGRDFVLDAYQHAIDEKYRFFSFGDAMFVRPK 344

Query: 360 R 360
           +
Sbjct: 345 K 345


>gi|297207639|ref|ZP_06924074.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus aureus subsp. aureus ATCC 51811]
 gi|296887656|gb|EFH26554.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus aureus subsp. aureus ATCC 51811]
          Length = 347

 Score =  263 bits (672), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 150/355 (42%), Positives = 211/355 (59%), Gaps = 18/355 (5%)

Query: 3   VKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHL-VSDLPAFLNSNDAIVF 61
           ++EFD+DLP S IA  P+  RD +RL+V+            HL   D+  +    D +V 
Sbjct: 9   IEEFDYDLPESLIAQTPLKDRDHSRLLVMDRETGE----MKHLHFKDIIEYFRPGDTLVL 64

Query: 62  NNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFSQD 121
           N+T+V+ A+L G++         ++   +  ++  N W V  +P+K IK G+ L+F    
Sbjct: 65  NDTRVMPARLFGLK----EETGAKVEMLMLTQIEGNDWEVLLKPAKRIKVGNKLNF---- 116

Query: 122 GQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVDYQ 181
           G  ++ A  I + + G  ++     GI L+ ++  +G +PLPPYI  K  +D  D   YQ
Sbjct: 117 GNGKIIAECIKEMDQGGRIMRLHYEGI-LQERLDELGEMPLPPYI--KERLDDPDR--YQ 171

Query: 182 TTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIMH 241
           T YAK  GS AAPTAGLHFT  LL+ + + G+ + FVTLHVG GTF PV V+D +DH MH
Sbjct: 172 TVYAKESGSAAAPTAGLHFTDELLTEIKNKGVNIAFVTLHVGLGTFRPVSVDDVNDHEMH 231

Query: 242 SEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITPGY 301
           SE   +   TA  LN  KS+G RI+SVGTTS R LET   +       SG+TNIFI PG+
Sbjct: 232 SEYYQMTQETADLLNDTKSKGHRIISVGTTSTRTLETIRRDHDKFVEMSGWTNIFIYPGF 291

Query: 302 RFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
            F+A+D  ++NFHLPKSTL+MLVSAF   E     Y+ A++  YRF+S+GD  L+
Sbjct: 292 DFKAIDGQITNFHLPKSTLVMLVSAFSTRENVLNAYKTAVNLEYRFFSFGDAMLI 346


>gi|323440807|gb|EGA98516.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus aureus O11]
 gi|323442844|gb|EGB00469.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
           [Staphylococcus aureus O46]
          Length = 341

 Score =  263 bits (672), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 151/357 (42%), Positives = 212/357 (59%), Gaps = 18/357 (5%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHL-VSDLPAFLNSNDAI 59
           M ++EFD+DLP S IA  P+  RD +RL+V+            HL   D+  +    D +
Sbjct: 1   MNIEEFDYDLPESLIAQTPLKDRDHSRLLVMDRETGE----MKHLHFKDIIEYFRPGDTL 56

Query: 60  VFNNTKVITAQLNGVRFCHINRREKEISCTLHMRVSPNSWSVYARPSKVIKKGDILHFFS 119
           V N+T+V+ A+L G++         ++   +  ++  N W V  +P+K IK G+ L+F  
Sbjct: 57  VLNDTRVMPARLFGLK----EETGAKVEMLMLTQIEGNDWEVLLKPAKRIKVGNKLNF-- 110

Query: 120 QDGQSRLEATVIDKWNTGEILLVFSISGIELERQISLVGTIPLPPYIARKRPIDARDYVD 179
             G  ++ A  I + + G  ++     GI L+ ++  +G +PLPPYI  K  +D  D   
Sbjct: 111 --GNGKIIAECIKEMDQGGRIMRLHYEGI-LQERLDELGEMPLPPYI--KERLDDPDR-- 163

Query: 180 YQTTYAKIQGSVAAPTAGLHFTSNLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHI 239
           YQT YAK  GS AAPTAGLHFT  LL+ + + G+ + FVTLHVG GTF PV V+D +DH 
Sbjct: 164 YQTVYAKESGSAAAPTAGLHFTDELLTEIKNKGVNIAFVTLHVGLGTFRPVSVDDVNDHE 223

Query: 240 MHSEIGFIDAPTAQALNSVKSRGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFITP 299
           MHSE   +   TA  LN  KS+G RI+SVGTTS R LET   +       SG+TNIFI P
Sbjct: 224 MHSEYYQMTQETADLLNDTKSKGHRIISVGTTSTRTLETIRRDYDKFVETSGWTNIFIYP 283

Query: 300 GYRFRAVDILMSNFHLPKSTLLMLVSAFCGIEETKKMYQHAISHAYRFYSYGDTSLL 356
           G+ F+A+D  ++NFHLPKSTL+MLVSAF   E     Y+ A++  YRF+S+GD  L+
Sbjct: 284 GFDFKAIDGQITNFHLPKSTLVMLVSAFSTRENVLNAYKTAVNLEYRFFSFGDAMLI 340


>gi|220927982|ref|YP_002504891.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Clostridium
           cellulolyticum H10]
 gi|219998310|gb|ACL74911.1| S-adenosylmethionine/tRNA-ribosyltransferase-isomerase [Clostridium
           cellulolyticum H10]
          Length = 340

 Score =  263 bits (672), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 153/361 (42%), Positives = 203/361 (56%), Gaps = 27/361 (7%)

Query: 1   MMVKEFDFDLPPSRIALRPVFPRDSARLMVVHPNLSCPLVISDHLVSDLPAFLNSNDAIV 60
           M + +FD+ LP   IA  P+  RD +RLMV+         I   L  DL  +L+  D +V
Sbjct: 1   MNLHDFDYYLPEELIAQHPLEKRDMSRLMVLDKQTG---EIEHKLFKDLFNYLDEGDCLV 57

Query: 61  FNNTKVITAQLNGVRFCHINRREKE-----ISCTLHMRVSPNSWSVYARPSKVIKKGDIL 115
            NNT+VI A+L G         EKE     I   L  RV  ++W V  RP K  K G   
Sbjct: 58